Stabilizer of axonemal microtubules 1

Overview
NameStabilizer of axonemal microtubules 1
Smed IDSMED30028223
Uniprot Best hitStabilizer of axonemal microtubules 1 OS=Homo sapiens OX=9606 GN=SAXO1 PE=1 SV=2 (E=1.68635e-49)
Length (bp)1684
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Stabilizer of axonemal microtubules 1 (SMED30028223) t-SNE clustered cells

Violin plots show distribution of expression levels for Stabilizer of axonemal microtubules 1 (SMED30028223) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Stabilizer of axonemal microtubules 1 (SMED30028223) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Stabilizer of axonemal microtubules 1 (SMED30028223) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028223

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30028223SMESG000042230.1 SmedASXL_012531SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30028223SMESG000042230.1 dd_Smed_v4_5551_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30028223SMESG000042230.1 dd_Smed_v4_5551_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30028223SMESG000042230.1 dd_Smed_v4_5551_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30028223SMESG000042230.1 dd_Smed_v4_5551_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30028223SMESG000042230.1 dd_Smed_v6_5551_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30028223SMESG000042230.1 dd_Smed_v4_5551_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30028223SMESG000042230.1 dd_Smed_v4_5551_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30028223SMESG000042230.1 dd_Smed_v4_5551_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Stabilizer of axonemal microtubules 1 vs. Ensembl Human
Match: SAXO1 (stabilizer of axonemal microtubules 1 [Source:HGNC Symbol;Acc:HGNC:28566])

HSP 1 Score: 181.415 bits (459), Expect = 3.512e-50
Identity = 139/461 (30.15%), Postives = 210/461 (45.55%), Query Frame = 1
Query:  154 CICKICCCGRHHCPHQP--IRSNASGPCVLSEYTNKYT-PHQINPVHSFKPLANYTRNPEPLEDKTNHRIDYVPHALEKKYVHQREPYKPSEGEFEKNTTYTSEFNPKHGEKAMMFK-RNPERRELGKFEGTPTYKADYPGWLASPREVHGKPAEWIPPSETFNGIPTYSSDYVKYKSTKPRESFRPHQETQIPNVPFQDMTENRESYIQHPVEQRKIKDQSEWFRPV-VPFTGESTFSSDFKEKPLGLNRSYKPPAIAKLSSEPLQNETTHNSDYKPWGVEKPYLHQSERYNPPEGSMMTDTTYLRDFLPRRTERVLAFRPKDNRESIGQFSSKTSYSDDFQKWNIAARQRFGPNREYIPSDIPFENRTTHGTHFVP-MPLSIRQSFKQSNQTHLSNEPFNGESIYRTEYAPKEVDVCPTFFMGSPRATYEFTGEVDNKGHLLVSPRKMDEMEKQTEVAV 1518
            CIC++C CGRHHCPH P  I      PC+LSEYT  Y   H   P  SFKP   Y + P P+E  T  R D+ PH +    VHQ + + PSE   +  TTY  ++NP    +    K R+ +     K E  PTYKADY  W    RE      ++ P S  F+   T+  DY   K      S +P    ++ N+P +D+T  + SY+ HPVE+R +  ++E FRP  +PF   +T    ++       +S KP A       P  N T     Y+ W + + +      Y PPE  M   TT    +   +     + RP    +  G+F   ++  DD+++W+    +   P  +      P +  TT   H+VP +P++ + S K        N P   ++ Y   + PKE+  C   +   P  T+E   EVD  GH +  P      ++ + ++V
Sbjct:    5 CICELCSCGRHHCPHLPTKIYDKTEKPCLLSEYTENYPFYHSYLPRESFKPRREYQKGPIPMEGLTTSRRDFGPHKVAPVKVHQYDQFVPSEENMDLLTTYKKDYNPYPVCRVDPIKPRDSKYPCSDKMECLPTYKADYLPWNQPRREPLRLEHKYQPASVRFDNRTTHQDDY-PIKGLVKTISCKPLAMPKLCNIPLEDVTNYKMSYVAHPVEKRFVH-EAEKFRPCEIPFESLTTQKQSYRGLMGEPAKSLKPLARPPGLDMPFCNTTEFRDKYQAWPMPRMFSKAPITYVPPEDRMDLLTTVQAHYTCPKGAPAQSCRPALQIKKCGRFEGSSTTKDDYKQWSSMRTEPVKPVPQLDLPTEPLDCLTTTRAHYVPHLPINTK-SCKPHWSGPRGNVPVESQTTYTISFTPKEMGRCLASYPEPPGYTFE---EVDALGHRIYKPVSQAGSQQSSHLSV 459          
BLAST of Stabilizer of axonemal microtubules 1 vs. Ensembl Human
Match: SAXO2 (stabilizer of axonemal microtubules 2 [Source:HGNC Symbol;Acc:HGNC:33727])

HSP 1 Score: 140.584 bits (353), Expect = 4.928e-36
Identity = 103/373 (27.61%), Postives = 175/373 (46.92%), Query Frame = 1
Query:  355 DYVPHALEKKYVHQREPYKPSEGEFEKNTTYTSEFNPKHGEKAMMFKRNPERRELGKFEGTPTYKADYPGWLASPREVHGKPAEWIPPSETFNGIPTYSSDYVKYKSTKPRESFRPHQETQIPNVPFQDMTENRESYIQHPVEQRKIKDQSEWFRPVVP-FTGESTFSSDFKEKPLGLNRSYKPPAIAKLSSEPL-QNETTHNSDYKPWGVEKPYLHQSERYNPPEGSMMTDTTYLRDFLPRRTERVLAFRPKDNRESIG-QFSSKTSYSDDFQKWNIAARQRFGPNREYIPS-DIPFENRTTHGTHFVPMPLSIRQSFKQSNQTHLSNEPFNGESIYRTEYAPKEVDVCPTFFMGSPRATYEFTGEVDNKGH 1461
            DY P+ + K+  H  E YKP +G+ +  TTY  + N    +   + +    + + GK +  PTYK DY  W     E++     + PP+  F    T+  D+V  +  KPR+SF+P    +    PF  +T +R  YI H +E  K +   E ++P    F   +T   DF +  +G       P   +++   L +  T     ++PW +  P + +   Y PP GSM+ ++T   D++P +   V+  RP   + S    F  K+   +DF  W  + RQ     ++ IP+    F+  +T  +H+VP  L   +S K  N    S+ PF+  ++Y  EY PK  ++CP  +   P   ++ T   +++GH
Sbjct:   20 DYCPYEIVKQPRHVPEEYKPKQGKIDLGTTYKRDLNSYKVQPVAIVRPLERQVKKGKLDTVPTYKDDYRAWDLHKSELYKPEQTYHPPTVKFGNSTTFQDDFVP-QEIKPRQSFKPSSVVKRSTAPFNGITSHRLDYIPHQLE-LKFERPKEVYKPTDQRFEDLTTHRCDF-QGLIGETAKLCRPVHTRVTQNALFEGSTEFRESFQPWEIPPPEVKKVPEYVPPTGSMLLNSTSHLDYVPYQANHVVPIRPVSQKRSNNFPFQGKSIMKEDFPAWE-SCRQGLIKKQQQIPNPSGKFDGLSTFRSHYVPHELIPTESCKPLNIAFKSSVPFDDVTMYSVEYTPKRQEICPASYPSPPGYIFDNT---NSQGH 385          

HSP 2 Score: 103.99 bits (258), Expect = 2.408e-23
Identity = 78/247 (31.58%), Postives = 118/247 (47.77%), Query Frame = 1
Query:  238 SEYTNKYTPHQINPVHSFKPLANYTRNPEPLEDKTNHRIDYVPHALEKKYVHQREPYKPSEGEFEKNTTYTSEFNPKHGEKAMMFKRNPER-RELGKFEGTPTYKADYPGWLASPREVHGKPAEWIPPSETFNGIPTYSSDYVKYKSTKPRESFRPHQETQIPNVPFQDMTENRESY-IQHPVEQRKIKDQSEWFRPVVPFTGESTFSSDFKEKPLGLNRSYKPPAIAKLSSEPLQNETTHNSDYKP 972
            + + + + P +I P  SFKP +   R+  P    T+HR+DY+PH LE K+   +E YKP++  FE  TT+  +F    GE A + +    R  +   FEG+  ++  +  W   P EV   P E++PP+ +     T   DYV Y++       RP  + +  N PFQ  +  +E +       Q  IK Q +   P   F G STF S +    L    S KP  IA  SS P  + T ++ +Y P
Sbjct:  115 TTFQDDFVPQEIKPRQSFKPSSVVKRSTAPFNGITSHRLDYIPHQLELKFERPKEVYKPTDQRFEDLTTHRCDFQGLIGETAKLCRPVHTRVTQNALFEGSTEFRESFQPWEIPPPEVKKVP-EYVPPTGSMLLNSTSHLDYVPYQANH-VVPIRPVSQKRSNNFPFQGKSIMKEDFPAWESCRQGLIKKQQQIPNPSGKFDGLSTFRSHYVPHELIPTESCKPLNIAFKSSVPFDDVTMYSVEYTP 359          

HSP 3 Score: 88.9669 bits (219), Expect = 2.209e-18
Identity = 49/157 (31.21%), Postives = 79/157 (50.32%), Query Frame = 1
Query:  919 LSSEPLQNETTHNSDYKPWGVEKPYLHQSERYNPPEGSMMTDTTYLRDFLPRRTERVLAFRPKDNRESIGQFSSKTSYSDDFQKWNIAARQRFGPNREYIPSDIPFENRTTHGTHFVPMPLSIRQSFKQSNQTHLSNEPFNGESIYRTEYAPKEVDV 1389
            + S  L    +  SDY P+ + K   H  E Y P +G +   TTY RD    + + V   RP + +   G+  +  +Y DD++ W++   + + P + Y P  + F N TT    FVP  +  RQSFK S+    S  PFNG + +R +Y P ++++
Sbjct:    6 MRSWCLCQICSCGSDYCPYEIVKQPRHVPEEYKPKQGKIDLGTTYKRDLNSYKVQPVAIVRPLERQVKKGKLDTVPTYKDDYRAWDLHKSELYKPEQTYHPPTVKFGNSTTFQDDFVPQEIKPRQSFKPSSVVKRSTAPFNGITSHRLDYIPHQLEL 162          
BLAST of Stabilizer of axonemal microtubules 1 vs. Ensembl Human
Match: SAXO1 (stabilizer of axonemal microtubules 1 [Source:HGNC Symbol;Acc:HGNC:28566])

HSP 1 Score: 123.635 bits (309), Expect = 5.382e-30
Identity = 108/400 (27.00%), Postives = 175/400 (43.75%), Query Frame = 1
Query:  328 LEDKTNHRIDYVPHALEKKYVHQREPYKPSEGEFEKNTTYTSEFNPKHGEKAMMFK-RNPERRELGKFEGTPTYKADYPGWLASPREVHGKPAEWIPPSETFNGIPTYSSDYVKYKSTKPRESFRPHQETQIPNVPFQDMTENRESYIQHPVEQRKIKDQSEWFRPV-VPFTGESTFSSDFKEKPLGLNRSYKPPAIAKLSSEPLQNETTHNSDYKPWGVEKPYLHQSERYNPPEGSMMTDTTYLRDFLPRRTERVLAFRPKDNRESIGQFSSKTSYSDDFQKWNIAARQRFGPNREYIPSDIPFENRTTHGTHFVP-MPLSIRQSFKQSNQTHLSNEPFNGESIYRTEYAPKEVDVCPTFFMGSPRATYEFTGEVDNKGHLLVSPRKMDEMEKQTEVAV 1518
            +E  T  R D+ PH +    VHQ + + PSE   +  TTY  ++NP    +    K R+ +     K E  PTYKADY  W    RE      ++ P S  F+   T+  DY   K      S +P    ++ N+P +D+T  + SY+ HPVE+R +  ++E FRP  +PF   +T    ++       +S KP A       P  N T     Y+ W + + +      Y PPE  M   TT    +   +     + RP    +  G+F   ++  DD+++W+    +   P  +      P +  TT   H+VP +P++ + S K        N P   ++ Y   + PKE+  C   +   P  T+E   EVD  GH +  P      ++ + ++V
Sbjct:    1 MEGLTTSRRDFGPHKVAPVKVHQYDQFVPSEENMDLLTTYKKDYNPYPVCRVDPIKPRDSKYPCSDKMECLPTYKADYLPWNQPRREPLRLEHKYQPASVRFDNRTTHQDDY-PIKGLVKTISCKPLAMPKLCNIPLEDVTNYKMSYVAHPVEKRFVH-EAEKFRPCEIPFESLTTQKQSYRGLMGEPAKSLKPLARPPGLDMPFCNTTEFRDKYQAWPMPRMFSKAPITYVPPEDRMDLLTTVQAHYTCPKGAPAQSCRPALQIKKCGRFEGSSTTKDDYKQWSSMRTEPVKPVPQLDLPTEPLDCLTTTRAHYVPHLPINTK-SCKPHWSGPRGNVPVESQTTYTISFTPKEMGRCLASYPEPPGYTFE---EVDALGHRIYKPVSQAGSQQSSHLSV 394          

HSP 2 Score: 72.0182 bits (175), Expect = 7.765e-13
Identity = 64/236 (27.12%), Postives = 94/236 (39.83%), Query Frame = 1
Query:  286 SFKPLANYTRNPEPLEDKTNHRIDYVPHALEKKYVHQREPYKPSEGEFEKNTTYTSEFNPKHGEKAMMFKRNPERRELGK---FEGTPTYKADYPGWLASPREVHGKPAEWIPPSE---------------------------------TFNGIPTYSSDYVKYKSTKPRESFRPHQETQIPNVPFQDMTENRESYIQH-PVEQRKIKDQSEWFRPVVPFTGESTFSSDFKEKPLG 882
            S KPLA       PLED TN+++ YV H +EK++VH+ E ++P E  FE  TT    +    GE A   K  P  R  G    F  T  ++  Y  W   PR     P  ++PP +                                  F G  T   DY ++ S +  E  +P  +  +P  P   +T  R  Y+ H P+  +  K      R  VP   ++T++  F  K +G
Sbjct:  122 SCKPLAMPKLCNIPLEDVTNYKMSYVAHPVEKRFVHEAEKFRPCEIPFESLTTQKQSYRGLMGEPAKSLK--PLARPPGLDMPFCNTTEFRDKYQAW-PMPRMFSKAPITYVPPEDRMDLLTTVQAHYTCPKGAPAQSCRPALQIKKCGRFEGSSTTKDDYKQWSSMR-TEPVKPVPQLDLPTEPLDCLTTTRAHYVPHLPINTKSCKPHWSGPRGNVPVESQTTYTISFTPKEMG 353          
BLAST of Stabilizer of axonemal microtubules 1 vs. Ensembl Human
Match: SAXO1 (stabilizer of axonemal microtubules 1 [Source:HGNC Symbol;Acc:HGNC:28566])

HSP 1 Score: 123.635 bits (309), Expect = 5.382e-30
Identity = 108/400 (27.00%), Postives = 175/400 (43.75%), Query Frame = 1
Query:  328 LEDKTNHRIDYVPHALEKKYVHQREPYKPSEGEFEKNTTYTSEFNPKHGEKAMMFK-RNPERRELGKFEGTPTYKADYPGWLASPREVHGKPAEWIPPSETFNGIPTYSSDYVKYKSTKPRESFRPHQETQIPNVPFQDMTENRESYIQHPVEQRKIKDQSEWFRPV-VPFTGESTFSSDFKEKPLGLNRSYKPPAIAKLSSEPLQNETTHNSDYKPWGVEKPYLHQSERYNPPEGSMMTDTTYLRDFLPRRTERVLAFRPKDNRESIGQFSSKTSYSDDFQKWNIAARQRFGPNREYIPSDIPFENRTTHGTHFVP-MPLSIRQSFKQSNQTHLSNEPFNGESIYRTEYAPKEVDVCPTFFMGSPRATYEFTGEVDNKGHLLVSPRKMDEMEKQTEVAV 1518
            +E  T  R D+ PH +    VHQ + + PSE   +  TTY  ++NP    +    K R+ +     K E  PTYKADY  W    RE      ++ P S  F+   T+  DY   K      S +P    ++ N+P +D+T  + SY+ HPVE+R +  ++E FRP  +PF   +T    ++       +S KP A       P  N T     Y+ W + + +      Y PPE  M   TT    +   +     + RP    +  G+F   ++  DD+++W+    +   P  +      P +  TT   H+VP +P++ + S K        N P   ++ Y   + PKE+  C   +   P  T+E   EVD  GH +  P      ++ + ++V
Sbjct:    1 MEGLTTSRRDFGPHKVAPVKVHQYDQFVPSEENMDLLTTYKKDYNPYPVCRVDPIKPRDSKYPCSDKMECLPTYKADYLPWNQPRREPLRLEHKYQPASVRFDNRTTHQDDY-PIKGLVKTISCKPLAMPKLCNIPLEDVTNYKMSYVAHPVEKRFVH-EAEKFRPCEIPFESLTTQKQSYRGLMGEPAKSLKPLARPPGLDMPFCNTTEFRDKYQAWPMPRMFSKAPITYVPPEDRMDLLTTVQAHYTCPKGAPAQSCRPALQIKKCGRFEGSSTTKDDYKQWSSMRTEPVKPVPQLDLPTEPLDCLTTTRAHYVPHLPINTK-SCKPHWSGPRGNVPVESQTTYTISFTPKEMGRCLASYPEPPGYTFE---EVDALGHRIYKPVSQAGSQQSSHLSV 394          

HSP 2 Score: 72.0182 bits (175), Expect = 7.765e-13
Identity = 64/236 (27.12%), Postives = 94/236 (39.83%), Query Frame = 1
Query:  286 SFKPLANYTRNPEPLEDKTNHRIDYVPHALEKKYVHQREPYKPSEGEFEKNTTYTSEFNPKHGEKAMMFKRNPERRELGK---FEGTPTYKADYPGWLASPREVHGKPAEWIPPSE---------------------------------TFNGIPTYSSDYVKYKSTKPRESFRPHQETQIPNVPFQDMTENRESYIQH-PVEQRKIKDQSEWFRPVVPFTGESTFSSDFKEKPLG 882
            S KPLA       PLED TN+++ YV H +EK++VH+ E ++P E  FE  TT    +    GE A   K  P  R  G    F  T  ++  Y  W   PR     P  ++PP +                                  F G  T   DY ++ S +  E  +P  +  +P  P   +T  R  Y+ H P+  +  K      R  VP   ++T++  F  K +G
Sbjct:  122 SCKPLAMPKLCNIPLEDVTNYKMSYVAHPVEKRFVHEAEKFRPCEIPFESLTTQKQSYRGLMGEPAKSLK--PLARPPGLDMPFCNTTEFRDKYQAW-PMPRMFSKAPITYVPPEDRMDLLTTVQAHYTCPKGAPAQSCRPALQIKKCGRFEGSSTTKDDYKQWSSMR-TEPVKPVPQLDLPTEPLDCLTTTRAHYVPHLPINTKSCKPHWSGPRGNVPVESQTTYTISFTPKEMG 353          
BLAST of Stabilizer of axonemal microtubules 1 vs. Ensembl Human
Match: SAXO1 (stabilizer of axonemal microtubules 1 [Source:HGNC Symbol;Acc:HGNC:28566])

HSP 1 Score: 61.6178 bits (148), Expect = 1.525e-11
Identity = 33/67 (49.25%), Postives = 38/67 (56.72%), Query Frame = 1
Query:  154 CICKICCCGRHHCPHQP--IRSNASGPCVLSEYTNKY-TPHQINPVHSFKPLANYTRNPEPLEDKTN 345
            CIC++C CGRHHCPH P  I      PC+LSEYT  Y   H   P  SFKP   Y + P P+E  T 
Sbjct:    5 CICELCSCGRHHCPHLPTKIYDKTEKPCLLSEYTENYPFYHSYLPRESFKPRREYQKGPIPMEGLTT 71          
BLAST of Stabilizer of axonemal microtubules 1 vs. Ensembl Celegans
Match: T08G11.3 (pep chromosome:WBcel235:I:8921190:8925327:1 gene:WBGene00011630.1 transcript:T08G11.3.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T08G11.3)

HSP 1 Score: 85.5001 bits (210), Expect = 2.372e-17
Identity = 93/374 (24.87%), Postives = 149/374 (39.84%), Query Frame = 1
Query:  154 CICKICCCGRHHCPHQPIRSNASGPCVLSEYTNKYT---PHQINPVHSFKPLANYT------------------------------RNPEPLED-----KTNHRIDYVPHALEKKYVHQREPYKPS-----EGEFEKNTTYTSEFNPKHGEKAMMFKRNPERREL--GKFEGTPTYKADYPGWLASPREVHGKPAEWIPPSETFNGIPTYSSDYVKYKSTKPRESFRPHQETQIPNVPFQDMTENRESYIQHPVEQRKIK---DQSEWFRPVVPFTGESTFSSDFKEKPLGLNRSYKPPAIAKLSSEPLQNETTHNSDYKPWGVEK----PYLHQSERYNPPEGSMMTDTTYLRDFLPRRTERVLAFRPKDNRE 1119
            CIC+IC CGRH C H  + ++      + E   +Y    P +  P        N T                               N  PL+       T  R+D+     + K ++++ P +P+      GEFE  TT+ S+F+ K G+      R P+  +L  G F  T T +AD+    A    +   P         FNG  T  +DY + K  +     R   + Q+ + PF   T N+  Y Q   E+  I      +E F    PF G++T  SD+ +K +G +   K PA  ++ S P    TT+ +D+     ++    P     +R +   GS    TT   DF  ++  R + F+  D+ +
Sbjct:    9 CICQICQCGRHKCDH--VDADLGFGNGIEENQTEYGMQYPAKQAPRERQAKSRNATFLSDGDFDGTTINRQDYGEKKVARNAPFKFVNTGPLDSGEFLADTTQRVDF-----QGKSINRQAPLRPTTNGLQSGEFEGYTTHKSDFDYK-GDPRTGVIRGPQDAQLFSGPFNSTTTNRADFDKKQAERSGILRGPTSTNMFGGQFNGTTTNKTDYDQ-KQAERNGIIRGAADAQLFSGPFNGQTTNKSDYDQKQAERSGILRGPTNTEMFSG--PFNGQTTNKSDYDQKQVGRSEILKGPANTEMFSGPFDGITTNKADFDKKQADRQQRYPRAQNDDRLSA--GSFYDTTTNRADFDRKQASRPMPFKAADDSQ 369          

HSP 2 Score: 72.7886 bits (177), Expect = 2.968e-13
Identity = 82/339 (24.19%), Postives = 142/339 (41.89%), Query Frame = 1
Query:  421 GEFEKNTTYTSEFNPKHGEKAMMFKRNPERREL--GKFEGTPTYKADYPGWLASPREVHGKPAEWIPPSETFNGIPTYSSDYVKYKSTKPRESFRPHQETQIPNVPFQDMTENRESYIQHPVEQ---RKIKDQSEWFRPVVPFTGESTFSSDFKEKPLGLN---RSYKPPAIAKLSSEPLQNETTHNSDYKPWGVEKPYL---HQSERYNPPEGSMMTDTTYLR-DFLPRRTERVLAFRPKDNRES--IGQFSSKTSYSDDFQKWNIAARQRFGPNREYIPSDIPFENRTTHGTHFVPMPLSIRQSFKQSNQTHLSNEPFNGESIYRTEYAPKEVDVCP 1395
            G F   TT  S+++ K  E++ +  R P   E+  G F G  T K+DY        E+   PA     S  F+GI T  +D+ K ++ + +   R   + ++    F D T NR  + +    +    K  D S+      PF   ST  +D+ +K    +   R+    +   +++ P + E+T+++D++    EK  L   H S     P  S    TT  R DF+ +   RV+  +PKD+  S  + +F + T+Y D FQ+ +                              +PM        +  ++ H+    F GE+   +++  K VD+CP
Sbjct:  236 GPFNGQTTNKSDYDQKQAERSGIL-RGPTNTEMFSGPFNGQTTNKSDYDQKQVGRSEILKGPANTEMFSGPFDGITTNKADFDKKQADRQQRYPRAQNDDRLSAGSFYDTTTNRADFDRKQASRPMPFKAADDSQ-LTSSGPFLVLSTNRADYVKKQGDRSLPIRNTNDTSTHSINA-PFEGESTNHADFQRKQAEKSKLTRPHSSSNLLSPNASKFDATTTTRADFIQKPHVRVINVKPKDDSFSGHVSRFDANTTYHDGFQEKSAEK---------------------------LPMQ-------RTKDELHVGEGKFYGETTQHSDFIEKHVDICP 537          
BLAST of Stabilizer of axonemal microtubules 1 vs. Ensembl Zebrafish
Match: saxo2 (stabilizer of axonemal microtubules 2 [Source:ZFIN;Acc:ZDB-GENE-051127-27])

HSP 1 Score: 201.445 bits (511), Expect = 6.831e-58
Identity = 144/467 (30.84%), Postives = 225/467 (48.18%), Query Frame = 1
Query:  151 LCICKICCCGRHHCPHQPIRSNASGP--CVLSEYTNKYTPHQINPV-HSFKPLANYTRNPEPLEDKTNHRIDYVPHALEKKYVHQREPYKPSEGEFEKNTTYTSEFNPKHGEKAMMFKRNPERREL--GKFEGTPTYKADYPGWLASPREVHGKPAEWIPPSETFNGIPTYSSDYVKYKSTKPRESFRPHQETQIPNVPFQDMTENRESYIQHPVEQRKIKDQSEWFRPVVPFTGESTFSSDFKEKPLGLNRSYKPPAIAKLSSEPLQNETTHNSDYKPWGVEKPYLHQSERYNPPEGSMMTDTTYLRDFLPRRTERVLAFRPKDN-RESIGQFSSKTSYSDDFQKWNIAARQRFGPNREYI--PSDIPFENRTTHGTHFVPMPLSIRQSFKQSNQTHLSNEPFNGESIYRTEYAPKEVDVCPTFFMGSPRATYEFTGEVDNKGHLLVSPRKM---DEMEKQTEVAV 1518
            LCIC++C CGRH C H+P       P   VLSEY  KY P++ +    S KP   Y  + + ++  T  R DY+P+ +  +   Q+  YKP  GE +  TTY  +FNP +  +     R  ER  +   K +  PTYK D+  W    RE+      + PP+  F    T+  D+V ++   PRES++P    ++ + PF+  T N+ SY+ HP+E R +K   E+     PF   +T   D++  P    +S KP  +   S++P Q+ T     Y+ W V  P + +S  Y  P  +M   TT   D++  + +  ++ +P     +S   F   T+  DDFQ W +A RQ     +  +  PS    E+ TT   HFV        SFK  N    ++ P   +++YRT++ PK++ +CP  F   P   +E     D++GH     RKM   D +E   E+ +
Sbjct:    6 LCICEMCSCGRHRCTHRPTTLYKKDPQTNVLSEYIEKYPPYKGHTRPKSLKPQLKYKAHQDTMDATTTFRTDYIPYPVTHRPEKQQLEYKPKSGEIDLGTTYKQDFNP-YEVQPFTPLRPKERVHVVNAKLDTVPTYKEDFRQWEIIRRELTKPDTTYQPPATKFGNSTTFQDDFV-HRGLVPRESYKPSNVAKLSDTPFEKNTSNKLSYVPHPLEARYVKPPEEYKPSSHPFHDVTTHRQDYQGLPSQSTKSCKPEPVKVASNKPFQSSTEFRDQYQHWPVSLPQMQKSVEYTSPTANMDLTTTSHSDYIKHQIQPFVSSKPFSLPAKSSRPFQGNTTMRDDFQPW-VAQRQSIIRKQAELQRPSG-KMEDLTTFRAHFVQHEAQPSFSFKPQNSPLHTDIPLQADTMYRTDFTPKKISMCPASFETPPGFVFE---NRDDQGHRFF--RKMTSSDRIETPKEMVL 463          
BLAST of Stabilizer of axonemal microtubules 1 vs. Ensembl Xenopus
Match: vcam1 (vascular cell adhesion molecule 1 [Source:Xenbase;Acc:XB-GENE-492444])

HSP 1 Score: 224.172 bits (570), Expect = 2.700e-66
Identity = 144/444 (32.43%), Postives = 217/444 (48.87%), Query Frame = 1
Query:  154 CICKICCCGRHHCPHQP--IRSNASGPCVLSEYTNKYTPHQ-INPVHSFKPLANYTRNPEPLEDKTNHRIDYVPHALEKKYVHQREPYKPSEGEFEKNTTYTSEFNPKHGEKAMMFK-RNPERRELGKFEGTPTYKADYPGWLASPREVHGKPAEWIPPSETFNGIPTYSSDYVKYKSTKPRESFRPHQETQIPNVPFQDMTENRESYIQHPVEQRKIKDQSEWFRPVVPFTGESTFSSDFKEKPLGLNRSYKPPAIAKLSSEPLQNETTHNSDYKPWGVEKPYLHQSERYNPPEGSMMTDTTYLRDFLPRRTERVLAFRP-KDNRESIGQFSSKTSYSDDFQKWNIAARQRFGPNREYIPS-DIPFENRTTHGTHFVPMPLSIRQSFKQSNQTHLSNEPFNGESIYRTEYAPKEVDVCPTFFMGSPRATYEFTGEVDNKGHLL 1467
            CIC+IC CGRH CPH P  I   +   CVL+EY  KY  +  + P  S KP   Y+     +E  T  + DYVP+ +  + V   E Y+P  G  E  TTY  ++NP   E     +  +  +   G+F+  PTYK D+  W    RE+  +   +  P+E F    T+  D+   K   PRESF+P    +  ++PF+  T +R SY+ H VE R ++ + E+     PF   +T   +FK     + +S KP      S+   +  T     ++PW +  PY+H+S  Y PP+  M  DTT   D++P + + V   RP    R S   F   ++  DDF+ W    RQ        IP     FE  TT  +H+ P  ++  QSFK  N    ++ PF G ++YR+EY PK+ ++CP  +   P   +E    +DN+GH +
Sbjct:    5 CICEICTCGRHRCPHNPTHITEKSGKQCVLTEYVEKYPQYDNVQPPKSMKPKQEYSGEHGRMEGITTFKSDYVPYEILNRPVRAHEEYQPKPGSIELGTTYNRDYNPHRLEPVAPIRPVDKGQANPGRFDTNPTYKDDFRPWEFQKRELAKQERVYQAPTEKFGNSTTFQDDFFP-KQIMPRESFKPLGVAKNRDIPFEGTTSHRISYVPHEVEPRFVRQKEEYKPSSQPFEDLTTHRLNFKGAIGEITKSCKPEHGKVGSNAQFEGATEFRDSFQPWSIPAPYVHKSYEYVPPKSHMECDTTTHLDYVPHQLKLVAPIRPVTHGRRSNVPFQGSSTMKDDFRAWE-GGRQEMIKRDHLIPKPSGKFEGLTTFKSHYQPHEINPTQSFKPLNMPLRTSVPFEGATMYRSEYTPKKSELCPANYPSPPGYVFE---SIDNRGHKI 443          
BLAST of Stabilizer of axonemal microtubules 1 vs. Ensembl Xenopus
Match: vcam1 (vascular cell adhesion molecule 1 [Source:Xenbase;Acc:XB-GENE-492444])

HSP 1 Score: 199.519 bits (506), Expect = 5.191e-57
Identity = 138/448 (30.80%), Postives = 212/448 (47.32%), Query Frame = 1
Query:  136 SNKSDLCICKICCCGRHHCPHQPIRSNASGPCVLSEYTNKYTPHQ-INPVHSFKPLANYTRNPEPLEDKTNHRIDYVPHALEKKYVHQREPYKPSEGEFEKNTTYTSEFNPKHGEKAMMFK-RNPERRELGKFEGTPTYKADYPGWLASPREVHGKPAEWIPPSETFNGIPTYSSDYVKYKSTKPRESFRPHQETQIPNVPFQDMTENRESYIQHPVEQRKIKDQSEWFRPVVPFTGESTFSSDFKEKPLGLNRSYKPPAIAKLSSEPLQNETTHNSDYKPWGVEKPYLHQSERYNPPEGSMMTDTTYLRDFLPRRTERVLAFRP-KDNRESIGQFSSKTSYSDDFQKWNIAARQRFGPNREYIPS-DIPFENRTTHGTHFVPMPLSIRQSFKQSNQTHLSNEPFNGESIYRTEYAPKEVDVCPTFFMGSPRATYEFTGEVDNKGHLL 1467
            S+   L IC  C C R       I+  +   CVL+EY  KY  +  + P  S KP   Y+     +E  T  + DYVP+ +  + V   E Y+P  G  E  TTY  ++NP   E     +  +  +   G+F+  PTYK D+  W    RE+  +   +  P+E F    T+  D+   K   PRESF+P    +  ++PF+  T +R SY+ H VE R ++ + E+     PF   +T   +FK     + +S KP      S+   +  T     ++PW +  PY+H+S  Y PP+  M  DTT   D++P + + V   RP    R S   F   ++  DDF+ W    RQ        IP     FE  TT  +H+ P  ++  QSFK  N    ++ PF G ++YR+EY PK+ ++CP  +   P   +E    +DN+GH +
Sbjct:    2 SDTIKLTIC-TCACKR-------IKVKSGKQCVLTEYVEKYPQYDNVQPPKSMKPKQEYSGEHGRMEGITTFKSDYVPYEILNRPVRAHEEYQPKPGSIELGTTYNRDYNPHRLEPVAPIRPVDKGQANPGRFDTNPTYKDDFRPWEFQKRELAKQERVYQAPTEKFGNSTTFQDDFFP-KQIMPRESFKPLGVAKNRDIPFEGTTSHRISYVPHEVEPRFVRQKEEYKPSSQPFEDLTTHRLNFKGAIGEITKSCKPEHGKVGSNAQFEGATEFRDSFQPWSIPAPYVHKSYEYVPPKSHMECDTTTHLDYVPHQLKLVAPIRPVTHGRRSNVPFQGSSTMKDDFRAWE-GGRQEMIKRDHLIPKPSGKFEGLTTFKSHYQPHEINPTQSFKPLNMPLRTSVPFEGATMYRSEYTPKKSELCPANYPSPPGYVFE---SIDNRGHKI 436          
BLAST of Stabilizer of axonemal microtubules 1 vs. Ensembl Mouse
Match: Saxo1 (stabilizer of axonemal microtubules 1 [Source:MGI Symbol;Acc:MGI:1923061])

HSP 1 Score: 171.785 bits (434), Expect = 7.024e-47
Identity = 130/441 (29.48%), Postives = 194/441 (43.99%), Query Frame = 1
Query:  154 CICKICCCGRHHCPHQP--IRSNASGPCVLSEYTNKYTPHQ-INPVHSFKPLANYTRNPEPLEDKTNHRIDYVPHALEKKYVHQREPYKPSEGEFEKNTTYTSEFNPKHGEKAMMFKRNPERRELGK--FEGTPTYKADYPGWLASPREVHGKPAEWIPPSETFNGIPTYSSDYVKYKSTKPRESFRPHQETQIPNVPFQDMTENRESYIQHPVEQRKIKDQSEWFRPVVPFTGESTFSSDFKEKPLGLNRSYKPPAIAKLSSEPLQNETTHNSDYKPWGVEKPYLHQSERYNPPEGSMMTDTTYLRDFLPRRTERVLAFRPKDNRESIGQFSSKTSYSDDFQKWNIAARQRFGPNREYIPSDIPFENRTTHGTHFVPMPLSIRQSFKQSNQTHLSNEPFNGESIYRTEYAPKEVDVCPTFFMGSPRATYEFTGEVDNKGH 1461
            CIC +C CGRH CPH P  I        +LSEYT  Y  +Q   P +SFKP   Y +   P+E  T  R D+  H +     HQ + Y PS+   +  TTY  +FN        + K    +   G    +  PTYK DY  W    RE+   P ++ P S  F    T+  DY   K      S +P  +++I N+P +D+T  + SY+ HPVE+R +K+  ++    +PF   +T    ++       +S KPPA   +   P  N T     ++ W   +        Y PPE  M   TT    +   +    +  RP  + +    F S T+  DDF++W     +   P         P + +TT  T FV  P  I +++K        N P  G++ Y   + PK++  CP  +M  P   +E   EVD+ GH
Sbjct:    6 CICNLCSCGRHRCPHLPTKIYDKTEKTRLLSEYTENYPIYQSYLPRNSFKPEWCYRKPSAPMEGLTTCRRDFGLHKMLPVTFHQPDTYVPSQETMDLLTTYKHDFNYLPTCPVGLIKPRDSKFPNGDKIMQYLPTYKVDYLPWNQPRRELLRPPHKYRPESSKFENRTTHQDDYT-MKGLVTTVSCKPPSKSKIYNIPLEDLTNYKMSYVPHPVEKRFVKEAEKYIPCDIPFENLTTHKESYRGLLGEPAKSTKPPAKFPVHDAPFTNTTEVQEKFQAWPTPQMVPKAPVVYVPPEEKMDLLTTVQTHYKYLKGSPAITCRPVPSIKKSKCFESSTTTKDDFKQWAAVNTKPIRPTLHLSLPAEPLDCQTTTKTCFVAHPPIITENYKPPWVGLRRNIPVEGQTTYSINFTPKDLGKCPASYMEPPGYIFE---EVDSMGH 442          
BLAST of Stabilizer of axonemal microtubules 1 vs. Ensembl Mouse
Match: Saxo2 (stabilizer of axonemal microtubules 2 [Source:MGI Symbol;Acc:MGI:1914618])

HSP 1 Score: 152.14 bits (383), Expect = 1.769e-40
Identity = 111/374 (29.68%), Postives = 182/374 (48.66%), Query Frame = 1
Query:  355 DYVPHALEKKYVHQREPYKPSEGEFEKNTTYTSEFNPKHGEKAMMFKRNPERREL--GKFEGTPTYKADYPGWLASPREVHGKPAEWIPPSETFNGIPTYSSDYVKYKSTKPRESFRPHQETQIPNVPFQDMTENRESYIQHPVEQRKIKDQSEWFRPV-VPFTGESTFSSDFKEKPLGLNRSYKPPAIAKLSSEPLQNETTHNSDYKPWGVEKPYLHQSERYNPPEGSMMTDTTYLRDFLPRRTERVLAFRPKDNR-ESIGQFSSKTSYSDDFQKWNIAARQRFGPNREYIPS-DIPFENRTTHGTHFVPMPLSIRQSFKQSNQTHLSNEPFNGESIYRTEYAPKEVDVCPTFFMGSPRATYEFTGEVDNKGH 1461
            DY P+ + K+  H  E YKP +G+ +  TTY  +FNP +  + ++  R  ER+++  GK +  PTYK DY  W     E+      + PP   F    T+  DYV  +  KPR+SF+P    +    PF   T +R  Y+ H +E  K     E ++P   PF   +T  +DF+       +  +P       +   +  T     ++PW +  P + +   Y PP GSM  ++T   D++P +  RV+A RP  +R +S   F  K++  +DF  W I  RQ     ++ IP+    FE  +T  +HFVP  L   +S K  N+   S+ P +  ++Y  ++ PK+ ++CP  +   P   +E T   +++GH
Sbjct:   15 DYRPYEIVKQPRHIPEEYKPKQGKIDLGTTYKRDFNP-YKVQPLIKVRPVERQQVKKGKLDTVPTYKDDYRSWDIQKCELCKPEQAYHPPDVKFGNSTTFQDDYVP-QEIKPRQSFKPCSVVKCSVGPFNGDTSHRRDYVPHQLE-VKFARPKEIYKPTDQPFEDLTTHRNDFQGLAGETAKICRPAYTRVTQNIQFKGSTEFRDSFQPWEIPPPKVKKVAEYVPPSGSMQLNSTSHLDYVPYQASRVVAIRPVSHRRQSNFPFQGKSTTKEDFPAWEIC-RQGLIKQQQQIPNPSGKFEGLSTFRSHFVPHELIPTESCKPLNEALKSSVPLDDVTMYSIQFTPKKQEICPASYPSPPGYIFENT---NSQGH 381          

HSP 2 Score: 103.605 bits (257), Expect = 2.048e-23
Identity = 79/247 (31.98%), Postives = 120/247 (48.58%), Query Frame = 1
Query:  238 SEYTNKYTPHQINPVHSFKPLANYTRNPEPLEDKTNHRIDYVPHALEKKYVHQREPYKPSEGEFEKNTTYTSEFNPKHGEKAMMFKRNPERRELG-KFEGTPTYKADYPGWLASPREVHGKPAEWIPPSETFNGIPTYSSDYVKYKSTKPRESFRPHQETQIPNVPFQDMTENRESYIQHPV-EQRKIKDQSEWFRPVVPFTGESTFSSDFKEKPLGLNRSYKPPAIAKLSSEPLQNETTHNSDYKP 972
            + + + Y P +I P  SFKP +    +  P    T+HR DYVPH LE K+   +E YKP++  FE  TT+ ++F    GE A + +    R     +F+G+  ++  +  W   P +V  K AE++PPS +     T   DYV Y++++   + RP    +  N PFQ  +  +E +    +  Q  IK Q +   P   F G STF S F    L    S KP   A  SS PL + T ++  + P
Sbjct:  111 TTFQDDYVPQEIKPRQSFKPCSVVKCSVGPFNGDTSHRRDYVPHQLEVKFARPKEIYKPTDQPFEDLTTHRNDFQGLAGETAKICRPAYTRVTQNIQFKGSTEFRDSFQPWEIPPPKVK-KVAEYVPPSGSMQLNSTSHLDYVPYQASR-VVAIRPVSHRRQSNFPFQGKSTTKEDFPAWEICRQGLIKQQQQIPNPSGKFEGLSTFRSHFVPHELIPTESCKPLNEALKSSVPLDDVTMYSIQFTP 355          

HSP 3 Score: 95.5153 bits (236), Expect = 1.013e-20
Identity = 51/153 (33.33%), Postives = 82/153 (53.59%), Query Frame = 1
Query:  934 LQNETTHNSDYKPWGVEKPYLHQSERYNPPEGSMMTDTTYLRDFLPRRTERVLAFRPKDNRE-SIGQFSSKTSYSDDFQKWNIAARQRFGPNREYIPSDIPFENRTTHGTHFVPMPLSIRQSFKQSNQTHLSNEPFNGESIYRTEYAPKEVDV 1389
            L    T  SDY+P+ + K   H  E Y P +G +   TTY RDF P + + ++  RP + ++   G+  +  +Y DD++ W+I   +   P + Y P D+ F N TT    +VP  +  RQSFK  +    S  PFNG++ +R +Y P +++V
Sbjct:    6 LCQICTCGSDYRPYEIVKQPRHIPEEYKPKQGKIDLGTTYKRDFNPYKVQPLIKVRPVERQQVKKGKLDTVPTYKDDYRSWDIQKCELCKPEQAYHPPDVKFGNSTTFQDDYVPQEIKPRQSFKPCSVVKCSVGPFNGDTSHRRDYVPHQLEV 158          

HSP 4 Score: 65.0846 bits (157), Expect = 7.986e-11
Identity = 81/398 (20.35%), Postives = 166/398 (41.71%), Query Frame = 1
Query:  148 DLCICKICCCGRHHCPHQPIRSNASGP----------CVLSEYTNKYTPHQINPVHSFKPLANYTRNPEPLEDKTNHRIDYVPHALEK-KYVHQREPYKPSEGEFEKNTTYTSEFNPKHGEKAMMFK-RNPERRELGKFEGTPTYKADY-PGWL----ASPREVHGKPAEWIPPSETFNGIPTYSSDYVKYKSTKPRESFRPHQETQIPNVPFQDMTENRESYIQHPVEQRKIKDQSEWFRPVVPFTGESTFSSDFKEKPLGLNRSYKPPAIAKLSSEPLQNETTHNSDYKPWGVEKPYLHQSERYNP-PEGSMMTDTTYLRDFLPRRTERVLAFRPKDNRESIGQFSSKTSYSDDFQKWNIAARQRFGPNREYI-PSDIP------FENRTTHGTHF 1266
            + C+C+IC CG  + P++ ++     P           + + Y   + P+++ P+   +P+         L+    ++ DY    ++K +     + Y P + +F  +TT+  ++ P+  +    FK  +  +  +G F G  +++ DY P  L    A P+E++       P  + F  + T+ +D+        +   RP       N+ F+  TE R+S+    +   K+K  +E+  P       ST   D+         + +P +  + S+ P Q ++T   D+  W + +  L + ++  P P G     +T+   F+P          P ++ + + +    +   DD   ++I    +F P ++ I P+  P      FEN  + G  F
Sbjct:    3 NWCLCQICTCGSDYRPYEIVKQPRHIPEEYKPKQGKIDLGTTYKRDFNPYKVQPLIKVRPVERQQVKKGKLDTVPTYKDDYRSWDIQKCELCKPEQAYHPPDVKFGNSTTFQDDYVPQEIKPRQSFKPCSVVKCSVGPFNGDTSHRRDYVPHQLEVKFARPKEIYK------PTDQPFEDLTTHRNDFQGLAGETAKIC-RPAYTRVTQNIQFKGSTEFRDSFQPWEIPPPKVKKVAEYVPPSGSMQLNSTSHLDYVPYQASRVVAIRPVSHRRQSNFPFQGKSTTKEDFPAWEICRQGLIKQQQQIPNPSGKFEGLSTFRSHFVPHE------LIPTESCKPLNEALKSSVPLDDVTMYSI----QFTPKKQEICPASYPSPPGYIFENTNSQGHKF 383          
BLAST of Stabilizer of axonemal microtubules 1 vs. UniProt
Match: sp|Q8IYX7|SAXO1_HUMAN (Stabilizer of axonemal microtubules 1 OS=Homo sapiens OX=9606 GN=SAXO1 PE=1 SV=2)

HSP 1 Score: 181.415 bits (459), Expect = 1.686e-49
Identity = 139/461 (30.15%), Postives = 210/461 (45.55%), Query Frame = 1
Query:  154 CICKICCCGRHHCPHQP--IRSNASGPCVLSEYTNKYT-PHQINPVHSFKPLANYTRNPEPLEDKTNHRIDYVPHALEKKYVHQREPYKPSEGEFEKNTTYTSEFNPKHGEKAMMFK-RNPERRELGKFEGTPTYKADYPGWLASPREVHGKPAEWIPPSETFNGIPTYSSDYVKYKSTKPRESFRPHQETQIPNVPFQDMTENRESYIQHPVEQRKIKDQSEWFRPV-VPFTGESTFSSDFKEKPLGLNRSYKPPAIAKLSSEPLQNETTHNSDYKPWGVEKPYLHQSERYNPPEGSMMTDTTYLRDFLPRRTERVLAFRPKDNRESIGQFSSKTSYSDDFQKWNIAARQRFGPNREYIPSDIPFENRTTHGTHFVP-MPLSIRQSFKQSNQTHLSNEPFNGESIYRTEYAPKEVDVCPTFFMGSPRATYEFTGEVDNKGHLLVSPRKMDEMEKQTEVAV 1518
            CIC++C CGRHHCPH P  I      PC+LSEYT  Y   H   P  SFKP   Y + P P+E  T  R D+ PH +    VHQ + + PSE   +  TTY  ++NP    +    K R+ +     K E  PTYKADY  W    RE      ++ P S  F+   T+  DY   K      S +P    ++ N+P +D+T  + SY+ HPVE+R +  ++E FRP  +PF   +T    ++       +S KP A       P  N T     Y+ W + + +      Y PPE  M   TT    +   +     + RP    +  G+F   ++  DD+++W+    +   P  +      P +  TT   H+VP +P++ + S K        N P   ++ Y   + PKE+  C   +   P  T+E   EVD  GH +  P      ++ + ++V
Sbjct:    5 CICELCSCGRHHCPHLPTKIYDKTEKPCLLSEYTENYPFYHSYLPRESFKPRREYQKGPIPMEGLTTSRRDFGPHKVAPVKVHQYDQFVPSEENMDLLTTYKKDYNPYPVCRVDPIKPRDSKYPCSDKMECLPTYKADYLPWNQPRREPLRLEHKYQPASVRFDNRTTHQDDY-PIKGLVKTISCKPLAMPKLCNIPLEDVTNYKMSYVAHPVEKRFVH-EAEKFRPCEIPFESLTTQKQSYRGLMGEPAKSLKPLARPPGLDMPFCNTTEFRDKYQAWPMPRMFSKAPITYVPPEDRMDLLTTVQAHYTCPKGAPAQSCRPALQIKKCGRFEGSSTTKDDYKQWSSMRTEPVKPVPQLDLPTEPLDCLTTTRAHYVPHLPINTK-SCKPHWSGPRGNVPVESQTTYTISFTPKEMGRCLASYPEPPGYTFE---EVDALGHRIYKPVSQAGSQQSSHLSV 459          
BLAST of Stabilizer of axonemal microtubules 1 vs. UniProt
Match: sp|Q4R7D3|SAXO1_MACFA (Stabilizer of axonemal microtubules 1 OS=Macaca fascicularis OX=9541 GN=SAXO1 PE=2 SV=2)

HSP 1 Score: 181.03 bits (458), Expect = 2.176e-49
Identity = 138/460 (30.00%), Postives = 205/460 (44.57%), Query Frame = 1
Query:  154 CICKICCCGRHHCPHQP--IRSNASGPCVLSEYTNKY-TPHQINPVHSFKPLANYTRNPEPLEDKTNHRIDYVPHALEKKYVHQREPYKPSEGEFEKNTTYTSEFNPKHGEKAMMFK-RNPERRELGKFEGTPTYKADYPGWLASPREVHGKPAEWIPPSETFNGIPTYSSDYVKYKSTKPRESFRPHQETQIPNVPFQDMTENRESYIQHPVEQRKIKDQSEWFRPV-VPFTGESTFSSDFKEKPLGLNRSYKPPAIAKLSSEPLQNETTHNSDYKPWGVEKPYLHQSERYNPPEGSMMTDTTYLRDFLPRRTERVLAFRPKDNRESIGQFSSKTSYSDDFQKWNIAARQRFGPNREYIPSDIPFENRTTHGTHFVPMPLSIRQSFKQSNQTHLSNEPFNGESIYRTEYAPKEVDVCPTFFMGSPRATYEFTGEVDNKGHLLVSPRKMDEMEKQTEVAV 1518
            CIC++C CGRHHCPH P  I      PC+LSEYT  Y   H   P  SFKP   Y +   P+E  T  R D+ PH +     HQ + + PSE   +  TTY  ++NP    +    K R+ +     K E  PTYKADY  W    R+      ++ P S  F+   T+  DY   K      S +P    ++ N+P +D+T  + SY+ HPVE+R +  ++E FRP  +PF   +T    ++       +S KP A       P  N T     Y+ W   + +      Y PPE SM   TT    +   +     + RP       G+F   ++  DD+++W+    +   P  +      P +  TT   H+VP P    +S K        N P  G++ Y   + PKE+  C   +   P  T+E   EVD  GH +  P      ++ + ++V
Sbjct:    5 CICELCSCGRHHCPHLPTKIYDKTEKPCLLSEYTENYPCYHSYLPRESFKPRREYQKGSIPMEGLTTSRRDFGPHKVAPVKAHQYDQFVPSEENMDLLTTYKKDYNPYTVCRVDPIKPRDSKYPYSNKMEYLPTYKADYLPWNQPRRQPLRLEHKYQPASVRFDNRTTHQDDY-PIKGLVKTVSCKPLAMPKLCNIPLEDVTNYKMSYVAHPVEKRFVH-EAEKFRPCEIPFESLTTHKQSYRGLMGEPAKSLKPLARPPGLDMPFSNTTEFRDKYQAWPTPQMFSKAPITYVPPEDSMDLLTTVQAHYTYPKGVPARSCRPAPQIRKSGRFEGSSTTKDDYKQWSSMRTEPVKPIPQLDFPTEPLDCLTTTRAHYVPHPPINTKSCKPHWSGPRGNVPVEGQTTYTISFTPKEMSKCLASYPEPPGYTFE---EVDALGHRIYKPVSQAGSQQSSHLSV 459          
BLAST of Stabilizer of axonemal microtubules 1 vs. UniProt
Match: sp|Q6AYP6|SAXO1_RAT (Stabilizer of axonemal microtubules 1 OS=Rattus norvegicus OX=10116 GN=Saxo1 PE=2 SV=1)

HSP 1 Score: 173.711 bits (439), Expect = 8.716e-47
Identity = 133/445 (29.89%), Postives = 198/445 (44.49%), Query Frame = 1
Query:  154 CICKICCCGRHHCPHQP--IRSNASGPCVLSEYTNKY-TPHQINPVHSFKPLANYTRNPEPLEDKTNHRIDYVPHALEKKYVHQREPYKPSEGEFEKNTTYTSEFNPKHGEKAMMFK-RNPERRELGKFEGTPTYKADYPGWLASPREVHGKPAEWIPPSETFNGIPTYSSDYVKYKSTKPRESFRPHQETQIPNVPFQDMTENRESYIQHPVEQRKIKDQSEWFRPVVPFTGESTFSSDFKEKPLGLNRSYKPPAIAKLSSEPLQNETTHNSDYKPWGVEKPYLHQSERYNPPEGSMMTDTTYLRDFLPRRTERVLAFRPKDNRESIGQFSSKTSYSDDFQKWNIAARQRFGPNREYIPSDIPFENRTTHGTHFVPMPLSIRQSFKQSNQTHLSNEPFNGESIYRTEYAPKEVDVCPTFFMGSPRATYEFTGEVDNKGHLLVSP 1476
            CIC +C CG+HHCPH P  I      PC  SEYT KY T     P  SFKP   Y +   P+E  +  + D+    +     H  E   P + E +  TTY   +N     +    K R+ + +   K E  PTYKADY  W    R     P  + P S  F+   T+  DY   K+     S++P    ++ N+P + MT  + SY+ HP+E+R + +  ++    VPF   +T    ++       +++KP         P  + T     ++PW   K    +S  Y PPEG M   TT   D+         + RP  + +   +F S T+  +DF+ W    R+   PN +   SD P E  TT+  H+VP   +  +S K +      N P  G++ Y T + PKE+  CP  +   P   ++   EVD  GH L  P
Sbjct:    5 CICDLCSCGKHHCPHLPTKIYEKTEKPCFFSEYTEKYPTYLSYVPRESFKPKLEYQKVNIPMEGLSTTKRDFGTFNIVPVKHHLPEKATPIQDEMDFLTTYNQHYNYCPANRVNPIKPRDNKHQCNDKMECVPTYKADYLPWNQQKRSSIRPPQSYRPASCRFDHRTTHQDDY-PIKNPVDTVSYKPPHGPKLCNIPLESMTSYKSSYVAHPMEKRCVYEGEKYKPSEVPFDSLTTHKDSYRGLIGEPAKTWKPAPNHPGLDIPFPSNTEFREKFQPWPTPKIVPKESIAYIPPEGKMDLLTTVQADYKCPNGVPAQSCRPVIHLKKSDRFESSTTNREDFKHWANIRREPVKPNHQLKFSDEPMEYMTTNRAHYVPHAPANTKSCKPTWSGPRVNIPLEGQTTYSTSFTPKEIQRCPASYPEPPGYIFD---EVDAVGHRLYRP 445          
BLAST of Stabilizer of axonemal microtubules 1 vs. UniProt
Match: sp|Q8BQB6|SAXO2_MOUSE (Stabilizer of axonemal microtubules 2 OS=Mus musculus OX=10090 GN=Saxo2 PE=2 SV=2)

HSP 1 Score: 152.14 bits (383), Expect = 1.237e-39
Identity = 111/374 (29.68%), Postives = 182/374 (48.66%), Query Frame = 1
Query:  355 DYVPHALEKKYVHQREPYKPSEGEFEKNTTYTSEFNPKHGEKAMMFKRNPERREL--GKFEGTPTYKADYPGWLASPREVHGKPAEWIPPSETFNGIPTYSSDYVKYKSTKPRESFRPHQETQIPNVPFQDMTENRESYIQHPVEQRKIKDQSEWFRPV-VPFTGESTFSSDFKEKPLGLNRSYKPPAIAKLSSEPLQNETTHNSDYKPWGVEKPYLHQSERYNPPEGSMMTDTTYLRDFLPRRTERVLAFRPKDNR-ESIGQFSSKTSYSDDFQKWNIAARQRFGPNREYIPS-DIPFENRTTHGTHFVPMPLSIRQSFKQSNQTHLSNEPFNGESIYRTEYAPKEVDVCPTFFMGSPRATYEFTGEVDNKGH 1461
            DY P+ + K+  H  E YKP +G+ +  TTY  +FNP +  + ++  R  ER+++  GK +  PTYK DY  W     E+      + PP   F    T+  DYV  +  KPR+SF+P    +    PF   T +R  Y+ H +E  K     E ++P   PF   +T  +DF+       +  +P       +   +  T     ++PW +  P + +   Y PP GSM  ++T   D++P +  RV+A RP  +R +S   F  K++  +DF  W I  RQ     ++ IP+    FE  +T  +HFVP  L   +S K  N+   S+ P +  ++Y  ++ PK+ ++CP  +   P   +E T   +++GH
Sbjct:   15 DYRPYEIVKQPRHIPEEYKPKQGKIDLGTTYKRDFNP-YKVQPLIKVRPVERQQVKKGKLDTVPTYKDDYRSWDIQKCELCKPEQAYHPPDVKFGNSTTFQDDYVP-QEIKPRQSFKPCSVVKCSVGPFNGDTSHRRDYVPHQLE-VKFARPKEIYKPTDQPFEDLTTHRNDFQGLAGETAKICRPAYTRVTQNIQFKGSTEFRDSFQPWEIPPPKVKKVAEYVPPSGSMQLNSTSHLDYVPYQASRVVAIRPVSHRRQSNFPFQGKSTTKEDFPAWEIC-RQGLIKQQQQIPNPSGKFEGLSTFRSHFVPHELIPTESCKPLNEALKSSVPLDDVTMYSIQFTPKKQEICPASYPSPPGYIFENT---NSQGH 381          

HSP 2 Score: 103.605 bits (257), Expect = 1.433e-22
Identity = 79/247 (31.98%), Postives = 120/247 (48.58%), Query Frame = 1
Query:  238 SEYTNKYTPHQINPVHSFKPLANYTRNPEPLEDKTNHRIDYVPHALEKKYVHQREPYKPSEGEFEKNTTYTSEFNPKHGEKAMMFKRNPERRELG-KFEGTPTYKADYPGWLASPREVHGKPAEWIPPSETFNGIPTYSSDYVKYKSTKPRESFRPHQETQIPNVPFQDMTENRESYIQHPV-EQRKIKDQSEWFRPVVPFTGESTFSSDFKEKPLGLNRSYKPPAIAKLSSEPLQNETTHNSDYKP 972
            + + + Y P +I P  SFKP +    +  P    T+HR DYVPH LE K+   +E YKP++  FE  TT+ ++F    GE A + +    R     +F+G+  ++  +  W   P +V  K AE++PPS +     T   DYV Y++++   + RP    +  N PFQ  +  +E +    +  Q  IK Q +   P   F G STF S F    L    S KP   A  SS PL + T ++  + P
Sbjct:  111 TTFQDDYVPQEIKPRQSFKPCSVVKCSVGPFNGDTSHRRDYVPHQLEVKFARPKEIYKPTDQPFEDLTTHRNDFQGLAGETAKICRPAYTRVTQNIQFKGSTEFRDSFQPWEIPPPKVK-KVAEYVPPSGSMQLNSTSHLDYVPYQASR-VVAIRPVSHRRQSNFPFQGKSTTKEDFPAWEICRQGLIKQQQQIPNPSGKFEGLSTFRSHFVPHELIPTESCKPLNEALKSSVPLDDVTMYSIQFTP 355          

HSP 3 Score: 95.5153 bits (236), Expect = 7.086e-20
Identity = 51/153 (33.33%), Postives = 82/153 (53.59%), Query Frame = 1
Query:  934 LQNETTHNSDYKPWGVEKPYLHQSERYNPPEGSMMTDTTYLRDFLPRRTERVLAFRPKDNRE-SIGQFSSKTSYSDDFQKWNIAARQRFGPNREYIPSDIPFENRTTHGTHFVPMPLSIRQSFKQSNQTHLSNEPFNGESIYRTEYAPKEVDV 1389
            L    T  SDY+P+ + K   H  E Y P +G +   TTY RDF P + + ++  RP + ++   G+  +  +Y DD++ W+I   +   P + Y P D+ F N TT    +VP  +  RQSFK  +    S  PFNG++ +R +Y P +++V
Sbjct:    6 LCQICTCGSDYRPYEIVKQPRHIPEEYKPKQGKIDLGTTYKRDFNPYKVQPLIKVRPVERQQVKKGKLDTVPTYKDDYRSWDIQKCELCKPEQAYHPPDVKFGNSTTFQDDYVPQEIKPRQSFKPCSVVKCSVGPFNGDTSHRRDYVPHQLEV 158          

HSP 4 Score: 65.0846 bits (157), Expect = 5.586e-10
Identity = 81/398 (20.35%), Postives = 166/398 (41.71%), Query Frame = 1
Query:  148 DLCICKICCCGRHHCPHQPIRSNASGP----------CVLSEYTNKYTPHQINPVHSFKPLANYTRNPEPLEDKTNHRIDYVPHALEK-KYVHQREPYKPSEGEFEKNTTYTSEFNPKHGEKAMMFK-RNPERRELGKFEGTPTYKADY-PGWL----ASPREVHGKPAEWIPPSETFNGIPTYSSDYVKYKSTKPRESFRPHQETQIPNVPFQDMTENRESYIQHPVEQRKIKDQSEWFRPVVPFTGESTFSSDFKEKPLGLNRSYKPPAIAKLSSEPLQNETTHNSDYKPWGVEKPYLHQSERYNP-PEGSMMTDTTYLRDFLPRRTERVLAFRPKDNRESIGQFSSKTSYSDDFQKWNIAARQRFGPNREYI-PSDIP------FENRTTHGTHF 1266
            + C+C+IC CG  + P++ ++     P           + + Y   + P+++ P+   +P+         L+    ++ DY    ++K +     + Y P + +F  +TT+  ++ P+  +    FK  +  +  +G F G  +++ DY P  L    A P+E++       P  + F  + T+ +D+        +   RP       N+ F+  TE R+S+    +   K+K  +E+  P       ST   D+         + +P +  + S+ P Q ++T   D+  W + +  L + ++  P P G     +T+   F+P          P ++ + + +    +   DD   ++I    +F P ++ I P+  P      FEN  + G  F
Sbjct:    3 NWCLCQICTCGSDYRPYEIVKQPRHIPEEYKPKQGKIDLGTTYKRDFNPYKVQPLIKVRPVERQQVKKGKLDTVPTYKDDYRSWDIQKCELCKPEQAYHPPDVKFGNSTTFQDDYVPQEIKPRQSFKPCSVVKCSVGPFNGDTSHRRDYVPHQLEVKFARPKEIYK------PTDQPFEDLTTHRNDFQGLAGETAKIC-RPAYTRVTQNIQFKGSTEFRDSFQPWEIPPPKVKKVAEYVPPSGSMQLNSTSHLDYVPYQASRVVAIRPVSHRRQSNFPFQGKSTTKEDFPAWEICRQGLIKQQQQIPNPSGKFEGLSTFRSHFVPHE------LIPTESCKPLNEALKSSVPLDDVTMYSI----QFTPKKQEICPASYPSPPGYIFENTNSQGHKF 383          
BLAST of Stabilizer of axonemal microtubules 1 vs. UniProt
Match: sp|Q658L1|SAXO2_HUMAN (Stabilizer of axonemal microtubules 2 OS=Homo sapiens OX=9606 GN=SAXO2 PE=1 SV=1)

HSP 1 Score: 140.584 bits (353), Expect = 2.367e-35
Identity = 103/373 (27.61%), Postives = 175/373 (46.92%), Query Frame = 1
Query:  355 DYVPHALEKKYVHQREPYKPSEGEFEKNTTYTSEFNPKHGEKAMMFKRNPERRELGKFEGTPTYKADYPGWLASPREVHGKPAEWIPPSETFNGIPTYSSDYVKYKSTKPRESFRPHQETQIPNVPFQDMTENRESYIQHPVEQRKIKDQSEWFRPVVP-FTGESTFSSDFKEKPLGLNRSYKPPAIAKLSSEPL-QNETTHNSDYKPWGVEKPYLHQSERYNPPEGSMMTDTTYLRDFLPRRTERVLAFRPKDNRESIG-QFSSKTSYSDDFQKWNIAARQRFGPNREYIPS-DIPFENRTTHGTHFVPMPLSIRQSFKQSNQTHLSNEPFNGESIYRTEYAPKEVDVCPTFFMGSPRATYEFTGEVDNKGH 1461
            DY P+ + K+  H  E YKP +G+ +  TTY  + N    +   + +    + + GK +  PTYK DY  W     E++     + PP+  F    T+  D+V  +  KPR+SF+P    +    PF  +T +R  YI H +E  K +   E ++P    F   +T   DF +  +G       P   +++   L +  T     ++PW +  P + +   Y PP GSM+ ++T   D++P +   V+  RP   + S    F  K+   +DF  W  + RQ     ++ IP+    F+  +T  +H+VP  L   +S K  N    S+ PF+  ++Y  EY PK  ++CP  +   P   ++ T   +++GH
Sbjct:   20 DYCPYEIVKQPRHVPEEYKPKQGKIDLGTTYKRDLNSYKVQPVAIVRPLERQVKKGKLDTVPTYKDDYRAWDLHKSELYKPEQTYHPPTVKFGNSTTFQDDFVP-QEIKPRQSFKPSSVVKRSTAPFNGITSHRLDYIPHQLE-LKFERPKEVYKPTDQRFEDLTTHRCDF-QGLIGETAKLCRPVHTRVTQNALFEGSTEFRESFQPWEIPPPEVKKVPEYVPPTGSMLLNSTSHLDYVPYQANHVVPIRPVSQKRSNNFPFQGKSIMKEDFPAWE-SCRQGLIKKQQQIPNPSGKFDGLSTFRSHYVPHELIPTESCKPLNIAFKSSVPFDDVTMYSVEYTPKRQEICPASYPSPPGYIFDNT---NSQGH 385          

HSP 2 Score: 103.99 bits (258), Expect = 1.157e-22
Identity = 78/247 (31.58%), Postives = 118/247 (47.77%), Query Frame = 1
Query:  238 SEYTNKYTPHQINPVHSFKPLANYTRNPEPLEDKTNHRIDYVPHALEKKYVHQREPYKPSEGEFEKNTTYTSEFNPKHGEKAMMFKRNPER-RELGKFEGTPTYKADYPGWLASPREVHGKPAEWIPPSETFNGIPTYSSDYVKYKSTKPRESFRPHQETQIPNVPFQDMTENRESY-IQHPVEQRKIKDQSEWFRPVVPFTGESTFSSDFKEKPLGLNRSYKPPAIAKLSSEPLQNETTHNSDYKP 972
            + + + + P +I P  SFKP +   R+  P    T+HR+DY+PH LE K+   +E YKP++  FE  TT+  +F    GE A + +    R  +   FEG+  ++  +  W   P EV   P E++PP+ +     T   DYV Y++       RP  + +  N PFQ  +  +E +       Q  IK Q +   P   F G STF S +    L    S KP  IA  SS P  + T ++ +Y P
Sbjct:  115 TTFQDDFVPQEIKPRQSFKPSSVVKRSTAPFNGITSHRLDYIPHQLELKFERPKEVYKPTDQRFEDLTTHRCDFQGLIGETAKLCRPVHTRVTQNALFEGSTEFRESFQPWEIPPPEVKKVP-EYVPPTGSMLLNSTSHLDYVPYQANH-VVPIRPVSQKRSNNFPFQGKSIMKEDFPAWESCRQGLIKKQQQIPNPSGKFDGLSTFRSHYVPHELIPTESCKPLNIAFKSSVPFDDVTMYSVEYTP 359          

HSP 3 Score: 88.9669 bits (219), Expect = 1.061e-17
Identity = 49/157 (31.21%), Postives = 79/157 (50.32%), Query Frame = 1
Query:  919 LSSEPLQNETTHNSDYKPWGVEKPYLHQSERYNPPEGSMMTDTTYLRDFLPRRTERVLAFRPKDNRESIGQFSSKTSYSDDFQKWNIAARQRFGPNREYIPSDIPFENRTTHGTHFVPMPLSIRQSFKQSNQTHLSNEPFNGESIYRTEYAPKEVDV 1389
            + S  L    +  SDY P+ + K   H  E Y P +G +   TTY RD    + + V   RP + +   G+  +  +Y DD++ W++   + + P + Y P  + F N TT    FVP  +  RQSFK S+    S  PFNG + +R +Y P ++++
Sbjct:    6 MRSWCLCQICSCGSDYCPYEIVKQPRHVPEEYKPKQGKIDLGTTYKRDLNSYKVQPVAIVRPLERQVKKGKLDTVPTYKDDYRAWDLHKSELYKPEQTYHPPTVKFGNSTTFQDDFVPQEIKPRQSFKPSSVVKRSTAPFNGITSHRLDYIPHQLEL 162          
BLAST of Stabilizer of axonemal microtubules 1 vs. TrEMBL
Match: gnl|BL_ORD_ID|15779692 (tr|A0A1I8HXT3|A0A1I8HXT3_9PLAT Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig028915g2 PE=4 SV=1)

HSP 1 Score: 374.4 bits (960), Expect = 4.805e-121
Identity = 182/460 (39.57%), Postives = 272/460 (59.13%), Query Frame = 1
Query:  136 SNKSDLCICKICCCGRHHCPHQPIRSNASGPCVLSEYTNKYTPHQINPVHSFKPLANYTRNPEPLEDKTNHRIDYVPHALEKKYVHQREPYKPSEGEFEKNTTYTSEFNPKHGEKAMMFKRNPERRELGKFEGTPTYKADYPGWLASPREVHGKPAEWIPPSETFNGIPTYSSDYVKYKSTKPRESFRPHQETQIPNVPFQDMTENRESYIQHPVEQRKIKDQSEWFRPVVPFTGESTFSSDFKEKPLGLNRSYKPPAIAKLSSEPLQNETTHNSDYKPWGVEKPYLHQSERYNPPEGSMMTDTTYLRDFLPRRTERVLAFRPKDNRESIGQFSSKTSYSDDFQKWNIAARQRFGPNREYIPSDIPFENRTTHGTHFVPMPLSIRQSFKQSNQTHLSNEPFNGESIYRTEYAPKEVDVCPTFFMGSPRATYEFTGEVDNKGHLLVSPRKMDEMEKQTEVA 1515
            S++ + CIC+IC CGRH C   P R  + GPC LSEY NKY  H + PV S+KP A       PL D+T +R+DYVPH LE+ + HQ + Y+  EG FE  T Y  ++  K G++A   KR  +R  LG+F+G PTYK DY  W  +  +  G    W PP + F GIPTY +DYV Y + +P  SF+P++  ++   P +DMT+ R+SY+ HP+E+R+ +++  W RP VPF G STF+ D+  K   +    KP A    S  P  ++TTH  DYKPW + +P++HQS+ Y PPEG++   TTY++D+      R    +  D     G F   T Y D++++W + +R R GPN++Y P+  PFE ++T  +H+VP PL +R+SFK +       EPF+G ++YR EY PK  + CP  F+ +  + + + G  D +GH +  P+ +      T+++
Sbjct:    3 SSRPEQCICEICNCGRHRCKVHPNRPVSDGPCTLSEYNNKYIQHPMQPVSSYKPAARPAAGDGPLSDQTTNRVDYVPHPLERPHFHQPDQYRQPEGSFEDTTMYKKDYTQKQGDRAQPIKREVKRGALGEFQGEPTYKHDYRQWELTKPDRGGPQNTWQPPRDPFGGIPTYQTDYVPY-AVRPTASFKPNEAAKLSQAPLEDMTDYRQSYVPHPLERRQERERLGWSRPAVPFDGMSTFTRDYTAKGTAVRAPMKPDARPHASDAPFHDDTTHRVDYKPWELSRPFVHQSDTYVPPEGTIDDTTTYVKDYPAHPLVRQTYSKKPDRGLPSGPFDDATDYKDNYRQWQMGSRVRAGPNQQYQPNPAPFEGQSTTSSHYVPHPLDLRRSFKPTQGAARGEEPFDGTTLYRMEYVPKHTEPCPAAFLETNSSRFRYQGN-DERGHQVYVPKDLSVGTTVTDLS 460          
BLAST of Stabilizer of axonemal microtubules 1 vs. TrEMBL
Match: gnl|BL_ORD_ID|18260820 (tr|A0A267F5A9|A0A267F5A9_9PLAT Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig028915g1 PE=4 SV=1)

HSP 1 Score: 372.859 bits (956), Expect = 2.181e-120
Identity = 182/460 (39.57%), Postives = 271/460 (58.91%), Query Frame = 1
Query:  136 SNKSDLCICKICCCGRHHCPHQPIRSNASGPCVLSEYTNKYTPHQINPVHSFKPLANYTRNPEPLEDKTNHRIDYVPHALEKKYVHQREPYKPSEGEFEKNTTYTSEFNPKHGEKAMMFKRNPERRELGKFEGTPTYKADYPGWLASPREVHGKPAEWIPPSETFNGIPTYSSDYVKYKSTKPRESFRPHQETQIPNVPFQDMTENRESYIQHPVEQRKIKDQSEWFRPVVPFTGESTFSSDFKEKPLGLNRSYKPPAIAKLSSEPLQNETTHNSDYKPWGVEKPYLHQSERYNPPEGSMMTDTTYLRDFLPRRTERVLAFRPKDNRESIGQFSSKTSYSDDFQKWNIAARQRFGPNREYIPSDIPFENRTTHGTHFVPMPLSIRQSFKQSNQTHLSNEPFNGESIYRTEYAPKEVDVCPTFFMGSPRATYEFTGEVDNKGHLLVSPRKMDEMEKQTEVA 1515
            S++ + CIC+IC CGRH C   P R  + GPC LSEY NKY  H + PV S+KP A       PL D+T +R+DYVPH LE+ + HQ + Y+  EG FE  T Y  ++  K G++A   KR  +R  LG+F+G PTYK DY  W  +  +  G    W PP + F GIPTY +DYV Y + +P  SF+P++  ++   P +DMT+ R+SY+ HP+E+R+ +++  W RP VPF G STF+ D+  K   +    KP A    S  P  ++TTH  DYKPW + +P++HQS+ Y PPEG++   TTY +D+      R    +  D     G F   T Y D++++W + +R R GPN++Y P+  PFE ++T  +H+VP PL +R+SFK +       EPF+G ++YR EY PK  + CP  F+ +  + + + G  D +GH +  P+ +      T+++
Sbjct:    3 SSRPEQCICEICNCGRHRCKVHPNRPVSDGPCTLSEYNNKYIQHPMQPVSSYKPAARPAAGDGPLSDQTTNRVDYVPHPLERPHFHQPDQYRQPEGSFEDTTMYKKDYTQKQGDRAQPIKREVKRGALGEFQGEPTYKHDYRQWELTKPDRGGPQNTWQPPRDPFGGIPTYQTDYVPY-AVRPTASFKPNEAAKLSQAPLEDMTDYRQSYVPHPLERRQERERLGWSRPAVPFDGMSTFTRDYTAKGTAVRAPMKPDARPHASDAPFHDDTTHRVDYKPWELSRPFVHQSDTYVPPEGTIDDTTTYGKDYPAHPLVRQTYSKKPDRGLPSGPFDDATDYKDNYRQWQMGSRVRAGPNQQYQPNPAPFEGQSTTSSHYVPHPLDLRRSFKPTQGAARGEEPFDGTTLYRMEYVPKHTEPCPAAFLETNSSRFRYQGN-DERGHQVYVPKDLSVGTTVTDLS 460          
BLAST of Stabilizer of axonemal microtubules 1 vs. TrEMBL
Match: gnl|BL_ORD_ID|15785074 (tr|A0A1I8J1J1|A0A1I8J1J1_9PLAT Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig030940g1 PE=4 SV=1)

HSP 1 Score: 357.066 bits (915), Expect = 2.661e-114
Identity = 178/449 (39.64%), Postives = 263/449 (58.57%), Query Frame = 1
Query:  133 MSNKSDLCICKICCCGRHHCPHQPIRSNASGPCVLSEYTNKYTPHQINPVHSFKPLANYTRNPEPLEDKTNHRIDYVPHALEKKYVHQREPYKPSEGEFEKNTTYTSEFNPKHGEKAMMFKRNPERRELGKFEGTPTYKADYPGWLASPREVHGKPAEWIPPSETFNGIPTYSSDYVKYKSTKPRESFRPHQETQIPNVPFQDMTENRESYIQHPVEQRKIKDQSEWFRPVVPFTGESTFSSDFKEKPLGLNRSYKPPAIAKLSSEPLQNETTHNSDYKPWGVEKPYLHQSERYNPPEGSMMTDTTYLRDFLPRRTERVLAFRPKDNRESIGQFSSKTSYSDDFQKWNIAARQRFGPNREYIPSDIPFENRTTHGTHFVPMPLSIRQSFKQSNQTHLSNEPFNGESIYRTEYAPKEVDVCPTFFMGSPRATYEFTGEVDNKGHLLVSPR 1479
            MS +   CIC+IC CGRH C   P R    GPC LSEYTNK+ PH I PV SFKP      +  PL DKT HR+D+VPH L++   HQ E Y+P  G+F+  T Y+ E+  K  ++A+  KR  +R   G+F G PTYK DY  W     E      +W P    F G+PTY++DYV +   +P  S +P++  ++ + P ++ T+ R+S++ HP+E+RK K++  W RP  PF G STF+ DF  K   +  S KP A A  S+ P +++TTH  D+KPW +++  +H++E Y PPEG +   TTY++D+   +  R    R  +     G+F+  T Y D+F+KW +  R++ GPN+ Y P+  PFE ++T  +HFVP P+ +R+SFK S     +  PF+G ++YR EY PK ++ CP   + +  + Y +  E D+ GH     R
Sbjct:    1 MSARPTQCICQICNCGRHRCKLHPNRPIRDGPCQLSEYTNKFIPHAIVPVGSFKPTVRAAGSEGPLSDKTTHRVDFVPHPLDRPKQHQAEQYRPPSGQFDGITMYSKEYTEKRADRAVPAKREVKRGVAGEFRGEPTYKHDYRKWDMPKLERSRTNPQWEPSKTPFGGLPTYTTDYVAHPG-RPSTSCKPNEVARMSSAPLENQTDYRQSFVPHPLERRKEKERQVWARPSAPFDGLSTFTRDFTPKSAMVRSSMKPDATAFASNAPFKDDTTHRLDFKPWELQRHAVHKAEPYVPPEGHVDGTTTYVKDYPAHKVVRETYTRRPERGLPSGEFNDATDYKDNFKKWALTGREKVGPNQTYQPNSAPFEGQSTTASHFVPHPMDVRRSFKPSQDAARTEGPFDGTTLYRMEYVPKHIEPCPAALLDTETSRYLYK-ETDDTGHKFYQAR 447          
BLAST of Stabilizer of axonemal microtubules 1 vs. TrEMBL
Match: gnl|BL_ORD_ID|18295655 (tr|A0A267GHI9|A0A267GHI9_9PLAT Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig030145g1 PE=4 SV=1)

HSP 1 Score: 348.977 bits (894), Expect = 1.014e-111
Identity = 169/408 (41.42%), Postives = 246/408 (60.29%), Query Frame = 1
Query:  136 SNKSDLCICKICCCGRHHCPHQPIRSNASGPCVLSEYTNKYTPHQINPVHSFKPLANYTRNPEPLEDKTNHRIDYVPHALEKKYVHQREPYKPSEGEFEKNTTYTSEFNPKHGEKAMMFKRNPERRELGKFEGTPTYKADYPGWLASPREVHGKPAEWIPPSETFNGIPTYSSDYVKYKSTKPRESFRPHQETQIPNVPFQDMTENRESYIQHPVEQRKIKDQSEWFRPVVPFTGESTFSSDFKEKPLGLNRSYKPPAIAKLSSEPLQNETTHNSDYKPWGVEKPYLHQSERYNPPEGSMMTDTTYLRDFLPRRTERVLAFRPKDNRESIGQFSSKTSYSDDFQKWNIAARQRFGPNREYIPSDIPFENRTTHGTHFVPMPLSIRQSFKQSNQTHLSNEPFNGESIYR 1359
            S++ + CIC+IC CGRH C   P R  + GPC LSEY NKY  H + PV S+KP A       PL D+T +R+DYVPH LE+ + HQ + Y+  EG FE  T Y  ++  K G++A   KR  +R  LG+F+G PTYK DY  W  +  +  G    W PP + F GIPTY +DYV Y + +P  SF+P++  ++   P +DMT+ R+SY+ HP+E+R+ +++  W RP VPF G STF+ D+  K   +    KP A    S  P  ++TTH  DYKPW + +P++HQS+ Y PPEG++   TTY++D+      R    +  D     G F   T Y D++++W + +R R GPN++Y P+  PFE ++T  +H+VP PL +R+SFK +       EPF+G ++YR
Sbjct:    3 SSRPEQCICEICNCGRHRCKVHPNRPVSDGPCTLSEYNNKYIQHPMQPVSSYKPAARPAAGDGPLSDQTTNRVDYVPHPLERPHFHQPDQYRQPEGSFEDTTMYKKDYTQKQGDRAQPIKREVKRGALGEFQGEPTYKHDYRQWELTKPDRGGPQNTWQPPRDPFGGIPTYQTDYVPY-AVRPTASFKPNEAAKLSQAPLEDMTDYRQSYVPHPLERRQERERLGWSRPAVPFDGMSTFTRDYTAKGTAVRAPMKPDARPHASDAPFHDDTTHRVDYKPWELSRPFVHQSDTYVPPEGTIDDTTTYVKDYPAHPLVRQTYSKKPDRGLPSGPFDDATDYKDNYRQWQMGSRVRAGPNQQYQPNPAPFEGQSTTSSHYVPHPLDLRRSFKPTQGAARGEEPFDGTTLYR 409          

HSP 2 Score: 98.5969 bits (244), Expect = 2.404e-18
Identity = 53/177 (29.94%), Postives = 89/177 (50.28%), Query Frame = 1
Query:  844 STFSSDFKEKPLGLNRSYKPPAIAKLSSEPLQNETTHNSDYKPWGVEKPYLHQSERYNPPEGSMMTDTTYLRDFLPRRTERVLAFRPKDNRESIGQFSSKTSYSDDFQKWNIAARQRFGPNREYIPSDIPFENRTTHGTHFVPMPLSIRQSFKQSNQTHLSNEPFNGESIYRTEYAP 1374
            S +++ + + P+    SYKP A       PL ++TT+  DY P  +E+P+ HQ ++Y  PEGS    T Y +D+  ++ +R    + +  R ++G+F  + +Y  D+++W +    R GP   + P   PF    T+ T +VP  +    SFK +    LS  P    + YR  Y P
Sbjct:   37 SEYNNKYIQHPMQPVSSYKPAARPAAGDGPLSDQTTNRVDYVPHPLERPHFHQPDQYRQPEGSFEDTTMYKKDYTQKQGDRAQPIKREVKRGALGEFQGEPTYKHDYRQWELTKPDRGGPQNTWQPPRDPFGGIPTYQTDYVPYAVRPTASFKPNEAAKLSQAPLEDMTDYRQSYVP 213          
BLAST of Stabilizer of axonemal microtubules 1 vs. TrEMBL
Match: gnl|BL_ORD_ID|15777586 (tr|A0A1I8HA86|A0A1I8HA86_9PLAT Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig009654g1 PE=4 SV=1)

HSP 1 Score: 347.051 bits (889), Expect = 3.669e-110
Identity = 171/456 (37.50%), Postives = 268/456 (58.77%), Query Frame = 1
Query:  139 NKSDLCICKICCCGRHHC---PHQPIRSNASGPCVLSEYTNKYTPHQINPVH-SFKPLANYTRNP-EPLEDKTNHRIDYVPHALEKKYVHQREPYKPSEGEFEKNTTYTSEFNPKHGEKAMMFKRNPERRELGKFEGTPTYKADYPGWLASPR-EVHGKPAEWIPPSETFNGIPTYSSDYVKYKSTKPRESFRPHQETQIPNVPFQDMTENRESYIQHPVEQRKIKDQSEWFRPVVPFTGESTFSSDFKEKPLGLNRSYKPPAIAKLSSEPLQNETTHNSDYKPWGVEKPYLHQSERYNPPEGSMMTDTTYLRDFLPRRTERVLAFRPKDNR-ESIGQFSSKTSYSDDFQKWNIAARQRFGPNREYIPSDIPFENRTTHGTHFVPMPLSIRQSFKQSNQTHLSNEPFNGESIYRTEYAPKEVDVCPT--FFMGSPRATYEFTGEVDNKGHLLVSPR 1479
            ++++ CICK+C CGRH C   P++P  +   GPC  +EY  KY PH   P+  S KP     RN  +P+ D+T +R+D+VPH LE+  +HQ EPY+P+ G  +  T Y  E+  K GE+A   KR P R   G+F+G PTY  DY  W    R    G+P++W P  E+F G+PTY +D+V +   +P  S +P +  +    P  D+T+ R+SY+ H +E+R+ K+  +W +P VPF G +TF+ D+  K  G     KP A A  S+ P + +TTH  DYK W + +P++H++E Y PPEG++   T+Y+RD+        + +  ++ R    G F   T Y +++++W ++ R + GP+R+Y P+  PFE ++T   HFVP  L  +++FK ++    ++EPF+G ++YRTE+ P+  + CP      G   A Y+F G  D KGH + +PR
Sbjct:    2 SRNEQCICKLCNCGRHKCKLHPNRPASNRTGGPCGYTEYAQKYAPHPPQPMQTSCKPANQPIRNGNDPMTDETTNRVDFVPHPLERPRLHQHEPYRPASGTIDATTVYQREYTEKRGERAAAVKREPRRANAGEFQGEPTYARDYRKWELPERVSGQGRPSQWEPSRESFGGVPTYQTDFVAHSDARPPASCKPAEAAKTSQSPLDDVTDYRQSYVPHQLERRRAKEIQDWQKPAVPFEGVTTFARDYTPKAGGSRTLVKPSAQAYASNAPFEEDTTHKLDYKAWELSRPFVHKNEPYAPPEGAIEGTTSYVRDYPAHPAREKVGYLTREPRGRPSGPFEGSTVYKENYRQWELSGRVQAGPDRQYQPNQAPFEGQSTTAAHFVPHQLEAKRNFKPASGAAKNDEPFDGTTLYRTEFVPRHPEPCPAMQLLAGESTAGYKFQGH-DEKGHQIYAPR 456          
BLAST of Stabilizer of axonemal microtubules 1 vs. Ensembl Cavefish
Match: saxo2 (stabilizer of axonemal microtubules 2 [Source:NCBI gene;Acc:103022203])

HSP 1 Score: 199.519 bits (506), Expect = 2.995e-57
Identity = 144/464 (31.03%), Postives = 219/464 (47.20%), Query Frame = 1
Query:  151 LCICKICCCGRHHCPHQPI---RSNASGPCVLSEYTNKYTPHQI-NPVHSFKPLANYTRNPEPLEDKTNHRIDYVPHALEKKYVHQREPYKPSEGEFEKNTTYTSEFNPKHGEKAMMFK-RNPERRELGKFEGTPTYKADYPGWLASPREVHGKPAEWIPPSETFNGIPTYSSDYVKYKSTKPRESFRPHQETQIPNVPFQDMTENRESYIQHPVEQRKIKDQSEWFRPVVPFTGESTFSSDFKEKPLGLNRSYKPPAIAKLSSEPLQNETTHNSDYKPWGVEKPYLHQSERYNPPEGSMMTDTTYLRDFLPRRTERVLAFR--PKDNRESIGQFSSKTSYSDDFQKWNIAAR-QRFGPNREYIPSDIPFENRTTHGTHFVPMPLSIRQSFKQSNQTHLSNEPFNGESIYRTEYAPKEVDVCPTFFMGSPRATYEFTGEVDNKGHLLVSPRKMDEMEKQTEVAV 1518
            LC+C+IC CGRH CPHQP    R  + G  V +EY  K+  H+   P    KP   YT +   +E  T  + D++P+ + ++   Q+  Y+P+ GE +  TTY  +FNP   +     K +   R   GK    PTYK D+  W    RE+      + PP   F    T+  D+V  +    RESF+P    +  + PF+ +T N+ SYI HPVE R IK   E+     PF   +T   D++     + +S+KP  +   S  P Q+ T     ++ W V  P +H+S  Y  P   M   TT    ++  + +  ++ +  PK NR S   F S T+  DDF+ W  A R   F    E   +    E+ TT   HF+  PL    S+K +     ++ P    + YRT++ PK+V VCP  F   P   ++ +   D +GH     R  D+ + Q ++ V
Sbjct:    4 LCVCEICNCGRHRCPHQPTVLYRKGSEGYAV-TEYVEKFPAHESRQPPKILKPKYEYTADRGKMEGTTTFKSDFIPYEVSRRPGKQQAEYQPNPGEIDLGTTYKQDFNPYQLQPVTPLKPKVMIRPTSGKLNAVPTYKEDFRAWEIPKRELSKPDETYHPPPGKFGNTTTFQDDFVP-RGPVLRESFKPLNVAKQNDAPFEGVTSNQLSYIPHPVEARFIKAPEEYKPSSQPFQDLTTHRKDYQGISGPMPKSFKPERVKISSEAPFQSSTEFRERFQQWPVSLPQVHKSVEYVSPTADMDLTTTTKTTYIKHKVQPFISIKPFPKPNR-SPAPFHSNTTMKDDFKPWVTARRLSTFHKPEEIQRASGKMEDLTTFRAHFIQHPLQPNISYKPAAAPPRTDVPLEESTSYRTDFTPKKVSVCPASFESPPGFIFQNS---DERGHRFFR-RVSDQDKIQVQLQV 460          
BLAST of Stabilizer of axonemal microtubules 1 vs. Ensembl Cavefish
Match: ENSAMXT00000002606.2 (pep primary_assembly:Astyanax_mexicanus-2.0:16:25802480:25804640:1 gene:ENSAMXG00000002546.2 transcript:ENSAMXT00000002606.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 67.781 bits (164), Expect = 8.908e-12
Identity = 71/289 (24.57%), Postives = 115/289 (39.79%), Query Frame = 1
Query:  328 LEDKTNHRIDYVP-HALEKKYVHQREPYKPSEGEFEKNTTYTSEFNPKHGEKAMMFKR-----NPERRELGKFEGTPTYKADYPGWLASPREVHGKPAEWIPPSETFNGIPTYSSDYVKYKSTKPRESFRPHQETQIPNVPFQDMTENRESYIQHPVEQRKIKDQSEWFRPVVPFTGESTFSSDFKE---------KPLG----LNRSYKPPAIAKLS---------------SEPLQNETTHNSDYKPWGVEKPYLHQSERYNPPEGSMMTDTTYLRDFLPRRTERVL 1092
            +E+KT  R+DYVP H + +     ++ Y P +G     +TYT ++     +K ++ K+     NP      K      YK  +  W                    F    T+  DY    ST PR++F+P  +  + ++PF   T  + +YI HPV+ RK K + ++  P   F GEST+  DFK          KP+G    L+ ++      K                  +P Q  +    DY+PW       HQ+     PE +        +   P R+E+ +
Sbjct:    1 MENKTTFRLDYVPHHVIRRSPKAGKQLYIPPDGTMMLTSTYTEDYREHQVQKLLVNKKTEKYCNP----TAKMAPMSLYKEQFKPWCVERLRPFKITDNLQLNQGKFVNTTTFQDDYSAKGSTSPRKNFKPITQI-VESLPFDGTTNYKLNYITHPVQSRKPKTK-KYRPPSASFHGESTYKQDFKGLRTEAPKPIKPVGNMDFLSTTHADYVAHKCQRIQRVEPLIHAWEKVKKPFQGTSVMKEDYQPWDAA----HQTSIMRVPETA--------KSLGPSRSEKTV 271          
BLAST of Stabilizer of axonemal microtubules 1 vs. Ensembl Sea Lamprey
Match: saxo2 (stabilizer of axonemal microtubules 2 [Source:ZFIN;Acc:ZDB-GENE-051127-27])

HSP 1 Score: 168.703 bits (426), Expect = 1.256e-46
Identity = 136/458 (29.69%), Postives = 218/458 (47.60%), Query Frame = 1
Query:  181 RHHCPHQP--IRSNASGPCVLSEYTNKYTPHQIN-PVHSFKPLANYTRNPEPLEDKTNHRIDYVPHALEKKYVHQREPYKPSEGEFEKNTTYTSEFN--PKHGEKAMMFKRNP---ERRELGKFEGTPTYKADYPGWLASPREVHGKPAEWIPPSETFNGIPTYSSDYVKYKSTKPRESFRPHQETQIPNVPFQDMTENRESYIQHPVEQRKIKDQSEWFRPVVPFTGESTFSSDFKE-KPLGLNRSYKPPAIAKLSSEPLQNETTHNSDYKPWGVEKPYLHQSERYNPPEGSMMTDTTYLRDFLPRRTERVLAFRP--KDNRESIGQFSSKTSYSDDFQKWNIAARQRFGPNREYIPSDI-PFENRTTHGTHFVPMPLSIRQSFKQSNQTHLSNEPFNGESIYRTEYAPKEVDVCPTFFMGSPRATYEFTGEVDNKGHLLVSPRKMDEMEKQTEVAV 1518
            RH CPHQP  I +    PC+++EY ++Y  + +  P  SF+P   Y      ++  T  R DY+P+   K+ V   E YKP  G    +TTY ++FN  P H    ++    P   + +  GK +  PTY+ DY  W    RE       ++P +  +  + T+  DY   K   P  SF+P    +     F+D T +R +Y+ H +E R  ++   +      F   +TF  DF+   P    +S+KP  +   S +   + T  N  +K W +  P + +   Y+PP G+M T TT   D++  R ER+L  RP  +D R S+  F   T+  + ++ W  A R+    + E +   +  F++ TT   H+VP+PL    S+K       S+ PF   ++YR+EY PK+V VCP  +   P+       E D +GHL    R++ +  K    A+
Sbjct:    1 RHRCPHQPTGIYTQTEKPCLITEYVDRYHEYGLGGPRESFRPQHMYQGPQGKMDGITTFRADYIPYEAGKRPVRPVEAYKPVPGTMSMDTTYKTDFNEMPIH----LVLPARPMENQHQAHGKMDTIPTYQNDYRQWEILKRENAKPNYTYVPSTNKYGYMTTFQDDY-HAKQGGPSTSFKPANVMKPSEGAFEDRTTHRSAYVPHQLEARFAREPERYKPSTQQFDSLTTFRRDFQSLGPQEPVKSFKPEHVKVGSDDKFNDSTEFNDKFKVWPLSPPPVRKQAMYHPPTGTMDTTTTSHDDYVQHRQERILLARPISRDRRLSL-PFDGHTTMREAYKPW-AAQREPMIKHVEQMQRSLGKFDDMTTFREHYVPLPLIPMHSYKPKGGAVRSSAPFESGTMYRSEYTPKKVAVCPASY---PQPLGYAFQEKDTRGHLYF--RRLSDAHKMQIAAM 446          
BLAST of Stabilizer of axonemal microtubules 1 vs. Ensembl Nematostella
Match: EDO43170 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZN3])

HSP 1 Score: 107.842 bits (268), Expect = 2.928e-25
Identity = 102/405 (25.19%), Postives = 170/405 (41.98%), Query Frame = 1
Query:  181 RHHCPHQPIRSNASGPCVLSEYTNKYTPHQINP-VHSFKPLANYTRNPEPLEDKTNHRIDYVPHAL--------------------EKKYVHQ-----------REP---YKPSEGEFEKNTTYTSEFNPKHGEKAMMFKRNPERREL---GKFEGTPTYKADYPGWLASPREVHGKP-----------------------AEWIPPSET-------------FNGIPTYSSDYVKYKSTKPRESFRPHQETQIPNVPFQDMTENRESYIQHPVEQRKIKDQSEWFRPVVPFTGESTFSSDFKEKPLGLNRSYKPPAIAKLSSEPLQNETTHNSDYKPWGVEK-PYLHQSERYNPPEGSMMTDTTYLRDFLPRRTERVLAFRPKDNRESI-GQFSSKTSYSDDFQ 1167
            RH C H+P     +  C+ +EY ++Y  H         KP  +   +  PLED+T++R+DYV H                      E  Y H             +P   Y+P +  F+ +T +   F P     + +    P+ + +   G+ +G   ++ D+PG  + PR    +P                        + I P+++             F GI T   D+  YK+ +P  SF+P Q  Q  N PF+D T  RESY +  + +R+++++  +  P   F  ++TF  D+ E  +G  +S +PP  +  S++P Q+ TTH+  YK W V+  P   + E Y PP      ++T    F  +   R    R + NR +  G     T+Y D F+
Sbjct:    2 RHRCAHRPETRGPTHKCLFTEYQDRYKDHPFGERTKPIKPDRSVRISDAPLEDRTHYRLDYVSHKYAPPKKREKDRWIKPDGRVEDESTYKHDYPGRMVAPAESAKPACTYQPHDKPFQGSTVHQDTFRPWDLNLSRVKSMKPDTQSMARDGRMDGRTIHQTDFPG-HSVPRRPAIRPPNSDLRANCGPMENDTTTRLDYTKKQILPAQSAKPVYRRPSTGPPFQGITTCQHDF-GYKTGRPAASFKPQQGAQQSNAPFEDSTTTRESYPKWAIPKRQMREKEAYRPPSGKFKDDTTFRHDYPEWNVGPAQSARPPVQSFASNQPFQDSTTHSDTYKKWAVQAVPKSTKPEGYRPPSRKFEGESTMQSHFRGQYGPRSKPVRQEMNRPATSGPMDLHTTYDDTFK 404          

HSP 2 Score: 67.3958 bits (163), Expect = 4.756e-12
Identity = 59/233 (25.32%), Postives = 88/233 (37.77%), Query Frame = 1
Query:  694 FRPHQETQIPNVPFQDMTENRESYIQHPVEQRKIKDQSEWFRPVVPFTGESTFSSDFKEKPLGLNRSYKPPAIAKLSSEPLQNETTHNSDYKPWGVEKPYLHQSERYNPPEGSMMTD------TTYLRDFLPRRTERVLAFRP--KDNRESIGQFSSKTSYSDDFQKWNIAARQRFGPNREYIPSDIPFENRTTHGTHFVPMPLSIRQSFKQSNQTHLSNEPFNGESIYRTEY 1368
             +P +  +I + P +D T  R  Y+ H     K +++  W +P      EST+  D+  + +    S KP    +   +P Q  T H   ++PW +    L + +   P   SM  D      T +  DF      R  A RP   D R + G   + T+   D+ K  I   Q   P      +  PF+  TT    F         SFK       SN PF   +  R  Y
Sbjct:   39 IKPDRSVRISDAPLEDRTHYRLDYVSHKYAPPKKREKDRWIKPDGRVEDESTYKHDYPGRMVAPAESAKPACTYQPHDKPFQGSTVHQDTFRPWDLN---LSRVKSMKPDTQSMARDGRMDGRTIHQTDFPGHSVPRRPAIRPPNSDLRANCGPMENDTTTRLDYTKKQILPAQSAKPVYRRPSTGPPFQGITTCQHDFGYKTGRPAASFKPQQGAQQSNAPFEDSTTTRESY 268          
BLAST of Stabilizer of axonemal microtubules 1 vs. Ensembl Nematostella
Match: EDO36385 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIR4])

HSP 1 Score: 73.559 bits (179), Expect = 7.105e-14
Identity = 80/332 (24.10%), Postives = 134/332 (40.36%), Query Frame = 1
Query:  118 NIIFRMSNKSDLCICKICC-CGRHHCPH------QPIRSNASGPCVLSEYTNKY--TPHQINPVHSFKPLANYTRNPE-PLEDKTNHRIDYVPHALEKKYVHQREPYKPSEGEFEKNTTYTSEFNPKHGEKAMMFKRNPERREL------GKFEGTPTYKADYPGWLASPREVHGKPAEWIPPSETFNGIPTYSSDYVKYKSTKPRESFRPHQETQIPNVPFQDMTENRESYIQHPVEQRKIKDQSEWFRPVVPFTGESTFSSD---FKEKPLGLNRSYKPPAIAKLSSEPLQNETTHNSDYKPWGVEKPYLHQSERYNPPEGSMMTDTTYL 1056
            +++   SN+  L I        RH CPH      + I       C ++EY   Y     Q  P H  + L +    PE  + D T  +  Y+ H +      + E Y P+   FE   T +   +   G +A   + NP  + +       + +   T   DY  W   P E   +   + PP + FN    +  D+V++ +  PR + R   + ++        T N   +    +  +  K + E+  P  PF+  S F +D   F+  P      Y+P +    + +P+Q ETT N+D++ W VE       ERY  P+G +   TT +
Sbjct:   47 SVLLSSSNRFLLTIIDFQFEWLRHRCPHGSSDPNRVINKEREDKCSVTEYKGNYHRKSAQRGPFHRPRDLLH----PEGDIPDNTTSKTSYITHEVSPPKKKEPEKYVPNPNRFE---TVSENKDHYRGSRAPPARMNPYLKGITMRVPSAQIQYMSTSHGDYRTWKPEPLEKISRSKTYAPPEQPFNETSIHRQDFVRF-NQPPRPTARQPDKIRMSGS-MDKTTTNLTYFTPKEIPPKMEKKRDEYVAPEQPFSSTSIFKTDYQDFRNAPKAA--MYRPISDLFATDKPMQRETTKNADFQQWRVEARKQKSPERYQRPDGEVECKTTTM 367          
BLAST of Stabilizer of axonemal microtubules 1 vs. Ensembl Nematostella
Match: EDO48878 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHM3])

HSP 1 Score: 60.077 bits (144), Expect = 1.202e-9
Identity = 105/479 (21.92%), Postives = 183/479 (38.20%), Query Frame = 1
Query:  106 QYNSNIIFRMSNKSDLCICKICCCGRHH----CPH-----QPIRSNASGPCVLSEYTNKYTPHQINPVHSFKPLANYTRNPE--PLEDKTNHRIDYVPHALE-KKYVHQREPYKPSEGEFEKNTTYTSEFNPK------HGEKAMMFKRNPERRELGKFEGTPTYKADYPGWLASPREVHGKPAEWIPPSETFNG---IPTYSSDYVKYKSTKPRESFRPHQETQIPNVPFQDM---------TENRESYIQHPVEQRKIKDQSEWFRPV---VPFTGESTFSSDF----KEKPLGLNRSYKPPAIAKLSSEPLQN-ETTHNSDYK----PWGVEKPYLHQSER--YNPPEGSMMTDTTYLRDFLPRRTERVLAFRPKDNRE-SIGQFSSKTSYSDDFQKWNIAARQRFGPNRE---YIPSDIPFENRTTHGTHFVPMPLSI--RQSFKQSNQTHLSNEPFNGESIYRTEYAPKEVDVC 1392
            QY++     + ++   C+C++C CGR+H    C       Q +        V ++Y   Y  H   P H  +PL    RNP   P++ +T  R+ +V   L   K     E Y  S  + +  T Y  E+  +      H  +       PE     KF+G  T+ A +      P+  +G+    +P   TF G    P  +S    +     +  + P  +T +P     D+         T ++++Y     E R+   + +    +     F G++ F SDF       P        PPA   L     QN ETT+N  +K    P  + +  + + E   +  P+  M   T  + D+  +   +V   RP    E S  +F  +T+Y   F+       +R+G   E   Y+     F    +  T      +    R +FK   Q  +++     +++Y+ ++  K  D C
Sbjct:    6 QYSAATEKLLKDRGLKCVCELCDCGRYHRHEGCTRNVQKMQQVFKRPGMGQVETDYQATYKSHNAAPRHLRRPLPKL-RNPHPPPMDFRTEQRLQFVERELPFTKPCKMMESYTISSSKLDGATEYNQEYKDRGPPSIVHLSRPKTVTSKPE----AKFQGETTHNATFTAKKPLPQATYGE----LP---TFTGSILFPDKTSAMKTWNQEVYKGKYAPVAKTCVPGADQVDIGVEGDHYHTTTHQDTYKTPAHEGRQELQKRKAVISMGKRAKFQGDTQFRSDFPGYHGRMPKPAKSVQPPPATLSLKMNNDQNFETTNNDTFKITWDPKTIGRTQMMKPEMSTHVNPDLKMEVMTQTMVDYTQKAPVKVPVIRPPTRTEPSNIKFEGETAYQSQFKPHENVPFKRYGDFHESAVYLKPISKFHQDGSVTTQDFKGAIGGRPRTTFKPEQQLQMTDGKILDKTVYKADFIQKNQDEC 472          
BLAST of Stabilizer of axonemal microtubules 1 vs. Planmine SMEST
Match: SMESG000042230.1 (SMESG000042230.1)

HSP 1 Score: 965.681 bits (2495), Expect = 0.000e+0
Identity = 463/463 (100.00%), Postives = 463/463 (100.00%), Query Frame = 1
Query:  133 MSNKSDLCICKICCCGRHHCPHQPIRSNASGPCVLSEYTNKYTPHQINPVHSFKPLANYTRNPEPLEDKTNHRIDYVPHALEKKYVHQREPYKPSEGEFEKNTTYTSEFNPKHGEKAMMFKRNPERRELGKFEGTPTYKADYPGWLASPREVHGKPAEWIPPSETFNGIPTYSSDYVKYKSTKPRESFRPHQETQIPNVPFQDMTENRESYIQHPVEQRKIKDQSEWFRPVVPFTGESTFSSDFKEKPLGLNRSYKPPAIAKLSSEPLQNETTHNSDYKPWGVEKPYLHQSERYNPPEGSMMTDTTYLRDFLPRRTERVLAFRPKDNRESIGQFSSKTSYSDDFQKWNIAARQRFGPNREYIPSDIPFENRTTHGTHFVPMPLSIRQSFKQSNQTHLSNEPFNGESIYRTEYAPKEVDVCPTFFMGSPRATYEFTGEVDNKGHLLVSPRKMDEMEKQTEVAVY 1521
            MSNKSDLCICKICCCGRHHCPHQPIRSNASGPCVLSEYTNKYTPHQINPVHSFKPLANYTRNPEPLEDKTNHRIDYVPHALEKKYVHQREPYKPSEGEFEKNTTYTSEFNPKHGEKAMMFKRNPERRELGKFEGTPTYKADYPGWLASPREVHGKPAEWIPPSETFNGIPTYSSDYVKYKSTKPRESFRPHQETQIPNVPFQDMTENRESYIQHPVEQRKIKDQSEWFRPVVPFTGESTFSSDFKEKPLGLNRSYKPPAIAKLSSEPLQNETTHNSDYKPWGVEKPYLHQSERYNPPEGSMMTDTTYLRDFLPRRTERVLAFRPKDNRESIGQFSSKTSYSDDFQKWNIAARQRFGPNREYIPSDIPFENRTTHGTHFVPMPLSIRQSFKQSNQTHLSNEPFNGESIYRTEYAPKEVDVCPTFFMGSPRATYEFTGEVDNKGHLLVSPRKMDEMEKQTEVAVY
Sbjct:    1 MSNKSDLCICKICCCGRHHCPHQPIRSNASGPCVLSEYTNKYTPHQINPVHSFKPLANYTRNPEPLEDKTNHRIDYVPHALEKKYVHQREPYKPSEGEFEKNTTYTSEFNPKHGEKAMMFKRNPERRELGKFEGTPTYKADYPGWLASPREVHGKPAEWIPPSETFNGIPTYSSDYVKYKSTKPRESFRPHQETQIPNVPFQDMTENRESYIQHPVEQRKIKDQSEWFRPVVPFTGESTFSSDFKEKPLGLNRSYKPPAIAKLSSEPLQNETTHNSDYKPWGVEKPYLHQSERYNPPEGSMMTDTTYLRDFLPRRTERVLAFRPKDNRESIGQFSSKTSYSDDFQKWNIAARQRFGPNREYIPSDIPFENRTTHGTHFVPMPLSIRQSFKQSNQTHLSNEPFNGESIYRTEYAPKEVDVCPTFFMGSPRATYEFTGEVDNKGHLLVSPRKMDEMEKQTEVAVY 463          
BLAST of Stabilizer of axonemal microtubules 1 vs. Planmine SMEST
Match: SMESG000009389.1 (SMESG000009389.1)

HSP 1 Score: 365.54 bits (937), Expect = 4.770e-121
Identity = 194/447 (43.40%), Postives = 257/447 (57.49%), Query Frame = 1
Query:  139 NKSDLCICKICCCGRHHCPHQPIRSNASGPCVLSEYTNKYTPHQINPVHSFKPLANYTRNPEPLEDKTNHRIDYVPHALEKKYVHQREPYKPSEGEFEKNTTYTSEFNPKHGEKAMMFKRNPERRELGKFEGTPTYKADYPGWLASPREVHGKPAEWIPPSETFNGIPTYSSDYVKYKSTKPRESFRPHQETQIPNVPFQDMTENRESYIQHPVEQR-KIKDQSEWFRPVVPFTGESTFSSDFKEKPLGLNRSYKPPAIAKLSSEPLQNETTHNSDYKPWGVEKPYLHQSERYNPPEGSMMTDTTYLRDFLPRRTERVLAFRPKDNRESIGQFSSKTSYSDDFQKWNIAARQRFGPNREYIPSDIPFENRTTHGTHFVPMPLSIRQSFKQSNQTHLSNEPFNGESIYRTEYAPKEVDVCPTFFMGSPRATYEFTGEVDNKGHLLVSP 1476
            N + LCIC+IC CGRH CPH P     +GPC  SEYTNKYTPH   PV S KP A    + +PL D+T  R+DYVPH L++  VH  E ++P EG  +  + Y SE+  K   K    K    R++LGKFEG PTY+ DY  W  S  +       W PP E F G+PTY+SDYV YK+  P+ S +P         PF+DMT+ R+SY++HP+E + K KD++ W +  VPF G +TF  DF  K  G   S KP A A  S  PLQ++TT+  DYKPW V++P  H ++ Y  P+G M   TTYLRD+      + LA +PK    S+  F   T Y D ++KWN+  R   GPN +Y P  +PFE  +TH  HF+  PL  R+S K   + + ++  F+  +IYR EY  K VD CP   + SPRA + +  E DN GH    P
Sbjct:    5 NGTKLCICEICNCGRHKCPHHPAVRQTAGPCTFSEYTNKYTPHPFMPVSSCKPAAVAMHSSDPLSDQTTTRVDYVPHPLQRVKVHHTEMHRPPEGRMDDTSVYNSEYTEKRVPKTEPIKHQLMRKDLGKFEGEPTYRNDYRKWELSRPDRAQTVLTWSPPKERFEGLPTYTSDYVGYKAA-PQASCKPDVSALHSEAPFEDMTDYRQSYVKHPLEGKLKPKDRAMWAKSAVPFDGLTTFKRDFTPKEGGKAGSCKPLAQAFQSGAPLQSDTTNRIDYKPWEVKRPSHHLADPYKIPDGDMDMHTTYLRDYPEHPYMKSLAIKPKARGRSLEPFQGTTDYRDSYKKWNMGQRPHVGPNLQYHPPSVPFEGESTHHAHFIQHPLDPRKSCKPDPRAYANSGEFDDGTIYRMEYTKKHVDPCPAALLESPRARFIYR-EQDNSGHKFYEP 449          
BLAST of Stabilizer of axonemal microtubules 1 vs. Planmine SMEST
Match: SMESG000067500.1 (SMESG000067500.1)

HSP 1 Score: 205.297 bits (521), Expect = 1.002e-57
Identity = 144/446 (32.29%), Postives = 216/446 (48.43%), Query Frame = 1
Query:  181 RHHCPHQPIRSNASGPCVLSEYTNKYTPHQINPVHSFKPLANYTRNPEPLEDKTNHRIDYVPHALEKKYVHQREPYKPSEGEFEKNTTYTSEFNPKHGEKAMMFKRNPERRELGKFEGTPTYKADYPGWLA-------------SPREVHGKPAEWIPPSETFNGIPTYSSDYVKYKSTKPRESFRPHQETQIPNVPFQDMTENRESYIQHPVEQRKIKDQSEWFRPVVPFTGESTFSSDFKEKPLGLNRSYKPPAIAKLSSEPLQNETTHNSDYKPWGVEKPYLHQSERYNPPEGSMMTDTTYLRDFLPRRTERVLAFRPKDNRESIGQFSSKTSYSDDFQKWNIAARQRFGPNREYIPSDIPFENRTTHGTHFVPMPLSIRQSFKQSNQTHLSNEPFNGESIYRTEYAPKEVDVCP-TFFMGSPRAT----YEFTGEVDNKGHL 1464
            RH CPH+  +      C LSEY  +Y PH+I P  S KP         PL  +T HR+DY+P   E     +   Y   EG  +  T Y  EF PK        K+ P R    KFEG  T ++ Y  +L               P     KP ++   ++ F+GIP+Y  DY+ +    P+ SF+P         P    T+ R+SY+ HP+E R  K +  + +  VPF   +T   ++  K +   +SYKP      + +PL +ETTH  D+K   V+KP+ ++ E+Y  PEG +   TTY +D++     + ++ + K +R+    F   T+Y DDF+ W++   +    +    P+D PFE+ TT  + FVP  L    SFK +    LS EPF+  ++YRTEY  K    CP +F   +PR+     Y +  E D +GHL
Sbjct:  215 RHRCPHKMCKPGPWDKCNLSEYNTQYVPHEICPPKSLKPGFKPMLGEGPLSSETTHRVDYIPRCAEIPEKRKPPDYIKPEGIMDDTTMYRKEFGPKAICYTASTKQPPARLVPAKFEGESTNRSCYLLFLILNNCSIGDYIPWDIPPATRRKPDDYFKNTDKFDGIPSYRRDYIPHCQAPPK-SFKPVVSFMQSTDPLAQDTDYRQSYVNHPLEPRIKKKEPCFLQNRVPFDALTTHRKEYTPKEICPQKSYKPAPHFIQADKPLSDETTHRVDFKIHDVDKPFKYEPEKYRKPEGDIDLKTTYNKDYINLPACKTVSVKEKPSRKVSAPFQDGTNYRDDFKNWDVPPVRPIRRDIYEPPTD-PFEDCTTFKSAFVPHELCKVDSFKPAPHM-LSQEPFDDATMYRTEYTNKCRPYCPASFLTTNPRSVSPDGYIYNNE-DARGHL 656          
BLAST of Stabilizer of axonemal microtubules 1 vs. Planmine SMEST
Match: SMESG000067510.1 (SMESG000067510.1)

HSP 1 Score: 195.667 bits (496), Expect = 4.014e-56
Identity = 140/434 (32.26%), Postives = 209/434 (48.16%), Query Frame = 1
Query:  229 CVLSEYTNKYTPHQINPVHSFKPLANYTRNPEPLEDKTNHRIDYVPHALEKKYVHQREPYKPSEGEFEKNTTYTSEFNPKHGEKAMMFKRNPERRELGKFEGTPTYKA--------------DYPGWLASPREVHGKPAEWIPPSETFNGIPTYSSDYVKYKSTKPRESFRPHQETQIPNVPFQDMTENRESYIQHPVEQRKIKDQSEWFRPVVPFTGESTFSSDFKEKPLGLNRSYKPPAIAKLSSEPLQNETTHNSDYKPWGVEKPYLHQSERYNPPEGSMMTDTTYLRDFLPRRTERVLAFRPKDNRESIGQFSSKTSYSDDFQKWNIAARQRFGPNREYIPSDIPFENRTTHGTHFVPMPLSIRQSFKQSNQTHLSNEPFNGESIYRTEYAPKEVDVCP-TFFMGSPRAT----YEFTGEVDNKGHLLVS 1473
            C LSEY  +Y PH+I P  S KP         PL  +T HR+DY+P   E     +   Y   EG  E  T Y  EF PK        K+ P R    KFEG  T ++              DY  W   P     KP ++   ++ F+GIP+Y  DY+ +    P+ SF+P         P    T+ R+SY+ HP+E R  K +  + +  VPF   +T   ++  K +   +SYKP      + +PL +ETTH  D+K   V+KP+ ++ E+Y  PEG +   TTY +D++     + ++ + K +R+    F   T+Y DDF+ W++   +    +    P+D PFE+ TT  + FVP  L    SFK +    LS EPF+  ++YRTEY  K    CP +F   +PR+     Y +  E D +G   +S
Sbjct:   10 CNLSEYNTQYVPHEICPPKSLKPGFKPMLGEGPLSSETTHRVDYIPRCAEIPEKRKPPDYIKPEGIMEDTTMYRKEFGPKAICYTASTKQPPARLVPAKFEGESTNRSCYLLFVILNNCSIGDYIPWDIPP-ATRRKPDDYFKNTDKFDGIPSYRRDYIPHCQAPPK-SFKPVVSFMQSTDPLAQDTDYRQSYVNHPLEPRIKKKEPCFLQNRVPFDALTTHRKEYTPKEICPQKSYKPAPHFIQADKPLSDETTHRVDFKIHDVDKPFKYEPEKYRKPEGDIDLKTTYNKDYINLPACKTVSVKEKPSRKVSAPFQDGTNYRDDFKNWDVPPVRPIRRDIYEPPTD-PFEDCTTFKSAFVPHELCKVDSFKTAPHM-LSQEPFDDATMYRTEYTNKCRPYCPASFLTTNPRSVSPDGYIYNNE-DARGSFTLS 438          
BLAST of Stabilizer of axonemal microtubules 1 vs. Planmine SMEST
Match: SMESG000072576.1 (SMESG000072576.1)

HSP 1 Score: 184.882 bits (468), Expect = 4.329e-52
Identity = 137/447 (30.65%), Postives = 209/447 (46.76%), Query Frame = 1
Query:  154 CICKICCCGRHHCPHQPIRSNASGPCVLSEYTNKYTPHQINPVHSFKPLANYTRNPEPLEDKTNHRIDYVPHALEKKYVHQREPYKPSEGEFEKNTTYTSEFNPKHGEKAMMFKRNPERRELGKFEGTPTYKADYPGWLASPREVHGKPAEWIPPSETFNGIPTYSSDYVKYKSTKPRESFRPHQETQIPNVPFQDMTENRESYIQHPVEQRKIKDQSEWFRPVVPFTGESTFSSDFKEKPLGLNRSYKPPAIAKLSSEPLQNETTHNSDYKPWGVEKPYLHQSERYNPPEGSMMTDTTYLRDFLPRRTERVLAFRPKDNRESIGQFSSKTSYSDDFQKWN-----IAARQRFGPNREYIPSDIPFENRTTHGTHFVPMPLSIRQSFKQSNQTHLSNEPFNGESIYRTEYAPKEVDVCPTFFMGS-PRAT----YEFTGEVDNKGHL 1464
            CICKIC CG+H CPH+       GP + SEY  +Y         S KP  N   +  PL   T +R D+V H +      + + Y+P        + Y  EF  K      M +     ++ GKFE   T +  Y      P E+  +  ++ PP+E F+   TY SD++ Y   K   S +P   +   + PF  ++E R SY+QH VE R+I ++  + +   PF   +T   DF       ++  KPP       +P  ++TT+ +DY     + P   + E+Y  PEG M   TTY  +F+ +   + +  RP     +   FSS+TSY  ++Q WN     +  R++      Y P   PF+ +TT GT +V   +   QS K    T +   PF+G++ +RT+Y  K   VCP   + + PR+     Y + GE DN GHL
Sbjct:    8 CICKICNCGKHKCPHKSHPVAGWGPEICSEYGGQYHARPSERPESCKPPYNPILSDCPLSTVTTNRADFVAHDVHPVLKREHQKYEPPCTPMNDQSVYRHEFTEKPHCANRMIRPPATTQDNGKFESATTNRTTYVAHDVCPPELRSR-EQYKPPTEPFDATNTYRSDFIPYDQAK-MSSCKPPVTSLKSDAPFNSVSEQRHSYVQHNVEPRQIAEKIPYVKSDEPFESMTTNRQDFVPMENCKSQLMKPPGHRVECDKPFASDTTNRTDYVAHPSQIPEKFEHEKYVKPEGQMDMRTTYNDNFINQPNCKSMPIRPPITPGNSEPFSSETSYRQNYQNWNQPPNIVQHREK------YTPLTAPFDGQTTSGTSYVAHSIDKPQSCKPP-VTAMEKLPFDGQTTHRTDYVAKCPHVCPAASLSTNPRSISPDGYCYNGE-DNDGHL 444          
The following BLAST results are available for this feature:
BLAST of Stabilizer of axonemal microtubules 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SAXO13.512e-5030.15stabilizer of axonemal microtubules 1 [Source:HGNC... [more]
SAXO24.928e-3627.61stabilizer of axonemal microtubules 2 [Source:HGNC... [more]
SAXO15.382e-3027.00stabilizer of axonemal microtubules 1 [Source:HGNC... [more]
SAXO15.382e-3027.00stabilizer of axonemal microtubules 1 [Source:HGNC... [more]
SAXO11.525e-1149.25stabilizer of axonemal microtubules 1 [Source:HGNC... [more]
back to top
BLAST of Stabilizer of axonemal microtubules 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
T08G11.32.372e-1724.87pep chromosome:WBcel235:I:8921190:8925327:1 gene:W... [more]
back to top
BLAST of Stabilizer of axonemal microtubules 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Stabilizer of axonemal microtubules 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
saxo26.831e-5830.84stabilizer of axonemal microtubules 2 [Source:ZFIN... [more]
back to top
BLAST of Stabilizer of axonemal microtubules 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
vcam12.700e-6632.43vascular cell adhesion molecule 1 [Source:Xenbase;... [more]
vcam15.191e-5730.80vascular cell adhesion molecule 1 [Source:Xenbase;... [more]
back to top
BLAST of Stabilizer of axonemal microtubules 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Saxo17.024e-4729.48stabilizer of axonemal microtubules 1 [Source:MGI ... [more]
Saxo21.769e-4029.68stabilizer of axonemal microtubules 2 [Source:MGI ... [more]
back to top
BLAST of Stabilizer of axonemal microtubules 1 vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8IYX7|SAXO1_HUMAN1.686e-4930.15Stabilizer of axonemal microtubules 1 OS=Homo sapi... [more]
sp|Q4R7D3|SAXO1_MACFA2.176e-4930.00Stabilizer of axonemal microtubules 1 OS=Macaca fa... [more]
sp|Q6AYP6|SAXO1_RAT8.716e-4729.89Stabilizer of axonemal microtubules 1 OS=Rattus no... [more]
sp|Q8BQB6|SAXO2_MOUSE1.237e-3929.68Stabilizer of axonemal microtubules 2 OS=Mus muscu... [more]
sp|Q658L1|SAXO2_HUMAN2.367e-3527.61Stabilizer of axonemal microtubules 2 OS=Homo sapi... [more]
back to top
BLAST of Stabilizer of axonemal microtubules 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|157796924.805e-12139.57tr|A0A1I8HXT3|A0A1I8HXT3_9PLAT Uncharacterized pro... [more]
gnl|BL_ORD_ID|182608202.181e-12039.57tr|A0A267F5A9|A0A267F5A9_9PLAT Uncharacterized pro... [more]
gnl|BL_ORD_ID|157850742.661e-11439.64tr|A0A1I8J1J1|A0A1I8J1J1_9PLAT Uncharacterized pro... [more]
gnl|BL_ORD_ID|182956551.014e-11141.42tr|A0A267GHI9|A0A267GHI9_9PLAT Uncharacterized pro... [more]
gnl|BL_ORD_ID|157775863.669e-11037.50tr|A0A1I8HA86|A0A1I8HA86_9PLAT Uncharacterized pro... [more]
back to top
BLAST of Stabilizer of axonemal microtubules 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
saxo22.995e-5731.03stabilizer of axonemal microtubules 2 [Source:NCBI... [more]
ENSAMXT00000002606.28.908e-1224.57pep primary_assembly:Astyanax_mexicanus-2.0:16:258... [more]
back to top
BLAST of Stabilizer of axonemal microtubules 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
saxo21.256e-4629.69stabilizer of axonemal microtubules 2 [Source:ZFIN... [more]
back to top
BLAST of Stabilizer of axonemal microtubules 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Stabilizer of axonemal microtubules 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO431702.928e-2525.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO363857.105e-1424.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO488781.202e-921.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Stabilizer of axonemal microtubules 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Stabilizer of axonemal microtubules 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000042230.10.000e+0100.00SMESG000042230.1[more]
SMESG000009389.14.770e-12143.40SMESG000009389.1[more]
SMESG000067500.11.002e-5732.29SMESG000067500.1[more]
SMESG000067510.14.014e-5632.26SMESG000067510.1[more]
SMESG000072576.14.329e-5230.65SMESG000072576.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028223 ID=SMED30028223|Name=Stabilizer of axonemal microtubules 1|organism=Schmidtea mediterranea sexual|type=transcript|length=1684bp
TTCTATAACAACAATATTTGAGAAATATTTAAATATTTATTAGTTAAACT
TCAATTTGAATTTTTCTCTAAAACAAGTTAACATCTGAGGTTCTACTTAT
AGTAACAGTATAATAGTAATATTATTTTTCGAATGAGTAATAAATCTGAC
TTATGCATCTGCAAAATCTGCTGTTGTGGACGACATCACTGCCCTCATCA
GCCGATACGATCTAATGCATCAGGACCATGCGTTTTATCTGAATACACGA
ACAAATACACCCCTCATCAGATTAATCCGGTCCATTCATTTAAGCCTTTG
GCAAATTATACAAGAAATCCGGAACCTTTGGAGGATAAAACAAATCACCG
GATTGATTATGTACCGCATGCTTTGGAGAAAAAATATGTGCATCAAAGAG
AGCCATATAAACCATCTGAAGGGGAGTTTGAGAAAAATACTACTTATACG
TCAGAGTTTAATCCCAAACATGGTGAAAAGGCAATGATGTTTAAACGAAA
TCCTGAACGTAGAGAGCTAGGAAAATTTGAAGGAACTCCTACTTATAAAG
CTGATTATCCAGGTTGGCTAGCATCTCCTAGAGAAGTTCACGGAAAACCA
GCCGAATGGATTCCACCATCGGAAACATTTAATGGAATACCAACATATTC
GTCAGATTACGTTAAATATAAAAGTACCAAACCAAGAGAAAGTTTCCGGC
CACATCAAGAAACTCAAATACCAAATGTTCCATTTCAGGATATGACTGAA
AATCGAGAAAGCTACATACAACATCCAGTTGAGCAAAGAAAAATCAAAGA
CCAATCTGAATGGTTTCGGCCTGTTGTACCTTTCACTGGAGAATCAACTT
TTTCATCTGATTTCAAAGAAAAACCACTGGGTCTAAATAGAAGTTACAAA
CCTCCGGCGATTGCAAAATTGTCATCAGAGCCCTTACAAAATGAGACCAC
CCATAATTCTGATTATAAGCCGTGGGGGGTGGAAAAACCATATTTGCATC
AGTCTGAAAGATATAATCCGCCTGAAGGATCAATGATGACAGATACAACA
TATCTGAGAGATTTTCTTCCAAGAAGAACAGAGAGAGTTTTAGCTTTCAG
ACCAAAAGATAATAGAGAATCAATCGGTCAATTCAGCAGTAAGACGAGTT
ATTCTGATGATTTCCAGAAGTGGAATATTGCTGCAAGACAAAGATTCGGA
CCGAACCGAGAATACATTCCATCGGATATACCATTTGAAAACAGAACTAC
TCATGGAACACATTTCGTTCCAATGCCATTGTCTATTCGACAATCTTTCA
AACAGTCGAACCAAACACATTTATCGAATGAGCCATTTAATGGCGAATCT
ATATACCGAACAGAATACGCACCAAAGGAAGTTGATGTTTGCCCAACATT
CTTTATGGGTTCACCAAGGGCTACTTATGAATTTACTGGAGAAGTGGATA
ATAAAGGCCATTTATTGGTATCCCCAAGGAAAATGGATGAGATGGAGAAA
CAAACAGAAGTTGCAGTATATTAGTGACATGATTTGATAAACTGCGATTT
GACGTTTTTTATTTTATTTTCAACACTTTGCACACTTTTTATTTACAGAA
TTTGGATAGAAATTTAGAACATTATTTTCAATGAAAATTTATTGTTTCGT
TATAAAAAAATATAATTTTTTTTTGATTAAACAA
back to top

protein sequence of SMED30028223-orf-1

>SMED30028223-orf-1 ID=SMED30028223-orf-1|Name=SMED30028223-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=464bp
MSNKSDLCICKICCCGRHHCPHQPIRSNASGPCVLSEYTNKYTPHQINPV
HSFKPLANYTRNPEPLEDKTNHRIDYVPHALEKKYVHQREPYKPSEGEFE
KNTTYTSEFNPKHGEKAMMFKRNPERRELGKFEGTPTYKADYPGWLASPR
EVHGKPAEWIPPSETFNGIPTYSSDYVKYKSTKPRESFRPHQETQIPNVP
FQDMTENRESYIQHPVEQRKIKDQSEWFRPVVPFTGESTFSSDFKEKPLG
LNRSYKPPAIAKLSSEPLQNETTHNSDYKPWGVEKPYLHQSERYNPPEGS
MMTDTTYLRDFLPRRTERVLAFRPKDNRESIGQFSSKTSYSDDFQKWNIA
ARQRFGPNREYIPSDIPFENRTTHGTHFVPMPLSIRQSFKQSNQTHLSNE
PFNGESIYRTEYAPKEVDVCPTFFMGSPRATYEFTGEVDNKGHLLVSPRK
MDEMEKQTEVAVY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005814centriole
GO:0005879axonemal microtubule
GO:0031514motile cilium
GO:0036064ciliary basal body
GO:0036126sperm flagellum
Vocabulary: biological process
TermDefinition
GO:0009631cold acclimation
GO:0045724positive regulation of cilium assembly
GO:0050821protein stabilization
GO:0070417cellular response to cold
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000096ventral epidermis
PLANA:0000099neuron
PLANA:0000106ciliated epithelial cell
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR033336SAXO1/2
Vocabulary: molecular function
TermDefinition
GO:0008017microtubule binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR033336Stabilizer of axonemal microtubules 1/2PANTHERPTHR31516FAMILY NOT NAMEDcoord: 3..427
NoneNo IPR availablePANTHERPTHR31516:SF13STABILIZER OF AXONEMAL MICROTUBULES 2coord: 3..427