Succinyl-CoA:3-ketoacid-coenzyme A transferase

Overview
NameSuccinyl-CoA:3-ketoacid-coenzyme A transferase
Smed IDSMED30028204
Length (bp)2595
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Succinyl-CoA:3-ketoacid-coenzyme A transferase (SMED30028204) t-SNE clustered cells

Violin plots show distribution of expression levels for Succinyl-CoA:3-ketoacid-coenzyme A transferase (SMED30028204) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Succinyl-CoA:3-ketoacid-coenzyme A transferase (SMED30028204) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Succinyl-CoA:3-ketoacid-coenzyme A transferase (SMED30028204) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028204

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30028204SMESG000080432.1 Contig45598newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30028204SMESG000080432.1 Contig45598uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Category 3 cellSMED30028204SMESG000080432.1 SMESG000080424.1 dd_Smed_v6_1189_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Human
Match: OXCT1 (3-oxoacid CoA-transferase 1 [Source:HGNC Symbol;Acc:HGNC:8527])

HSP 1 Score: 142.124 bits (357), Expect = 2.013e-38
Identity = 68/136 (50.00%), Postives = 98/136 (72.06%), Query Frame = 3
Query: 2121 FKESARNFNETMCKAANITIVEVEQLVEIGEIDPDHVHVPGIYVDRILVGEKFEKRIEKKVYTERTGKQETDPIKIKRAKERERIMRRVALELKNGMYVNVGIGMPMQLANYIPNDMIVTLQSENGILGIGQYPKE 2528
            F++SARNFN  MCKAA  T+VEVE++V+IG   P+ +H+P IYV R++ GEK+EKRIE ++   + G  E    K      RERI++R ALE ++GMY N+GIG+P+  +N+I  ++ V LQSENG+LG+G YP++
Sbjct:  223 FRKSARNFNLPMCKAAETTVVEVEEIVDIGAFAPEDIHIPQIYVHRLIKGEKYEKRIE-RLSIRKEGDGEAKSAK-PGDDVRERIIKRAALEFEDGMYANLGIGIPLLASNFISPNITVHLQSENGVLGLGPYPRQ 356          

HSP 2 Score: 39.2762 bits (90), Expect = 2.013e-38
Identity = 18/24 (75.00%), Postives = 20/24 (83.33%), Query Frame = 2
Query: 2522 KRSEIDADLINAGKETVTIRPGGS 2593
            ++ E DADLINAGKETVTI PG S
Sbjct:  355 RQHEADADLINAGKETVTILPGAS 378          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Human
Match: OXCT1 (3-oxoacid CoA-transferase 1 [Source:HGNC Symbol;Acc:HGNC:8527])

HSP 1 Score: 141.739 bits (356), Expect = 2.182e-38
Identity = 68/136 (50.00%), Postives = 98/136 (72.06%), Query Frame = 3
Query: 2121 FKESARNFNETMCKAANITIVEVEQLVEIGEIDPDHVHVPGIYVDRILVGEKFEKRIEKKVYTERTGKQETDPIKIKRAKERERIMRRVALELKNGMYVNVGIGMPMQLANYIPNDMIVTLQSENGILGIGQYPKE 2528
            F++SARNFN  MCKAA  T+VEVE++V+IG   P+ +H+P IYV R++ GEK+EKRIE ++   + G  E    K      RERI++R ALE ++GMY N+GIG+P+  +N+I  ++ V LQSENG+LG+G YP++
Sbjct:   37 FRKSARNFNLPMCKAAETTVVEVEEIVDIGAFAPEDIHIPQIYVHRLIKGEKYEKRIE-RLSIRKEGDGEAKSAK-PGDDVRERIIKRAALEFEDGMYANLGIGIPLLASNFISPNITVHLQSENGVLGLGPYPRQ 170          

HSP 2 Score: 39.2762 bits (90), Expect = 2.182e-38
Identity = 18/24 (75.00%), Postives = 20/24 (83.33%), Query Frame = 2
Query: 2522 KRSEIDADLINAGKETVTIRPGGS 2593
            ++ E DADLINAGKETVTI PG S
Sbjct:  169 RQHEADADLINAGKETVTILPGAS 192          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Human
Match: OXCT2 (3-oxoacid CoA-transferase 2 [Source:HGNC Symbol;Acc:HGNC:18606])

HSP 1 Score: 130.954 bits (328), Expect = 8.815e-35
Identity = 71/136 (52.21%), Postives = 95/136 (69.85%), Query Frame = 3
Query: 2121 FKESARNFNETMCKAANITIVEVEQLVEIGEIDPDHVHVPGIYVDRILVGEKFEKRIEKKVYTERTGKQETDPIKIKRAKERERIMRRVALELKNGMYVNVGIGMPMQLANYIPNDMIVTLQSENGILGIGQYPKE 2528
            F+ SARNFN  MCKAA++T VEVE++VE+G   P+ +HVP IYVDR++ G+K+EKRIE+      T  +E D    K    R RI+RR ALE ++GMY N+GIG+P+  +N+I   M V L SENGILG+G +P E
Sbjct:  223 FRRSARNFNVPMCKAADVTAVEVEEIVEVGAFPPEDIHVPNIYVDRVIKGQKYEKRIER-----LTILKEEDGDAGKEEDARTRIIRRAALEFEDGMYANLGIGIPLLASNFISPSMTVHLHSENGILGLGPFPTE 353          

HSP 2 Score: 38.1206 bits (87), Expect = 8.815e-35
Identity = 16/21 (76.19%), Postives = 19/21 (90.48%), Query Frame = 2
Query: 2531 EIDADLINAGKETVTIRPGGS 2593
            E+DADLINAGK+TVT+ PGG 
Sbjct:  355 EVDADLINAGKQTVTVLPGGC 375          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Celegans
Match: C05C10.3 (Probable succinyl-CoA:3-ketoacid coenzyme A transferase, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:Q09450])

HSP 1 Score: 135.576 bits (340), Expect = 6.838e-34
Identity = 64/137 (46.72%), Postives = 88/137 (64.23%), Query Frame = 3
Query: 2121 FKESARNFNETMCKAANITIVEVEQLVEIGEIDPDHVHVPGIYVDRILVGEKFEKRIEKKVYTERTGKQETDPIKIKRAKERERIMRRVALELKNGMYVNVGIGMPMQLANYIPNDMIVTLQSENGILGIGQYPKEA 2531
            F+ +A NFN  MCKA+  TIVEVE++VE G I P+ VH+P IY  R+++G+ ++K IE+ ++     +    P      K RE I  R ALE  +GMY N+GIG+P    NYIPN   V LQSENGI+G+G YP++ 
Sbjct:  222 FRHAAGNFNNPMCKASKCTIVEVEEIVEPGVIAPNDVHIPSIYCHRLVLGKNYKKPIERPMFAH---EGPIKPSTSAAGKSREIIAARAALEFTDGMYANLGIGIPTLAPNYIPNGFTVHLQSENGIIGVGPYPRKG 355          

HSP 2 Score: 28.8758 bits (63), Expect = 6.838e-34
Identity = 13/19 (68.42%), Postives = 15/19 (78.95%), Query Frame = 2
Query: 2537 DADLINAGKETVTIRPGGS 2593
            DADLINAGKE +T+  G S
Sbjct:  358 DADLINAGKEPITLLKGAS 376          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Fly
Match: SCOT (gene:FBgn0035298 transcript:FBtr0333431)

HSP 1 Score: 146.747 bits (369), Expect = 9.686e-39
Identity = 71/139 (51.08%), Postives = 93/139 (66.91%), Query Frame = 3
Query: 2118 CFKESARNFNETMCKAANITIVEVEQLVEIGEIDPDHVHVPGIYVDRILVGEKFEKRIEKKVYTERTGKQETDPIKIKRAKERERIMRRVALELKNGMYVNVGIGMPMQLANYIPNDMIVTLQSENGILGIGQYPKEAK 2534
             F ++ARNFN  MC+AA IT+ EVE++V IG + PD +HVPGIY++RI  G  + KR+E+   TE     +  P        RERI RRVALE  +GMY N+GIG+P+  +NYIP  M V LQSENGILG+G +P + K
Sbjct:  150 VFNKAARNFNAPMCRAAKITVAEVEEIVPIGALSPDEIHVPGIYINRIFKGTNYNKRVERLRITEPKDPSKPAPPPNPAQVLRERIARRVALEFHDGMYANLGIGIPVLSSNYIPKGMNVMLQSENGILGLGPFPTKDK 288          

HSP 2 Score: 34.2686 bits (77), Expect = 9.686e-39
Identity = 14/23 (60.87%), Postives = 19/23 (82.61%), Query Frame = 2
Query: 2525 RSEIDADLINAGKETVTIRPGGS 2593
            + ++D DLINAGKE+VT+ PG S
Sbjct:  286 KDKVDPDLINAGKESVTVVPGAS 308          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Fly
Match: SCOT (gene:FBgn0035298 transcript:FBtr0072844)

HSP 1 Score: 146.747 bits (369), Expect = 1.033e-38
Identity = 71/138 (51.45%), Postives = 93/138 (67.39%), Query Frame = 3
Query: 2121 FKESARNFNETMCKAANITIVEVEQLVEIGEIDPDHVHVPGIYVDRILVGEKFEKRIEKKVYTERTGKQETDPIKIKRAKERERIMRRVALELKNGMYVNVGIGMPMQLANYIPNDMIVTLQSENGILGIGQYPKEAK 2534
            F ++ARNFN  MC+AA IT+ EVE++V IG + PD +HVPGIY++RI  G  + KR+E+   TE     +  P        RERI RRVALE  +GMY N+GIG+P+  +NYIP  M V LQSENGILG+G +P + K
Sbjct:  217 FNKAARNFNAPMCRAAKITVAEVEEIVPIGALSPDEIHVPGIYINRIFKGTNYNKRVERLRITEPKDPSKPAPPPNPAQVLRERIARRVALEFHDGMYANLGIGIPVLSSNYIPKGMNVMLQSENGILGLGPFPTKDK 354          

HSP 2 Score: 34.2686 bits (77), Expect = 1.033e-38
Identity = 14/23 (60.87%), Postives = 19/23 (82.61%), Query Frame = 2
Query: 2525 RSEIDADLINAGKETVTIRPGGS 2593
            + ++D DLINAGKE+VT+ PG S
Sbjct:  352 KDKVDPDLINAGKESVTVVPGAS 374          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Fly
Match: SCOT (gene:FBgn0035298 transcript:FBtr0072843)

HSP 1 Score: 146.747 bits (369), Expect = 1.095e-38
Identity = 71/138 (51.45%), Postives = 93/138 (67.39%), Query Frame = 3
Query: 2121 FKESARNFNETMCKAANITIVEVEQLVEIGEIDPDHVHVPGIYVDRILVGEKFEKRIEKKVYTERTGKQETDPIKIKRAKERERIMRRVALELKNGMYVNVGIGMPMQLANYIPNDMIVTLQSENGILGIGQYPKEAK 2534
            F ++ARNFN  MC+AA IT+ EVE++V IG + PD +HVPGIY++RI  G  + KR+E+   TE     +  P        RERI RRVALE  +GMY N+GIG+P+  +NYIP  M V LQSENGILG+G +P + K
Sbjct:  203 FNKAARNFNAPMCRAAKITVAEVEEIVPIGALSPDEIHVPGIYINRIFKGTNYNKRVERLRITEPKDPSKPAPPPNPAQVLRERIARRVALEFHDGMYANLGIGIPVLSSNYIPKGMNVMLQSENGILGLGPFPTKDK 340          

HSP 2 Score: 34.2686 bits (77), Expect = 1.095e-38
Identity = 14/23 (60.87%), Postives = 19/23 (82.61%), Query Frame = 2
Query: 2525 RSEIDADLINAGKETVTIRPGGS 2593
            + ++D DLINAGKE+VT+ PG S
Sbjct:  338 KDKVDPDLINAGKESVTVVPGAS 360          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Zebrafish
Match: oxct1b (3-oxoacid CoA transferase 1b [Source:ZFIN;Acc:ZDB-GENE-060929-212])

HSP 1 Score: 161.384 bits (407), Expect = 6.015e-44
Identity = 74/138 (53.62%), Postives = 106/138 (76.81%), Query Frame = 3
Query: 2121 FKESARNFNETMCKAANITIVEVEQLVEIGEIDPDHVHVPGIYVDRILVGEKFEKRIEKKVYTERTGKQETDPIKIKRAKERERIMRRVALELKNGMYVNVGIGMPMQLANYIPNDMIVTLQSENGILGIGQYPKEAK 2534
            F+++ RNFN+ MCKAA +TIVEVE++V+IG  + + +H+PGIYVDR++ G  +EKRIEK++   ++GK+E   +K +    RERI+RR ALE ++GMY N+GIG+PM  +NYI  D+ V LQSENGILG+G YP E++
Sbjct:  231 FRKTTRNFNQPMCKAAKVTIVEVEEIVDIGSFNAEDIHIPGIYVDRVVKGASYEKRIEKRLV--QSGKEEKPKVKQESDITRERIIRRAALEFQDGMYANLGIGIPMLASNYISPDITVHLQSENGILGLGPYPTESE 366          

HSP 2 Score: 37.3502 bits (85), Expect = 6.015e-44
Identity = 16/22 (72.73%), Postives = 19/22 (86.36%), Query Frame = 2
Query: 2528 SEIDADLINAGKETVTIRPGGS 2593
            SE+D DLINAGKETVT+ PG +
Sbjct:  365 SEVDPDLINAGKETVTVYPGAA 386          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Zebrafish
Match: oxct1a (3-oxoacid CoA transferase 1a [Source:ZFIN;Acc:ZDB-GENE-040723-3])

HSP 1 Score: 144.821 bits (364), Expect = 1.971e-38
Identity = 70/136 (51.47%), Postives = 97/136 (71.32%), Query Frame = 3
Query: 2121 FKESARNFNETMCKAANITIVEVEQLVEIGEIDPDHVHVPGIYVDRILVGEKFEKRIEKKVYTERTGKQETDPIKIKRAKERERIMRRVALELKNGMYVNVGIGMPMQLANYIPNDMIVTLQSENGILGIGQYPKE 2528
            F+++ARNFN+ MCKAA  TIVEVE++V++G    + +H+P IYV RI+ G+ +EKRIE++  T +  + E    K      RERI+RR ALE ++GMY N+GIG+PM  +N+I  D+ V LQSENGILG+G YP E
Sbjct:  230 FRKTARNFNQPMCKAAKTTIVEVEEIVDVGTFASEDIHIPSIYVHRIVNGDHYEKRIERR--TVKKAQAENPKPKKDSDIVRERIIRRAALEFEDGMYANLGIGIPMLASNFIKPDITVHLQSENGILGLGPYPTE 363          

HSP 2 Score: 35.8094 bits (81), Expect = 1.971e-38
Identity = 16/20 (80.00%), Postives = 18/20 (90.00%), Query Frame = 2
Query: 2534 IDADLINAGKETVTIRPGGS 2593
            +DADLINAGKETVTI PG +
Sbjct:  366 VDADLINAGKETVTILPGAA 385          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Zebrafish
Match: oxct1a (3-oxoacid CoA transferase 1a [Source:ZFIN;Acc:ZDB-GENE-040723-3])

HSP 1 Score: 131.724 bits (330), Expect = 1.270e-34
Identity = 72/172 (41.86%), Postives = 104/172 (60.47%), Query Frame = 3
Query: 2121 FKESARNFNETMCKAANITIVEVEQLVEIGEIDPDHVHVPGIYVDRILVGEKFEKRIE----------KKVYTERTGKQE-----------TDPIK---IKRAKE------------RERIMRRVALELKNGMYVNVGIGMPMQLANYIPNDMIVTLQSENGILGIGQYPKE 2528
            F+++ARNFN+ MCKAA  TIVEVE++V++G    + +H+P IYV RI+ G+ +EKRIE            V+ +++               TD ++   +K+A+             RERI+RR ALE ++GMY N+GIG+PM  +N+I  D+ V LQSENGILG+G YP E
Sbjct:  230 FRKTARNFNQPMCKAAKTTIVEVEEIVDVGTFASEDIHIPSIYVHRIVNGDHYEKRIEVSWHDLTGLFLSVFLDQSNLCHLLSLIAVVILLTDLLQRRTVKKAQAENPKPKKDSDIVRERIIRRAALEFEDGMYANLGIGIPMLASNFIKPDITVHLQSENGILGLGPYPTE 401          

HSP 2 Score: 36.1946 bits (82), Expect = 1.270e-34
Identity = 16/20 (80.00%), Postives = 18/20 (90.00%), Query Frame = 2
Query: 2534 IDADLINAGKETVTIRPGGS 2593
            +DADLINAGKETVTI PG +
Sbjct:  404 VDADLINAGKETVTILPGAA 423          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Xenopus
Match: mettl18 (methyltransferase like 18 [Source:Xenbase;Acc:XB-GENE-5811219])

HSP 1 Score: 127.872 bits (320), Expect = 2.599e-33
Identity = 71/136 (52.21%), Postives = 99/136 (72.79%), Query Frame = 3
Query: 2121 FKESARNFNETMCKAANITIVEVEQLVEIGEIDPDHVHVPGIYVDRILVGEKFEKRIEKKVYTERTGKQETDPIKIKRAKE--RERIMRRVALELKNGMYVNVGIGMPMQLANYIPNDMIVTLQSENGILGIGQYP 2522
            F+++ARNFN+ MCKAA +T+VEVE++VE G   P+ VH+P IYVDR++ G  ++K+IE+   T R  K E    K K+  +  RERI+RR ALE ++GMY N+GIG+PM  +N+I  D+ V LQSENG+LG+G YP
Sbjct:  233 FRKTARNFNQPMCKAAKVTVVEVEEIVETGTFAPEDVHIPSIYVDRVIKGNGYQKKIER--LTLR--KSENSKPKPKKDSDIVRERIIRRAALEFQDGMYANLGIGIPMLASNFIKKDITVHLQSENGVLGLGPYP 364          

HSP 2 Score: 36.1946 bits (82), Expect = 2.599e-33
Identity = 15/23 (65.22%), Postives = 19/23 (82.61%), Query Frame = 2
Query: 2525 RSEIDADLINAGKETVTIRPGGS 2593
            + E+D DLINAGKETVT+ PG +
Sbjct:  366 QEEVDPDLINAGKETVTVLPGAA 388          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Xenopus
Match: mettl18 (methyltransferase like 18 [Source:Xenbase;Acc:XB-GENE-5811219])

HSP 1 Score: 127.487 bits (319), Expect = 3.140e-33
Identity = 71/136 (52.21%), Postives = 99/136 (72.79%), Query Frame = 3
Query: 2121 FKESARNFNETMCKAANITIVEVEQLVEIGEIDPDHVHVPGIYVDRILVGEKFEKRIEKKVYTERTGKQETDPIKIKRAKE--RERIMRRVALELKNGMYVNVGIGMPMQLANYIPNDMIVTLQSENGILGIGQYP 2522
            F+++ARNFN+ MCKAA +T+VEVE++VE G   P+ VH+P IYVDR++ G  ++K+IE+   T R  K E    K K+  +  RERI+RR ALE ++GMY N+GIG+PM  +N+I  D+ V LQSENG+LG+G YP
Sbjct:  233 FRKTARNFNQPMCKAAKVTVVEVEEIVETGTFAPEDVHIPSIYVDRVIKGNGYQKKIER--LTLR--KSENSKPKPKKDSDIVRERIIRRAALEFQDGMYANLGIGIPMLASNFIKKDITVHLQSENGVLGLGPYP 364          

HSP 2 Score: 36.1946 bits (82), Expect = 3.140e-33
Identity = 15/23 (65.22%), Postives = 19/23 (82.61%), Query Frame = 2
Query: 2525 RSEIDADLINAGKETVTIRPGGS 2593
            + E+D DLINAGKETVT+ PG +
Sbjct:  366 QEEVDPDLINAGKETVTVLPGAA 388          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Xenopus
Match: mettl18 (methyltransferase like 18 [Source:Xenbase;Acc:XB-GENE-5811219])

HSP 1 Score: 127.487 bits (319), Expect = 3.411e-33
Identity = 71/136 (52.21%), Postives = 99/136 (72.79%), Query Frame = 3
Query: 2121 FKESARNFNETMCKAANITIVEVEQLVEIGEIDPDHVHVPGIYVDRILVGEKFEKRIEKKVYTERTGKQETDPIKIKRAKE--RERIMRRVALELKNGMYVNVGIGMPMQLANYIPNDMIVTLQSENGILGIGQYP 2522
            F+++ARNFN+ MCKAA +T+VEVE++VE G   P+ VH+P IYVDR++ G  ++K+IE+   T R  K E    K K+  +  RERI+RR ALE ++GMY N+GIG+PM  +N+I  D+ V LQSENG+LG+G YP
Sbjct:  218 FRKTARNFNQPMCKAAKVTVVEVEEIVETGTFAPEDVHIPSIYVDRVIKGNGYQKKIER--LTLR--KSENSKPKPKKDSDIVRERIIRRAALEFQDGMYANLGIGIPMLASNFIKKDITVHLQSENGVLGLGPYP 349          

HSP 2 Score: 36.1946 bits (82), Expect = 3.411e-33
Identity = 15/23 (65.22%), Postives = 19/23 (82.61%), Query Frame = 2
Query: 2525 RSEIDADLINAGKETVTIRPGGS 2593
            + E+D DLINAGKETVT+ PG +
Sbjct:  351 QEEVDPDLINAGKETVTVLPGAA 373          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Xenopus
Match: mettl18 (methyltransferase like 18 [Source:Xenbase;Acc:XB-GENE-5811219])

HSP 1 Score: 127.487 bits (319), Expect = 3.413e-33
Identity = 71/136 (52.21%), Postives = 99/136 (72.79%), Query Frame = 3
Query: 2121 FKESARNFNETMCKAANITIVEVEQLVEIGEIDPDHVHVPGIYVDRILVGEKFEKRIEKKVYTERTGKQETDPIKIKRAKE--RERIMRRVALELKNGMYVNVGIGMPMQLANYIPNDMIVTLQSENGILGIGQYP 2522
            F+++ARNFN+ MCKAA +T+VEVE++VE G   P+ VH+P IYVDR++ G  ++K+IE+   T R  K E    K K+  +  RERI+RR ALE ++GMY N+GIG+PM  +N+I  D+ V LQSENG+LG+G YP
Sbjct:  204 FRKTARNFNQPMCKAAKVTVVEVEEIVETGTFAPEDVHIPSIYVDRVIKGNGYQKKIER--LTLR--KSENSKPKPKKDSDIVRERIIRRAALEFQDGMYANLGIGIPMLASNFIKKDITVHLQSENGVLGLGPYP 335          

HSP 2 Score: 36.1946 bits (82), Expect = 3.413e-33
Identity = 15/23 (65.22%), Postives = 19/23 (82.61%), Query Frame = 2
Query: 2525 RSEIDADLINAGKETVTIRPGGS 2593
            + E+D DLINAGKETVT+ PG +
Sbjct:  337 QEEVDPDLINAGKETVTVLPGAA 359          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Xenopus
Match: mettl18 (methyltransferase like 18 [Source:Xenbase;Acc:XB-GENE-5811219])

HSP 1 Score: 127.102 bits (318), Expect = 3.497e-33
Identity = 71/136 (52.21%), Postives = 99/136 (72.79%), Query Frame = 3
Query: 2121 FKESARNFNETMCKAANITIVEVEQLVEIGEIDPDHVHVPGIYVDRILVGEKFEKRIEKKVYTERTGKQETDPIKIKRAKE--RERIMRRVALELKNGMYVNVGIGMPMQLANYIPNDMIVTLQSENGILGIGQYP 2522
            F+++ARNFN+ MCKAA +T+VEVE++VE G   P+ VH+P IYVDR++ G  ++K+IE+   T R  K E    K K+  +  RERI+RR ALE ++GMY N+GIG+PM  +N+I  D+ V LQSENG+LG+G YP
Sbjct:  215 FRKTARNFNQPMCKAAKVTVVEVEEIVETGTFAPEDVHIPSIYVDRVIKGNGYQKKIER--LTLR--KSENSKPKPKKDSDIVRERIIRRAALEFQDGMYANLGIGIPMLASNFIKKDITVHLQSENGVLGLGPYP 346          

HSP 2 Score: 36.1946 bits (82), Expect = 3.497e-33
Identity = 15/23 (65.22%), Postives = 19/23 (82.61%), Query Frame = 2
Query: 2525 RSEIDADLINAGKETVTIRPGGS 2593
            + E+D DLINAGKETVT+ PG +
Sbjct:  348 QEEVDPDLINAGKETVTVLPGAA 370          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Mouse
Match: Oxct1 (3-oxoacid CoA transferase 1 [Source:MGI Symbol;Acc:MGI:1914291])

HSP 1 Score: 142.124 bits (357), Expect = 2.920e-38
Identity = 67/134 (50.00%), Postives = 93/134 (69.40%), Query Frame = 3
Query: 2121 FKESARNFNETMCKAANITIVEVEQLVEIGEIDPDHVHVPGIYVDRILVGEKFEKRIEKKVYTERTGKQETDPIKIKRAKERERIMRRVALELKNGMYVNVGIGMPMQLANYIPNDMIVTLQSENGILGIGQYP 2522
            F++SARNFN  MCKAA  T+VEVE++V+IG   P+ +H+P IYV R++ GEK+EKRIE+   + R                RERI++R ALE ++GMY N+GIG+P+  +N+I  +M V LQSENG+LG+G YP
Sbjct:  223 FRKSARNFNLPMCKAAGTTVVEVEEIVDIGSFAPEDIHIPKIYVHRLIKGEKYEKRIER--LSLRKEGDGKGKSGKPGGDVRERIIKRAALEFEDGMYANLGIGIPLLASNFISPNMTVHLQSENGVLGLGPYP 354          

HSP 2 Score: 37.7354 bits (86), Expect = 2.920e-38
Identity = 17/23 (73.91%), Postives = 19/23 (82.61%), Query Frame = 2
Query: 2525 RSEIDADLINAGKETVTIRPGGS 2593
            + E DADLINAGKETVT+ PG S
Sbjct:  356 KDEADADLINAGKETVTVLPGAS 378          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Mouse
Match: Oxct1 (3-oxoacid CoA transferase 1 [Source:MGI Symbol;Acc:MGI:1914291])

HSP 1 Score: 142.124 bits (357), Expect = 3.021e-38
Identity = 67/134 (50.00%), Postives = 93/134 (69.40%), Query Frame = 3
Query: 2121 FKESARNFNETMCKAANITIVEVEQLVEIGEIDPDHVHVPGIYVDRILVGEKFEKRIEKKVYTERTGKQETDPIKIKRAKERERIMRRVALELKNGMYVNVGIGMPMQLANYIPNDMIVTLQSENGILGIGQYP 2522
            F++SARNFN  MCKAA  T+VEVE++V+IG   P+ +H+P IYV R++ GEK+EKRIE+   + R                RERI++R ALE ++GMY N+GIG+P+  +N+I  +M V LQSENG+LG+G YP
Sbjct:  223 FRKSARNFNLPMCKAAGTTVVEVEEIVDIGSFAPEDIHIPKIYVHRLIKGEKYEKRIER--LSLRKEGDGKGKSGKPGGDVRERIIKRAALEFEDGMYANLGIGIPLLASNFISPNMTVHLQSENGVLGLGPYP 354          

HSP 2 Score: 38.1206 bits (87), Expect = 3.021e-38
Identity = 17/23 (73.91%), Postives = 19/23 (82.61%), Query Frame = 2
Query: 2525 RSEIDADLINAGKETVTIRPGGS 2593
            + E DADLINAGKETVT+ PG S
Sbjct:  356 KDEADADLINAGKETVTVLPGAS 378          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Mouse
Match: Oxct2a (3-oxoacid CoA transferase 2A [Source:MGI Symbol;Acc:MGI:1891061])

HSP 1 Score: 129.413 bits (324), Expect = 2.167e-34
Identity = 69/137 (50.36%), Postives = 95/137 (69.34%), Query Frame = 3
Query: 2121 FKESARNFNETMCKAANITIVEVEQLVEIGEIDPDHVHVPGIYVDRILVGEKFEKRIEKKVYTER---TGKQETDPIKIKRAKERERIMRRVALELKNGMYVNVGIGMPMQLANYIPNDMIVTLQSENGILGIGQYP 2522
            F+ SARNFN  MCKAA+I++VEVE++V++G   P+ +HVP IYVDR++ G KFEKRIE+    +     G ++ DP        R RI++R ALE ++GMY N+GIG+P+  +NYI   M V L SENGILG+G +P
Sbjct:  223 FRGSARNFNVPMCKAADISVVEVEEIVDVGTFAPEDIHVPNIYVDRVIKGPKFEKRIERLTTRDSKPAPGSKDNDP-------SRTRIIKRAALEFQDGMYANLGIGIPVLASNYISPKMTVYLHSENGILGLGPFP 352          

HSP 2 Score: 37.7354 bits (86), Expect = 2.167e-34
Identity = 15/23 (65.22%), Postives = 21/23 (91.30%), Query Frame = 2
Query: 2525 RSEIDADLINAGKETVTIRPGGS 2593
            ++E+DAD+INAGK+TVT+ PGG 
Sbjct:  354 KNEVDADVINAGKQTVTVVPGGC 376          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Mouse
Match: Oxct2b (3-oxoacid CoA transferase 2B [Source:MGI Symbol;Acc:MGI:2664115])

HSP 1 Score: 128.642 bits (322), Expect = 3.221e-34
Identity = 68/137 (49.64%), Postives = 95/137 (69.34%), Query Frame = 3
Query: 2121 FKESARNFNETMCKAANITIVEVEQLVEIGEIDPDHVHVPGIYVDRILVGEKFEKRIEKKVYTER---TGKQETDPIKIKRAKERERIMRRVALELKNGMYVNVGIGMPMQLANYIPNDMIVTLQSENGILGIGQYP 2522
            F+ SARNFN  MCKAA+I++VEVE++V++G   P+ +H+P IYVDR++ G KFEKRIE+    +     G ++ DP        R RI++R ALE ++GMY N+GIG+P+  +NYI   M V L SENGILG+G +P
Sbjct:  223 FRGSARNFNVPMCKAADISVVEVEEIVDVGTFAPEDIHIPNIYVDRVIKGPKFEKRIERLTTRDSKPAPGSKDNDP-------SRTRIIKRAALEFQDGMYANLGIGIPVLASNYISPKMTVYLHSENGILGLGPFP 352          

HSP 2 Score: 37.7354 bits (86), Expect = 3.221e-34
Identity = 15/23 (65.22%), Postives = 21/23 (91.30%), Query Frame = 2
Query: 2525 RSEIDADLINAGKETVTIRPGGS 2593
            ++E+DAD+INAGK+TVT+ PGG 
Sbjct:  354 KNEVDADVINAGKQTVTVVPGGC 376          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. UniProt/SwissProt
Match: sp|Q54JD9|SCOT_DICDI (Probable succinyl-CoA:3-ketoacid coenzyme A transferase, mitochondrial OS=Dictyostelium discoideum OX=44689 GN=oxct1 PE=3 SV=1)

HSP 1 Score: 154.836 bits (390), Expect = 1.542e-40
Identity = 76/136 (55.88%), Postives = 99/136 (72.79%), Query Frame = 3
Query: 2121 FKESARNFNETMCKAANITIVEVEQLVEIGEIDPDHVHVPGIYVDRILVGEKFEKRIEK-KVYTERTGKQETDPIKIKRAKERERIMRRVALELKNGMYVNVGIGMPMQLANYIPNDMIVTLQSENGILGIGQYPK 2525
            F+ +ARNFN  M  AA ITI EVE++V+ GEI PD VHVPGIY+ RI+ G  FEKRIE+  V  E+TG+    P K + A +RERI+RR ALE ++GMY N+GIGMP   +N+IP  + + LQSENG+LG+G +PK
Sbjct:  212 FRNTARNFNPPMATAAKITIAEVEEIVDAGEIKPDEVHVPGIYIQRIVKGPSFEKRIERLTVQKEKTGEAAAKP-KDEAAAKRERIVRRAALEFEDGMYCNLGIGMPTLASNFIPKGIRIELQSENGLLGMGPFPK 346          

HSP 2 Score: 35.4242 bits (80), Expect = 1.542e-40
Identity = 18/24 (75.00%), Postives = 18/24 (75.00%), Query Frame = 2
Query: 2522 KRSEIDADLINAGKETVTIRPGGS 2593
            K  E DADLINAGKETVT  PG S
Sbjct:  346 KMGEHDADLINAGKETVTTIPGSS 369          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. UniProt/SwissProt
Match: sp|Q29551|SCOT1_PIG (Succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial OS=Sus scrofa OX=9823 GN=OXCT1 PE=1 SV=2)

HSP 1 Score: 143.28 bits (360), Expect = 2.007e-38
Identity = 78/173 (45.09%), Postives = 112/173 (64.74%), Query Frame = 3
Query: 2019 EESIRGNI*NLLTEPESVKFSLILKFLSFV*KN-CFKESARNFNETMCKAANITIVEVEQLVEIGEIDPDHVHVPGIYVDRILVGEKFEKRIEKKVYTERTGKQETDPIKIKRAK----ERERIMRRVALELKNGMYVNVGIGMPMQLANYIPNDMIVTLQSENGILGIGQYP 2522
            EE+IRG+            F+L+  + +    N  F++SARNFN  MCKAA  T+VEVE++V+IG   P+ +H+P IYV R++ GEK+EKRI      ER   ++ + +K +  K     RERI++R ALE ++GMY N+GIG+P+  +N+I  +M V LQSENGILG+G YP
Sbjct:  200 EEAIRGD------------FALVKAWKADQAGNVTFRKSARNFNLPMCKAAETTVVEVEEIVDIGSFAPEDIHIPKIYVHRLVKGEKYEKRI------ERLSVRKEEDVKTRSGKLGDNVRERIIKRAALEFEDGMYANLGIGIPLLASNFISPNMTVHLQSENGILGLGPYP 354          

HSP 2 Score: 39.6614 bits (91), Expect = 2.007e-38
Identity = 17/23 (73.91%), Postives = 21/23 (91.30%), Query Frame = 2
Query: 2525 RSEIDADLINAGKETVTIRPGGS 2593
            ++E+DADLINAGKETVT+ PG S
Sbjct:  356 QNEVDADLINAGKETVTVLPGAS 378          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. UniProt/SwissProt
Match: sp|Q9W058|SCOT_DROME (Succinyl-CoA:3-ketoacid-coenzyme A transferase, mitochondrial OS=Drosophila melanogaster OX=7227 GN=SCOT PE=1 SV=1)

HSP 1 Score: 146.747 bits (369), Expect = 7.914e-38
Identity = 71/138 (51.45%), Postives = 93/138 (67.39%), Query Frame = 3
Query: 2121 FKESARNFNETMCKAANITIVEVEQLVEIGEIDPDHVHVPGIYVDRILVGEKFEKRIEKKVYTERTGKQETDPIKIKRAKERERIMRRVALELKNGMYVNVGIGMPMQLANYIPNDMIVTLQSENGILGIGQYPKEAK 2534
            F ++ARNFN  MC+AA IT+ EVE++V IG + PD +HVPGIY++RI  G  + KR+E+   TE     +  P        RERI RRVALE  +GMY N+GIG+P+  +NYIP  M V LQSENGILG+G +P + K
Sbjct:  217 FNKAARNFNAPMCRAAKITVAEVEEIVPIGALSPDEIHVPGIYINRIFKGTNYNKRVERLRITEPKDPSKPAPPPNPAQVLRERIARRVALEFHDGMYANLGIGIPVLSSNYIPKGMNVMLQSENGILGLGPFPTKDK 354          

HSP 2 Score: 34.2686 bits (77), Expect = 7.914e-38
Identity = 14/23 (60.87%), Postives = 19/23 (82.61%), Query Frame = 2
Query: 2525 RSEIDADLINAGKETVTIRPGGS 2593
            + ++D DLINAGKE+VT+ PG S
Sbjct:  352 KDKVDPDLINAGKESVTVVPGAS 374          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. UniProt/SwissProt
Match: sp|P55809|SCOT1_HUMAN (Succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial OS=Homo sapiens OX=9606 GN=OXCT1 PE=1 SV=1)

HSP 1 Score: 142.124 bits (357), Expect = 8.883e-38
Identity = 68/136 (50.00%), Postives = 98/136 (72.06%), Query Frame = 3
Query: 2121 FKESARNFNETMCKAANITIVEVEQLVEIGEIDPDHVHVPGIYVDRILVGEKFEKRIEKKVYTERTGKQETDPIKIKRAKERERIMRRVALELKNGMYVNVGIGMPMQLANYIPNDMIVTLQSENGILGIGQYPKE 2528
            F++SARNFN  MCKAA  T+VEVE++V+IG   P+ +H+P IYV R++ GEK+EKRIE ++   + G  E    K      RERI++R ALE ++GMY N+GIG+P+  +N+I  ++ V LQSENG+LG+G YP++
Sbjct:  223 FRKSARNFNLPMCKAAETTVVEVEEIVDIGAFAPEDIHIPQIYVHRLIKGEKYEKRIE-RLSIRKEGDGEAKSAK-PGDDVRERIIKRAALEFEDGMYANLGIGIPLLASNFISPNITVHLQSENGVLGLGPYPRQ 356          

HSP 2 Score: 39.2762 bits (90), Expect = 8.883e-38
Identity = 18/24 (75.00%), Postives = 20/24 (83.33%), Query Frame = 2
Query: 2522 KRSEIDADLINAGKETVTIRPGGS 2593
            ++ E DADLINAGKETVTI PG S
Sbjct:  355 RQHEADADLINAGKETVTILPGAS 378          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. UniProt/SwissProt
Match: sp|B2GV06|SCOT1_RAT (Succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial OS=Rattus norvegicus OX=10116 GN=Oxct1 PE=1 SV=1)

HSP 1 Score: 142.895 bits (359), Expect = 1.092e-37
Identity = 70/136 (51.47%), Postives = 100/136 (73.53%), Query Frame = 3
Query: 2121 FKESARNFNETMCKAANITIVEVEQLVEIGEIDPDHVHVPGIYVDRILVGEKFEKRIEK-KVYTERTGKQETDPIKIKRAKE-RERIMRRVALELKNGMYVNVGIGMPMQLANYIPNDMIVTLQSENGILGIGQYP 2522
            F++SARNFN  MCKAA  T+VEVE++V+IG   P+ +H+P IYV R++ GEK+EKRIE+  +  E  GK ++     K  ++ RERI++R ALE ++GMY N+GIG+P+  +N+I  +M V LQSENG+LG+G YP
Sbjct:  223 FRKSARNFNLPMCKAAGTTVVEVEEIVDIGSFAPEDIHIPKIYVHRLIKGEKYEKRIERLSLRKEGEGKAKSG----KPGEDVRERIIKRAALEFEDGMYANLGIGIPLLASNFISPNMTVHLQSENGVLGLGPYP 354          

HSP 2 Score: 37.7354 bits (86), Expect = 1.092e-37
Identity = 17/23 (73.91%), Postives = 19/23 (82.61%), Query Frame = 2
Query: 2525 RSEIDADLINAGKETVTIRPGGS 2593
            + E DADLINAGKETVT+ PG S
Sbjct:  356 KDEADADLINAGKETVTVLPGAS 378          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. TrEMBL
Match: A0A0M9A457 (Succinyl-CoA:3-ketoacid-coenzyme A transferase OS=Melipona quadrifasciata OX=166423 GN=WN51_12762 PE=3 SV=1)

HSP 1 Score: 174.866 bits (442), Expect = 4.362e-45
Identity = 85/139 (61.15%), Postives = 109/139 (78.42%), Query Frame = 3
Query: 2121 FKESARNFNETMCKAANITIVEVEQLVEIGEIDPDHVHVPGIYVDRILVGEKFEKRIEKKVYTERTGKQETDPIKIKRA-KERERIMRRVALELKNGMYVNVGIGMPMQLANYIPNDMIVTLQSENGILGIGQYPKEAK 2534
            F++SARNFN  MCKAA ITI EVE++VEIG++DPDHVH+PGI+VDRI+ G  +EKR+EK+ YT    KQ   P K+  A K R+RI+RR ALE K+GMY N+GIG+PM   NYIP ++ VTLQSENGILG+G +P E++
Sbjct:  205 FRKSARNFNPVMCKAAKITIAEVEEIVEIGQLDPDHVHLPGIFVDRIVKGPSYEKRVEKQ-YT----KQNVKPKKVTPASKARDRIIRRAALEFKDGMYANLGIGIPMLACNYIPKNVKVTLQSENGILGLGPFPDESE 338          

HSP 2 Score: 38.5058 bits (88), Expect = 4.362e-45
Identity = 17/22 (77.27%), Postives = 19/22 (86.36%), Query Frame = 2
Query: 2528 SEIDADLINAGKETVTIRPGGS 2593
            SE+D DLINAGKETVT+ PG S
Sbjct:  337 SEVDPDLINAGKETVTVFPGAS 358          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. TrEMBL
Match: A0A232ERW3 (Succinyl-CoA:3-ketoacid-coenzyme A transferase OS=Trichomalopsis sarcophagae OX=543379 GN=TSAR_015319 PE=3 SV=1)

HSP 1 Score: 172.555 bits (436), Expect = 2.172e-44
Identity = 84/139 (60.43%), Postives = 105/139 (75.54%), Query Frame = 3
Query: 2121 FKESARNFNETMCKAANITIVEVEQLVEIGEIDPDHVHVPGIYVDRILVGEKFEKRIEKKVYTERTGKQETDPIKIKRA-KERERIMRRVALELKNGMYVNVGIGMPMQLANYIPNDMIVTLQSENGILGIGQYPKEAK 2534
            F++SARNFN  MCKAA I+I EVE++V +G+IDPD VHVPGIYVDRI+ G  +EKRIEK     R+ KQ   P K+  A K R RI++R ALE K+GMY N+GIGMPM  +NYIP ++ VTLQSENGILG+G +P E +
Sbjct:  241 FRKSARNFNPAMCKAAKISIAEVEEIVPVGKIDPDQVHVPGIYVDRIIKGTDYEKRIEK-----RSTKQTVKPTKVTPASKMRNRIIKRAALEFKDGMYANLGIGMPMLASNYIPKNVKVTLQSENGILGLGPFPDEGE 374          

HSP 2 Score: 38.5058 bits (88), Expect = 2.172e-44
Identity = 17/21 (80.95%), Postives = 19/21 (90.48%), Query Frame = 2
Query: 2531 EIDADLINAGKETVTIRPGGS 2593
            E+DADLINAGKETVT+ PG S
Sbjct:  374 EVDADLINAGKETVTVLPGAS 394          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. TrEMBL
Match: K7IM81 (Succinyl-CoA:3-ketoacid-coenzyme A transferase OS=Nasonia vitripennis OX=7425 PE=3 SV=1)

HSP 1 Score: 172.555 bits (436), Expect = 2.584e-44
Identity = 84/139 (60.43%), Postives = 105/139 (75.54%), Query Frame = 3
Query: 2121 FKESARNFNETMCKAANITIVEVEQLVEIGEIDPDHVHVPGIYVDRILVGEKFEKRIEKKVYTERTGKQETDPIKIKRA-KERERIMRRVALELKNGMYVNVGIGMPMQLANYIPNDMIVTLQSENGILGIGQYPKEAK 2534
            F++SARNFN  MCKAA I+I EVE++V +G+IDPD VHVPGIYVDRI+ G  +EKRIEK     R+ KQ   P K+  A K R RI++R ALE K+GMY N+GIGMPM  +NYIP ++ VTLQSENGILG+G +P E +
Sbjct:  241 FRKSARNFNPAMCKAAKISIAEVEEIVPVGKIDPDQVHVPGIYVDRIIKGTDYEKRIEK-----RSTKQTVKPTKVTPASKMRNRIIKRAALEFKDGMYANLGIGMPMLASNYIPKNVKVTLQSENGILGLGPFPDEGE 374          

HSP 2 Score: 38.5058 bits (88), Expect = 2.584e-44
Identity = 17/21 (80.95%), Postives = 19/21 (90.48%), Query Frame = 2
Query: 2531 EIDADLINAGKETVTIRPGGS 2593
            E+DADLINAGKETVT+ PG S
Sbjct:  374 EVDADLINAGKETVTVLPGAS 394          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. TrEMBL
Match: V9IHA7 (Succinyl-CoA:3-ketoacid-coenzyme A transferase OS=Apis cerana OX=7461 GN=ACCB04145 PE=2 SV=1)

HSP 1 Score: 169.859 bits (429), Expect = 1.057e-43
Identity = 82/139 (58.99%), Postives = 105/139 (75.54%), Query Frame = 3
Query: 2121 FKESARNFNETMCKAANITIVEVEQLVEIGEIDPDHVHVPGIYVDRILVGEKFEKRIEKKVYTERTGKQETDPIKIKRA-KERERIMRRVALELKNGMYVNVGIGMPMQLANYIPNDMIVTLQSENGILGIGQYPKEAK 2534
            F++SARNFN  MCKAA I I EVE++VEIG++DPD +H+PGIYVDRI+ G  +EKRIEK     R  KQ   P K+  A K R+RI+RR ALE K+GMY N+GIG+PM   NYIP ++ +TLQSENGILG+G +P E++
Sbjct:  242 FRKSARNFNPVMCKAAKIAIAEVEEIVEIGQLDPDQIHLPGIYVDRIVKGLSYEKRIEK-----RFTKQNIKPKKVTPASKARDRIIRRAALEFKDGMYANLGIGIPMLACNYIPKNVKITLQSENGILGVGPFPNESE 375          

HSP 2 Score: 38.891 bits (89), Expect = 1.057e-43
Identity = 18/22 (81.82%), Postives = 19/22 (86.36%), Query Frame = 2
Query: 2528 SEIDADLINAGKETVTIRPGGS 2593
            SE+D DLINAGKETVTI PG S
Sbjct:  374 SEVDPDLINAGKETVTIFPGAS 395          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. TrEMBL
Match: A0A2A3EEM0 (Succinyl-CoA:3-ketoacid-coenzyme A transferase OS=Apis cerana cerana OX=94128 GN=APICC_06362 PE=3 SV=1)

HSP 1 Score: 169.859 bits (429), Expect = 1.175e-43
Identity = 82/139 (58.99%), Postives = 105/139 (75.54%), Query Frame = 3
Query: 2121 FKESARNFNETMCKAANITIVEVEQLVEIGEIDPDHVHVPGIYVDRILVGEKFEKRIEKKVYTERTGKQETDPIKIKRA-KERERIMRRVALELKNGMYVNVGIGMPMQLANYIPNDMIVTLQSENGILGIGQYPKEAK 2534
            F++SARNFN  MCKAA I I EVE++VEIG++DPD +H+PGIYVDRI+ G  +EKRIEK     R  KQ   P K+  A K R+RI+RR ALE K+GMY N+GIG+PM   NYIP ++ +TLQSENGILG+G +P E++
Sbjct:  242 FRKSARNFNPVMCKAAKIAIAEVEEIVEIGQLDPDQIHLPGIYVDRIVKGLSYEKRIEK-----RFTKQNIKPKKVTPASKARDRIIRRAALEFKDGMYANLGIGIPMLACNYIPKNVKITLQSENGILGVGPFPNESE 375          

HSP 2 Score: 38.891 bits (89), Expect = 1.175e-43
Identity = 18/22 (81.82%), Postives = 19/22 (86.36%), Query Frame = 2
Query: 2528 SEIDADLINAGKETVTIRPGGS 2593
            SE+D DLINAGKETVTI PG S
Sbjct:  374 SEVDPDLINAGKETVTIFPGAS 395          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Cavefish
Match: oxct1b (succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial-like [Source:NCBI gene;Acc:103028178])

HSP 1 Score: 153.68 bits (387), Expect = 4.725e-41
Identity = 71/138 (51.45%), Postives = 100/138 (72.46%), Query Frame = 3
Query: 2121 FKESARNFNETMCKAANITIVEVEQLVEIGEIDPDHVHVPGIYVDRILVGEKFEKRIEKKVYTERTGKQETDPIKIKRAKERERIMRRVALELKNGMYVNVGIGMPMQLANYIPNDMIVTLQSENGILGIGQYPKEAK 2534
            F+++ RNFN+ MCKAA +TIVEVE++V++G    + +HVPGIY+DR++ G  +EKRIEK++       Q+  P      K RERI+RR ALE ++GMY N+GIG+PM  +NYI  ++ V LQSENGILG+G YP E++
Sbjct:  231 FRKTTRNFNQPMCKAAKVTIVEVEEIVDVGSFPAEDIHVPGIYIDRVVKGTSYEKRIEKRIVRS---SQKEKPKAKDSDKTRERIIRRAALEFEDGMYANLGIGIPMLASNYINPEITVHLQSENGILGLGPYPTESE 365          

HSP 2 Score: 35.4242 bits (80), Expect = 4.725e-41
Identity = 15/22 (68.18%), Postives = 19/22 (86.36%), Query Frame = 2
Query: 2528 SEIDADLINAGKETVTIRPGGS 2593
            SE+D +LINAGKETVT+ PG +
Sbjct:  364 SEVDPELINAGKETVTVLPGAA 385          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Cavefish
Match: oxct1a (succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial [Source:NCBI gene;Acc:103039388])

HSP 1 Score: 145.591 bits (366), Expect = 1.402e-39
Identity = 71/138 (51.45%), Postives = 99/138 (71.74%), Query Frame = 3
Query: 2121 FKESARNFNETMCKAANITIVEVEQLVEIGEIDPDHVHVPGIYVDRILVGEKFEKRIEKKVYTERTGKQETDPIKIKRAKE--RERIMRRVALELKNGMYVNVGIGMPMQLANYIPNDMIVTLQSENGILGIGQYPKE 2528
            F+++ARNFN+ MCKAA +TIVEVE++V++G    + VH+P +YV RI+ G  +EKRIE++       K +T   K K+  +  RERI+RR ALE ++GMY N+GIG+PM  +N+I  D+ V LQSENGILG+G YP E
Sbjct:  218 FRKTARNFNQPMCKAAKVTIVEVEEIVDVGTFAEEDVHIPSVYVHRIVKGNNYEKRIERRTVK----KAQTGTAKPKKDSDVVRERIVRRAALEFEDGMYANLGIGIPMLASNFIKPDISVYLQSENGILGLGPYPTE 351          

HSP 2 Score: 38.5058 bits (88), Expect = 1.402e-39
Identity = 17/21 (80.95%), Postives = 19/21 (90.48%), Query Frame = 2
Query: 2531 EIDADLINAGKETVTIRPGGS 2593
            E+DADLINAGKETVT+ PG S
Sbjct:  353 EVDADLINAGKETVTVLPGAS 373          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Cavefish
Match: oxct1a (succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial [Source:NCBI gene;Acc:103039388])

HSP 1 Score: 145.591 bits (366), Expect = 1.613e-39
Identity = 71/138 (51.45%), Postives = 99/138 (71.74%), Query Frame = 3
Query: 2121 FKESARNFNETMCKAANITIVEVEQLVEIGEIDPDHVHVPGIYVDRILVGEKFEKRIEKKVYTERTGKQETDPIKIKRAKE--RERIMRRVALELKNGMYVNVGIGMPMQLANYIPNDMIVTLQSENGILGIGQYPKE 2528
            F+++ARNFN+ MCKAA +TIVEVE++V++G    + VH+P +YV RI+ G  +EKRIE++       K +T   K K+  +  RERI+RR ALE ++GMY N+GIG+PM  +N+I  D+ V LQSENGILG+G YP E
Sbjct:  218 FRKTARNFNQPMCKAAKVTIVEVEEIVDVGTFAEEDVHIPSVYVHRIVKGNNYEKRIERRTVK----KAQTGTAKPKKDSDVVRERIVRRAALEFEDGMYANLGIGIPMLASNFIKPDISVYLQSENGILGLGPYPTE 351          

HSP 2 Score: 38.5058 bits (88), Expect = 1.613e-39
Identity = 17/21 (80.95%), Postives = 19/21 (90.48%), Query Frame = 2
Query: 2531 EIDADLINAGKETVTIRPGGS 2593
            E+DADLINAGKETVT+ PG S
Sbjct:  353 EVDADLINAGKETVTVLPGAS 373          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Sea Lamprey
Match: oxct1b (3-oxoacid CoA transferase 1b [Source:ZFIN;Acc:ZDB-GENE-060929-212])

HSP 1 Score: 77.7962 bits (190), Expect = 3.089e-16
Identity = 31/58 (53.45%), Postives = 47/58 (81.03%), Query Frame = 3
Query: 2121 FKESARNFNETMCKAANITIVEVEQLVEIGEIDPDHVHVPGIYVDRILVGEKFEKRIE 2294
            F+++ARNFN+ MCKAA  TI EVE++V++G   P+ VH+PGI+V R++ G+ ++KRIE
Sbjct:  161 FRKTARNFNQPMCKAAKCTIAEVEEIVDVGSFVPEDVHIPGIFVKRVIKGKSYQKRIE 218          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Nematostella
Match: EDO46906 (Succinyl-CoA:3-ketoacid-coenzyme A transferase [Source:UniProtKB/TrEMBL;Acc:A7RNT1])

HSP 1 Score: 145.206 bits (365), Expect = 3.719e-39
Identity = 70/135 (51.85%), Postives = 100/135 (74.07%), Query Frame = 3
Query: 2121 FKESARNFNETMCKAANITIVEVEQLVEIGEIDPDHVHVPGIYVDRILVGEKFEKRIEKKVYTERTGKQETDPIKIKRAKERERIMRRVALELKNGMYVNVGIGMPMQLANYIPNDMIVTLQSENGILGIGQYPK 2525
            F++SARNFN  M KAA +TI EVE+++E GEI P+ VH+  +YVDR++ G+K+EKRIE+   T +    ++ P K   A+ RERI++R ALE K+GM+ N+GIGMPM  +N+IP  + V LQSENGI+G+G +P+
Sbjct:  223 FRKSARNFNAPMGKAAKVTIAEVEEIIESGEIPPEDVHLSCVYVDRVIKGKKYEKRIERLTLT-KDDVGDSKP-KSAAAEMRERIIKRAALEFKDGMFANLGIGMPMLASNFIPEGVTVQLQSENGIMGLGPFPR 355          

HSP 2 Score: 35.8094 bits (81), Expect = 3.719e-39
Identity = 16/19 (84.21%), Postives = 17/19 (89.47%), Query Frame = 2
Query: 2537 DADLINAGKETVTIRPGGS 2593
            D DLINAGKETVT+ PGGS
Sbjct:  360 DGDLINAGKETVTVLPGGS 378          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Medaka
Match: oxct1a (3-oxoacid CoA-transferase 1 [Source:NCBI gene;Acc:101163581])

HSP 1 Score: 132.88 bits (333), Expect = 1.204e-35
Identity = 72/136 (52.94%), Postives = 99/136 (72.79%), Query Frame = 3
Query: 2121 FKESARNFNETMCKAANITIVEVEQLVEIGEIDPDHVHVPGIYVDRILVGEKFEKRIEKKVYTERTGKQETDPIKIKRAKERERIMRRVALELKNGMYVNVGIGMPMQLANYIPNDMIVTLQSENGILGIGQYPKE 2528
            F+++ARNFN+ MCKAA  TIVEVE++VE+G    + +H+P IYV+R++ G  +EKRIEK+  T R G++E    K      RERI+RR ALE ++GMY N+GIG+PM  +N+I  D+ V LQSENGILG+G YP +
Sbjct:  232 FRKTARNFNQPMCKAAKTTIVEVEEVVEVGTFAAEDIHIPSIYVNRVVHGLSYEKRIEKR--TVRKGQEEKPKPKKDSDIVRERIIRRAALEFEDGMYANLGIGIPMLASNFIKPDITVHLQSENGILGLGPYPTQ 365          

HSP 2 Score: 38.1206 bits (87), Expect = 1.204e-35
Identity = 16/23 (69.57%), Postives = 20/23 (86.96%), Query Frame = 2
Query: 2525 RSEIDADLINAGKETVTIRPGGS 2593
            + E+DADLINAGKETVT+ PG +
Sbjct:  365 QDEVDADLINAGKETVTVLPGAA 387          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Planmine SMEST
Match: SMESG000080432.1 (SMESG000080432.1)

HSP 1 Score: 277.33 bits (708), Expect = 2.001e-83
Identity = 133/138 (96.38%), Postives = 138/138 (100.00%), Query Frame = 3
Query: 2121 FKESARNFNETMCKAANITIVEVEQLVEIGEIDPDHVHVPGIYVDRILVGEKFEKRIEKKVYTERTGKQETDPIKIKRAKERERIMRRVALELKNGMYVNVGIGMPMQLANYIPNDMIVTLQSENGILGIGQYPKEAK 2534
            F++SARNFNETMCKAANITIVEVEQL+EIGEIDPDHVHVPGIYVDRILVGEKFEKRIEKKVYTERTGKQETDPIKIKRAKERERIMRRVALELKNGMYVNVGIGMPMQLANYIPNDMIVTLQSENGILGIGQYPKE++
Sbjct:  215 FRKSARNFNETMCKAANITIVEVEQLIEIGEIDPDHVHVPGIYVDRILVGEKFEKRIEKKVYTERTGKQETDPIKIKRAKERERIMRRVALELKNGMYVNVGIGMPMQLANYIPNDMIVTLQSENGILGIGQYPKESE 352          
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Planmine SMEST
Match: SMESG000080424.1 (SMESG000080424.1)

HSP 1 Score: 245.358 bits (625), Expect = 1.909e-71
Identity = 115/137 (83.94%), Postives = 127/137 (92.70%), Query Frame = 3
Query: 2121 FKESARNFNETMCKAANITIVEVEQLVEIGEIDPDHVHVPGIYVDRILVGEKFEKRIEKKVYTERTGKQETDPIKIKRAKERERIMRRVALELKNGMYVNVGIGMPMQLANYIPNDMIVTLQSENGILGIGQYPKEA 2531
            F+++ARNFNETMCK+AN TIVEVEQLVEIGEIDPDH+H+PGIYVDRILVGEKFEKRIEKK Y  +  KQETDP+KIK+AKERERI+RRVALEL+NGMYVNVGIGMPMQLA YIP DMIV LQSENGILGIGQYP E+
Sbjct:  229 FRKTARNFNETMCKSANTTIVEVEQLVEIGEIDPDHIHIPGIYVDRILVGEKFEKRIEKKAYLGKKEKQETDPVKIKKAKERERILRRVALELENGMYVNVGIGMPMQLARYIPQDMIVALQSENGILGIGQYPSES 365          
The following BLAST results are available for this feature:
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
OXCT12.013e-3850.003-oxoacid CoA-transferase 1 [Source:HGNC Symbol;Ac... [more]
OXCT12.182e-3850.003-oxoacid CoA-transferase 1 [Source:HGNC Symbol;Ac... [more]
OXCT28.815e-3552.213-oxoacid CoA-transferase 2 [Source:HGNC Symbol;Ac... [more]
back to top
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
C05C10.36.838e-3446.72Probable succinyl-CoA:3-ketoacid coenzyme A transf... [more]
back to top
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
SCOT9.686e-3951.08gene:FBgn0035298 transcript:FBtr0333431[more]
SCOT1.033e-3851.45gene:FBgn0035298 transcript:FBtr0072844[more]
SCOT1.095e-3851.45gene:FBgn0035298 transcript:FBtr0072843[more]
back to top
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
oxct1b6.015e-4453.623-oxoacid CoA transferase 1b [Source:ZFIN;Acc:ZDB-... [more]
oxct1a1.971e-3851.473-oxoacid CoA transferase 1a [Source:ZFIN;Acc:ZDB-... [more]
oxct1a1.270e-3441.863-oxoacid CoA transferase 1a [Source:ZFIN;Acc:ZDB-... [more]
back to top
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mettl182.599e-3352.21methyltransferase like 18 [Source:Xenbase;Acc:XB-G... [more]
mettl183.140e-3352.21methyltransferase like 18 [Source:Xenbase;Acc:XB-G... [more]
mettl183.411e-3352.21methyltransferase like 18 [Source:Xenbase;Acc:XB-G... [more]
mettl183.413e-3352.21methyltransferase like 18 [Source:Xenbase;Acc:XB-G... [more]
mettl183.497e-3352.21methyltransferase like 18 [Source:Xenbase;Acc:XB-G... [more]
back to top
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Oxct12.920e-3850.003-oxoacid CoA transferase 1 [Source:MGI Symbol;Acc... [more]
Oxct13.021e-3850.003-oxoacid CoA transferase 1 [Source:MGI Symbol;Acc... [more]
Oxct2a2.167e-3450.363-oxoacid CoA transferase 2A [Source:MGI Symbol;Ac... [more]
Oxct2b3.221e-3449.643-oxoacid CoA transferase 2B [Source:MGI Symbol;Ac... [more]
back to top
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q54JD9|SCOT_DICDI1.542e-4055.88Probable succinyl-CoA:3-ketoacid coenzyme A transf... [more]
sp|Q29551|SCOT1_PIG2.007e-3845.09Succinyl-CoA:3-ketoacid coenzyme A transferase 1, ... [more]
sp|Q9W058|SCOT_DROME7.914e-3851.45Succinyl-CoA:3-ketoacid-coenzyme A transferase, mi... [more]
sp|P55809|SCOT1_HUMAN8.883e-3850.00Succinyl-CoA:3-ketoacid coenzyme A transferase 1, ... [more]
sp|B2GV06|SCOT1_RAT1.092e-3751.47Succinyl-CoA:3-ketoacid coenzyme A transferase 1, ... [more]
back to top
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0M9A4574.362e-4561.15Succinyl-CoA:3-ketoacid-coenzyme A transferase OS=... [more]
A0A232ERW32.172e-4460.43Succinyl-CoA:3-ketoacid-coenzyme A transferase OS=... [more]
K7IM812.584e-4460.43Succinyl-CoA:3-ketoacid-coenzyme A transferase OS=... [more]
V9IHA71.057e-4358.99Succinyl-CoA:3-ketoacid-coenzyme A transferase OS=... [more]
A0A2A3EEM01.175e-4358.99Succinyl-CoA:3-ketoacid-coenzyme A transferase OS=... [more]
back to top
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
oxct1b4.725e-4151.45succinyl-CoA:3-ketoacid coenzyme A transferase 1, ... [more]
oxct1a1.402e-3951.45succinyl-CoA:3-ketoacid coenzyme A transferase 1, ... [more]
oxct1a1.613e-3951.45succinyl-CoA:3-ketoacid coenzyme A transferase 1, ... [more]
back to top
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
oxct1b3.089e-1653.453-oxoacid CoA transferase 1b [Source:ZFIN;Acc:ZDB-... [more]
back to top
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO469063.719e-3951.85Succinyl-CoA:3-ketoacid-coenzyme A transferase [S... [more]
back to top
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
oxct1a1.204e-3552.943-oxoacid CoA-transferase 1 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Succinyl-CoA:3-ketoacid-coenzyme A transferase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000080432.12.001e-8396.38SMESG000080432.1[more]
SMESG000080424.11.909e-7183.94SMESG000080424.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028204 ID=SMED30028204|Name=Succinyl-CoA:3-ketoacid-coenzyme A transferase|organism=Schmidtea mediterranea sexual|type=transcript|length=2595bp
TTCTGCGCCCCAAAATTATTATCACCCGCCCCAATCCGAGGGTCCCGCCC
CCTAGTTTGCTCACCTTTGGTCTACGCTATTCATATGATTACGCCTAATC
AAGTTACAAAAAACGATTTTAAAAGGTTACACCATTCACAGATGGTAATT
TCCCGATTTTTATTTTCTTTTAAATTTACAATTTCAAACTTATTTTCTTA
TAATAGTGAAAATTAATAATTTAAAAAAAACTCAAAATGTAATGTCATGT
AATTTTAAAATGTGAAAATTTCAAACAGAATATTTATAAAAATTATGAAG
AGAAAATCAAATCAAAAAATACCAACTTATTTTAAAATTTAAGAATAATT
TTCAATATGATAATTCTGGAATTATCGTATGACATTAAATTTGTTTTATT
TAAAAATTTATTGGCTTTATAACACACAGTTTATACAAATTTATATACTG
TAACAGAAAAAATAAATGCTTTATAGAAATCGTCTGAAGAGCTGGGGTAA
ATGAATATAAACTACTAGTTAATAAAGAGAAGTATTTTAATATCTAGAGA
TAACGTCAAAGGTGTTTGAATGGTTAATTATAAAATAGTTTCTTTCGGAA
TTCAAAGAGAAAAGGCTTTTCAGTTTGAGATGAGAAAAAAATAATGATTT
TAATGCGAAATACAAAAATAGGTTTTCAATAAGAAAGATAACTTGCATCA
GTCAAGAAGACAACATAAGCGCTGAATATATCAAAAAGACAATTTTGGAT
TAAGTATAAGTAATGAAGCATTACAGTGTAAAAAATAATATTGAAAATGT
TTTTAAAATGAAGGAAATATAAAATATTGATATGATGTCAATGAGGATAA
TATCATTTAAAATTGAAAAAACAAGCCATATTGGAAATAACAAAATAAAG
CTCATGGTTTTTGTGATTTCATATGAAAAATTGAATAAAACTTAGGTTAT
AAGACGACTAAAAGAATTTCAAAAAATATGTGGTGACTTGCAATTTCTGG
AACGAAGAATAAAGATATGAGGATTTTGATATCTAACTTACAGGATTATT
TATTAATTTGAGCAATGGGATGATTTTGCTTGACAGTTTTGGCTTACACA
AAGACGCATAATTTCTTGATTTATTGCATTAAATGAAATTTTAATCGATT
ACTTTACCACCAAGAACAGTTTACCTCCAACCGCTTGATGTAAATTCCGA
TTTTAAATCAATTATGAAGATGAGTGGAAGAATAAGGCTTAAATAGCAAT
AAAGAATATACAAAATCAGGATACCGTAAAAGACCCTGATGGGAAAGAGG
AACGATAGAATAAAATCTTTCAGTATGTTCTTGAACTATCCCAGTTAAAT
AAAATTGACCATAATTTTAAGTTGCTAAAGATAAAATATTACGTTTATAT
TAAAGAAAATAATTCAGATGATGTAATAAGCTTCTGAAGTATTTTGATTC
TTAACTTTTTTCAAAAATTCACTTTAAAATTATTAAAACAATTGGTCTTT
TTTCGAAACTTAGATCTAGCGCTATTTTCGACAGAATCCGGTAATAGGAA
AATCATAAAAAATTCGAATATAATTAACCTGGCATTTTTTGATAAAAATT
TATTTATAGTATAACTTTAAGATTTCTATTTTGTAATTTGTATGTAACAT
TTGTTAACAAAACAAACTTAAACAAAATAAATCAAATACGATACTTGTTT
TTTAAAAAACGGGTTAGAAGTCCATGGACCCAATAGGAATAGGTGGATCA
CTTTTCGAGAGTATGCTAAGCTTTTTTCTAATTATTTTAAAAATAATTAA
TAGACACGATGGCTATGTGGTAAAATTATTTCCTCCTATAATGAGTACAT
TGAATTCGAACCCTGTGAAAGACCAAGTAAAGGGATTATATTAAAAAAAA
TTTATACATAAATATATTGTTTTTGTCTTATATAAATTACAAAATATTTT
GAGCAATACGTAGGATTCTAAATGGTTACCAAAGGATTTGAACTCCTGGG
TTTAGATGAGAAAGTAGGGAAGAGTCTATCAGGGGGAATATCTAGAATCT
ATTGACCGAACCGGAATCAGTGAAATTTTCCTTAATTCTTAAATTTTTAA
GTTTTGTATAAAAAAATTGTTTTAAGGAAAGCGCTAGAAATTTTAATGAA
ACAATGTGCAAAGCTGCCAATATTACCATTGTAGAGGTAGAACAGCTGGT
TGAAATTGGTGAAATAGATCCGGATCACGTTCACGTTCCTGGAATTTATG
TTGATCGAATCCTAGTAGGAGAAAAATTTGAAAAGAGAATCGAAAAGAAA
GTTTACACAGAGAGAACTGGGAAACAAGAGACAGACCCAATTAAAATTAA
AAGAGCGAAAGAACGCGAACGAATTATGCGGAGAGTTGCTCTTGAATTAA
AAAATGGAATGTATGTTAATGTAGGCATTGGAATGCCTATGCAATTAGCA
AATTATATTCCCAATGATATGATAGTTACATTACAAAGTGAAAATGGAAT
ATTAGGTATTGGGCAATATCCAAAAGAAGCGAAATAGATGCTGATCTCAT
TAATGCTGGCAAAGAAACTGTCACGATAAGACCCGGAGGATCATA
back to top

protein sequence of SMED30028204-orf-1

>SMED30028204-orf-1 ID=SMED30028204-orf-1|Name=SMED30028204-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=128bp
MCKAANITIVEVEQLVEIGEIDPDHVHVPGIYVDRILVGEKFEKRIEKKV
YTERTGKQETDPIKIKRAKERERIMRRVALELKNGMYVNVGIGMPMQLAN
YIPNDMIVTLQSENGILGIGQYPKEAK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000035Category 3 cell
Vocabulary: INTERPRO
TermDefinition
IPR037171NagB/RpiA_transferase-like
IPR004165CoA_trans_fam_I
IPR004164CoA_transf_AS
Vocabulary: biological process
TermDefinition
GO:0008152metabolic process
GO:0046952ketone body catabolic process
Vocabulary: molecular function
TermDefinition
GO:0008410CoA-transferase activity
GO:00082603-oxoacid CoA-transferase activity
GO:0016740transferase activity
Vocabulary: cellular component
TermDefinition
GO:0005739mitochondrion
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR004165Coenzyme A transferase family IPFAMPF01144CoA_transcoord: 72..127
e-value: 4.9E-8
score: 32.6
coord: 2..37
e-value: 1.5E-8
score: 34.4
IPR004165Coenzyme A transferase family IPANTHERPTHR13707KETOACID-COENZYME A TRANSFERASEcoord: 1..127
NoneNo IPR availableGENE3DG3DSA:3.40.1080.10coord: 1..49
e-value: 1.9E-16
score: 61.9
NoneNo IPR availableGENE3DG3DSA:3.40.1080.10coord: 66..128
e-value: 3.3E-20
score: 74.3
NoneNo IPR availablePANTHERPTHR13707:SF23SUCCINYL-COA:3-KETOACID-COENZYME A TRANSFERASEcoord: 1..127
NoneNo IPR availableCDDcd16983CID_SCAF8_likecoord: 12..87
e-value: 0.00230879
score: 33.7398
IPR004164Coenzyme A transferase active sitePROSITEPS01274COA_TRANSF_2coord: 110..118
IPR037171NagB/RpiA transferase-likeSUPERFAMILYSSF100950NagB/RpiA/CoA transferase-likecoord: 1..115