Placenta specific protein 8

Overview
NamePlacenta specific protein 8
Smed IDSMED30028199
Length (bp)631
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Placenta specific protein 8 (SMED30028199) t-SNE clustered cells

Violin plots show distribution of expression levels for Placenta specific protein 8 (SMED30028199) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Placenta specific protein 8 (SMED30028199) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Placenta specific protein 8 (SMED30028199) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028199

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neuronSMED30028199 dd_Smed_v4_865_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30028199 dd_Smed_v4_865_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30028199 dd_Smed_v4_865_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Placenta specific protein 8 vs. Ensembl Human
Match: PLAC8L1 (PLAC8 like 1 [Source:HGNC Symbol;Acc:HGNC:31746])

HSP 1 Score: 68.9366 bits (167), Expect = 4.669e-14
Identity = 44/117 (37.61%), Postives = 59/117 (50.43%), Query Frame = 2
Query:  146 TSPIYQQQPQMTSNQTVIIQQPVIQYGGREWSSSLCSCFDDMESCCCVFLVAPCYLCCLYSKYGECCCTPMIVPGADMALRIQHRNRHKIQGTILNDCCVSVFCGFCSMCQVKRDMD 496
             S + +Q  +  S +T I    ++Q GG  WS+ L S   D   C C      C  C +   YGEC C P++ PG+  ALRI  R RHKIQGT+  D      C   S+CQV R++ 
Sbjct:   45 ASAVVKQPVRGASGRTTITA--IVQTGG-GWSTGLFSVCRDRRICFCGLFCPMCLECDIARHYGECLCWPLL-PGSTFALRIGTRERHKIQGTLCEDWLAVHCCWAFSICQVARELK 157          
BLAST of Placenta specific protein 8 vs. Ensembl Human
Match: CNFN (cornifelin [Source:HGNC Symbol;Acc:HGNC:30183])

HSP 1 Score: 62.3882 bits (150), Expect = 2.756e-12
Identity = 30/87 (34.48%), Postives = 47/87 (54.02%), Query Frame = 2
Query:  233 EWSSSLCSCFDDMESCCCVFLVAPCYLCCLYSKYGECCCTPMIVPGADMALRIQHRNRHKIQGTILNDCCVSVFCGFCSMCQVKRDM 493
            +W + L  C +DM  C C      C  C +   +GECCC P + PG   ++R   R R+ IQG++ +D     FC  C++CQ+ R++
Sbjct:   23 DWHTGLTDCCNDMPVCLCGTFAPLCLACRISDDFGECCCAPYL-PGGLHSIRTGMRERYHIQGSVGHDWAALTFCLPCALCQMAREL 108          
BLAST of Placenta specific protein 8 vs. Ensembl Human
Match: CNFN (cornifelin [Source:HGNC Symbol;Acc:HGNC:30183])

HSP 1 Score: 62.3882 bits (150), Expect = 2.756e-12
Identity = 30/87 (34.48%), Postives = 47/87 (54.02%), Query Frame = 2
Query:  233 EWSSSLCSCFDDMESCCCVFLVAPCYLCCLYSKYGECCCTPMIVPGADMALRIQHRNRHKIQGTILNDCCVSVFCGFCSMCQVKRDM 493
            +W + L  C +DM  C C      C  C +   +GECCC P + PG   ++R   R R+ IQG++ +D     FC  C++CQ+ R++
Sbjct:   23 DWHTGLTDCCNDMPVCLCGTFAPLCLACRISDDFGECCCAPYL-PGGLHSIRTGMRERYHIQGSVGHDWAALTFCLPCALCQMAREL 108          
BLAST of Placenta specific protein 8 vs. Ensembl Human
Match: PLAC8 (placenta associated 8 [Source:HGNC Symbol;Acc:HGNC:19254])

HSP 1 Score: 59.6918 bits (143), Expect = 3.572e-11
Identity = 33/105 (31.43%), Postives = 54/105 (51.43%), Query Frame = 2
Query:  194 VIIQQPVIQYG----GREWSSSLCSCFDDMESCCCVFLVAPCYLCCLYSKYGECCCTPMIVPGADMALRIQHRNRHKIQGTILNDCCVSVFCGFCSMCQVKRDMD 496
            V++ QP +  G       W + +C CF D   C C     PC  C + +   ECC     + G  +A+R  +R R+ I G+I +D   ++ C  C++CQ+KRD++
Sbjct:    8 VVVTQPGVGPGPAPQNSNWQTGMCDCFSDCGVCLCGTFCFPCLGCQVAADMNECC-----LCGTSVAMRTLYRTRYGIPGSICDDYMATLCCPHCTLCQIKRDIN 107          
BLAST of Placenta specific protein 8 vs. Ensembl Human
Match: PLAC8 (placenta associated 8 [Source:HGNC Symbol;Acc:HGNC:19254])

HSP 1 Score: 59.6918 bits (143), Expect = 3.572e-11
Identity = 33/105 (31.43%), Postives = 54/105 (51.43%), Query Frame = 2
Query:  194 VIIQQPVIQYG----GREWSSSLCSCFDDMESCCCVFLVAPCYLCCLYSKYGECCCTPMIVPGADMALRIQHRNRHKIQGTILNDCCVSVFCGFCSMCQVKRDMD 496
            V++ QP +  G       W + +C CF D   C C     PC  C + +   ECC     + G  +A+R  +R R+ I G+I +D   ++ C  C++CQ+KRD++
Sbjct:    8 VVVTQPGVGPGPAPQNSNWQTGMCDCFSDCGVCLCGTFCFPCLGCQVAADMNECC-----LCGTSVAMRTLYRTRYGIPGSICDDYMATLCCPHCTLCQIKRDIN 107          
BLAST of Placenta specific protein 8 vs. Ensembl Zebrafish
Match: ponzr5 (plac8 onzin related protein 5 [Source:ZFIN;Acc:ZDB-GENE-081104-325])

HSP 1 Score: 84.7297 bits (208), Expect = 7.289e-21
Identity = 42/109 (38.53%), Postives = 63/109 (57.80%), Query Frame = 2
Query:  194 VIIQQP---VIQYGGREWSSSLCSCFDDMESCCCVFLVAPCYLCCLYSKYGECCCTPMI-----VPGADMALRIQHRNRHKIQGTILNDCCVSVFCGFCSMCQVKRDMD 496
            +  QQP   +I     +WSS +C C D++  CC  F   PC+ C    K+GEC C P++     +P   +A+R+  R+R+ I+G+I  DC  S FCG CS CQ+ R+M+
Sbjct:    4 MTTQQPGQFMIAQTNDQWSSGICDCCDNVPECCFSFWCFPCFACSTARKHGECLCLPLLDGFGFIPAITLAMRVSVRSRYGIKGSICKDCAYSTFCGACSWCQISREMN 112          
BLAST of Placenta specific protein 8 vs. Ensembl Zebrafish
Match: ponzr5 (plac8 onzin related protein 5 [Source:ZFIN;Acc:ZDB-GENE-081104-325])

HSP 1 Score: 84.7297 bits (208), Expect = 7.573e-21
Identity = 42/109 (38.53%), Postives = 63/109 (57.80%), Query Frame = 2
Query:  194 VIIQQP---VIQYGGREWSSSLCSCFDDMESCCCVFLVAPCYLCCLYSKYGECCCTPMI-----VPGADMALRIQHRNRHKIQGTILNDCCVSVFCGFCSMCQVKRDMD 496
            +  QQP   +I     +WSS +C C D++  CC  F   PC+ C    K+GEC C P++     +P   +A+R+  R+R+ I+G+I  DC  S FCG CS CQ+ R+M+
Sbjct:    1 MTTQQPGQFMIAQTNDQWSSGICDCCDNVPECCFSFWCFPCFACSTARKHGECLCLPLLDGFGFIPAITLAMRVSVRSRYGIKGSICKDCAYSTFCGACSWCQISREMN 109          
BLAST of Placenta specific protein 8 vs. Ensembl Zebrafish
Match: ponzr2 (plac8 onzin related protein 2 [Source:ZFIN;Acc:ZDB-GENE-050411-41])

HSP 1 Score: 78.1814 bits (191), Expect = 3.397e-18
Identity = 46/113 (40.71%), Postives = 59/113 (52.21%), Query Frame = 2
Query:  182 SNQTVIIQ-QP-VIQYGGREWSSSLCSCFDDMESCCCVFLVAPCYLCCLYSKYGECCCTPMI-------VPGADMALRIQHRNRHKIQGTILNDCCVSVFCGFCSMCQVKRDM 493
            SN  VI Q QP +I      W S +C C DD+  CC  F    CY C     YGEC C P++       +P   M++R   R R+ IQGT+ NDC +S FC  C  CQ+ R+M
Sbjct:    2 SNVMVITQPQPTMISAHSDHWGSDICDCCDDVPECCFAFWCFSCYTCIQARNYGECLCLPLLDIFCGGMIPPITMSIRTSMRQRYGIQGTMCNDCVLSTFCRPCVWCQMSREM 114          
BLAST of Placenta specific protein 8 vs. Ensembl Zebrafish
Match: ponzr2 (plac8 onzin related protein 2 [Source:ZFIN;Acc:ZDB-GENE-050411-41])

HSP 1 Score: 78.1814 bits (191), Expect = 3.397e-18
Identity = 46/113 (40.71%), Postives = 59/113 (52.21%), Query Frame = 2
Query:  182 SNQTVIIQ-QP-VIQYGGREWSSSLCSCFDDMESCCCVFLVAPCYLCCLYSKYGECCCTPMI-------VPGADMALRIQHRNRHKIQGTILNDCCVSVFCGFCSMCQVKRDM 493
            SN  VI Q QP +I      W S +C C DD+  CC  F    CY C     YGEC C P++       +P   M++R   R R+ IQGT+ NDC +S FC  C  CQ+ R+M
Sbjct:    2 SNVMVITQPQPTMISAHSDHWGSDICDCCDDVPECCFAFWCFSCYTCIQARNYGECLCLPLLDIFCGGMIPPITMSIRTSMRQRYGIQGTMCNDCVLSTFCRPCVWCQMSREM 114          
BLAST of Placenta specific protein 8 vs. Ensembl Zebrafish
Match: ponzr3 (plac8 onzin related protein 3 [Source:ZFIN;Acc:ZDB-GENE-050506-38])

HSP 1 Score: 75.8702 bits (185), Expect = 1.864e-17
Identity = 41/108 (37.96%), Postives = 63/108 (58.33%), Query Frame = 2
Query:  194 VIIQQP---VIQYGGREWSSSLCSCFDDMESCCCVFLVAPCYLCCLYSKYGECCCTPMI-----VPGADMALRIQHRNRHKIQGTILNDCCVSVFCGFCSMCQVKRDM 493
            +IIQQP   V+  G  +WS+S+C C D++  CC     +PC+ C     +GEC C P++      P   MA+R+  R  + I+ +I NDC +S  CG CS CQ++R++
Sbjct:    5 MIIQQPKPLVLAPGSDQWSTSICEC-DNLHECCFAVWCSPCFACITARDHGECLCLPLLDSFGLCPPITMAMRVSVRRTYGIEDSICNDCVLSFCCGPCSYCQIRREL 111          
BLAST of Placenta specific protein 8 vs. Ensembl Xenopus
Match: ENSXETT00000008293.1 (novel protein similar to cornifelin [Source:NCBI gene;Acc:733751])

HSP 1 Score: 76.6406 bits (187), Expect = 1.189e-17
Identity = 44/114 (38.60%), Postives = 62/114 (54.39%), Query Frame = 2
Query:  173 QMTSNQTVIIQQPVIQ------YGGREWSSSLCSCFDDMESCCCVFLVAPCYLCCLYSKYGECCCTPMIVPGADMALRIQHRNRHKIQGTILNDCCVSVFCGFCSMCQVKRDMD 496
            Q+ + QTVI Q   +Q      +G  +W+S    CF D+  C C      C  C +   YGECCC P++  G  +ALR   R R+ IQGTI  DC    FCG C++CQ+ R+++
Sbjct:    3 QLETTQTVIFQPQAVQGYTTSKFG--QWNSDTFDCFRDVGICLCGAFFPMCVACKVAQDYGECCCLPLM-GGTILALRTGIRERYHIQGTICTDCLCVTFCGPCALCQMARELE 113          
BLAST of Placenta specific protein 8 vs. Ensembl Xenopus
Match: ifi35 (interferon induced protein 35 [Source:Xenbase;Acc:XB-GENE-1010748])

HSP 1 Score: 76.6406 bits (187), Expect = 1.308e-17
Identity = 44/114 (38.60%), Postives = 62/114 (54.39%), Query Frame = 2
Query:  173 QMTSNQTVIIQQPVIQ------YGGREWSSSLCSCFDDMESCCCVFLVAPCYLCCLYSKYGECCCTPMIVPGADMALRIQHRNRHKIQGTILNDCCVSVFCGFCSMCQVKRDMD 496
            Q+ + QTVI Q   +Q      +G  +W+S    CF D+  C C      C  C +   YGECCC P++  G  +ALR   R R+ IQGTI  DC    FCG C++CQ+ R+++
Sbjct:   13 QLETTQTVIFQPQAVQGYTTSKFG--QWNSDTFDCFRDVGICLCGAFFPMCVACKVAQDYGECCCLPLM-GGTILALRTGIRERYHIQGTICTDCLCVTFCGPCALCQMARELE 123          
BLAST of Placenta specific protein 8 vs. Ensembl Xenopus
Match: ifi35 (interferon induced protein 35 [Source:Xenbase;Acc:XB-GENE-1010748])

HSP 1 Score: 70.8626 bits (172), Expect = 2.283e-15
Identity = 36/88 (40.91%), Postives = 50/88 (56.82%), Query Frame = 2
Query:  233 EWSSSLCSCFDDMESCCCVFLVAPCYLCCLYSKYGECCCTPMIVPGADMALRIQHRNRHKIQGTILNDCCVSVFCGFCSMCQVKRDMD 496
            +W+S    CF D+  C C      C  C +   YGECCC P++  G  +ALR   R R+ IQGTI  DC    FCG C++CQ+ R+++
Sbjct:   35 QWNSDTFDCFRDVGICLCGAFFPMCVACKVAQDYGECCCLPLM-GGTILALRTGIRERYHIQGTICTDCLCVTFCGPCALCQMARELE 121          
BLAST of Placenta specific protein 8 vs. Ensembl Xenopus
Match: eps15l1 (epidermal growth factor receptor pathway substrate 15-like 1 [Source:Xenbase;Acc:XB-GENE-959469])

HSP 1 Score: 68.1662 bits (165), Expect = 2.141e-14
Identity = 45/124 (36.29%), Postives = 63/124 (50.81%), Query Frame = 2
Query:  125 QQPQMQFTSPIYQQQPQMTSNQTVIIQQPVIQYGGREWSSSLCSCFDDMESCCCVFLVAPCYLCCLYSK-YGECCCTPMIVPGADMALRIQHRNRHKIQGTILNDCCVSVFCGFCSMCQVKRDM 493
              PQ+  + PI  +    T  Q   +  P       +WSS  C C +D   C C   V PC L C  +K YGECCC P +  G  +A+R   R R+ I+GTI ND    + CG C++CQ+ R++
Sbjct:    2 SAPQVTVSYPITYEP---TGLQNFTVSAP------SKWSSDTCDCCNDAGICLCGAFV-PCILACRVAKDYGECCCLPCLF-GTSIAMRTGIRERYHIEGTICNDWACVMCCGPCTLCQMAREL 114          
BLAST of Placenta specific protein 8 vs. Ensembl Xenopus
Match: myo19 (myosin XIX [Source:Xenbase;Acc:XB-GENE-999897])

HSP 1 Score: 67.3958 bits (163), Expect = 3.388e-14
Identity = 34/89 (38.20%), Postives = 51/89 (57.30%), Query Frame = 2
Query:  230 REWSSSLCSCFDDMESCCCVFLVAPCYLCCLYSKYGECCCTPMIVPGADMALRIQHRNRHKIQGTILNDCCVSVFCGFCSMCQVKRDMD 496
              W+S +  C  D+  C C   +  C  C +   YGECCC P ++ G  +A+R   R R++I GTI NDC    FCG C++CQ+ R+++
Sbjct:   21 NRWNSDVFDCCQDLGICLCGTFLPLCLACKVAQDYGECCCLP-VLNGTIIAMRTGIRERYQIPGTICNDCVCLTFCGPCTLCQMARELN 108          
BLAST of Placenta specific protein 8 vs. Ensembl Mouse
Match: Plac8l1 (PLAC8-like 1 [Source:MGI Symbol;Acc:MGI:1916651])

HSP 1 Score: 71.2478 bits (173), Expect = 4.167e-15
Identity = 47/139 (33.81%), Postives = 68/139 (48.92%), Query Frame = 2
Query:  134 QMQFTSPIYQQQPQMTSN------QTVIIQQPV------------IQYGGREWSSSLCSCFDDMESCCCVFLVAPCYLCCLYSKYGECCCTPMIVPGADMALRIQHRNRHKIQGTILNDCCVSVFCGFCSMCQVKRDMD 496
             +   SP+  +   + SN        V+++QP+            +Q GG +WS+ L S   D + C    L   C  C +   YGEC C P++ PG+  ALRI  R RH+IQGT+  DC V   C   S+CQV R++ 
Sbjct:   21 HLPLFSPMPSEDEHLISNLRSHVPARVVVKQPIRGAIGRTTVAAIVQTGG-DWSTGLFSVCRDRKICFWGLLCPMCLECDIARHYGECLCWPLL-PGSTFALRIGTRERHRIQGTLCEDCVVVHCCWPFSICQVARELK 157          
BLAST of Placenta specific protein 8 vs. Ensembl Mouse
Match: Plac8 (placenta-specific 8 [Source:MGI Symbol;Acc:MGI:2445289])

HSP 1 Score: 64.6994 bits (156), Expect = 2.552e-13
Identity = 40/109 (36.70%), Postives = 57/109 (52.29%), Query Frame = 2
Query:  176 MTSNQTVIIQQP--VIQYGGREWSSSLCSCFDDMESCCCVFLVAPCYLCCLYSKYGECCCTPMIVPGADMALRIQHRNRHKIQGTILNDCCVSVFCGFCSMCQVKRDMD 496
            M    TVI+ QP  V       W +SLC CF D   C C      C  C + +   ECC     + G  +A+R  +R R+ I G+I +D  V++FC  CS+CQ+KRD++
Sbjct:    1 MAQAPTVIVTQPGFVRAPQNSNWQTSLCDCFSDCGVCLCGTFCFTCLGCQVAADMNECC-----LCGTTVAMRTLYRTRYGIPGSICDDYMVTLFCPVCSVCQLKRDIN 104          
BLAST of Placenta specific protein 8 vs. Ensembl Mouse
Match: Plac8 (placenta-specific 8 [Source:MGI Symbol;Acc:MGI:2445289])

HSP 1 Score: 64.6994 bits (156), Expect = 2.552e-13
Identity = 40/109 (36.70%), Postives = 57/109 (52.29%), Query Frame = 2
Query:  176 MTSNQTVIIQQP--VIQYGGREWSSSLCSCFDDMESCCCVFLVAPCYLCCLYSKYGECCCTPMIVPGADMALRIQHRNRHKIQGTILNDCCVSVFCGFCSMCQVKRDMD 496
            M    TVI+ QP  V       W +SLC CF D   C C      C  C + +   ECC     + G  +A+R  +R R+ I G+I +D  V++FC  CS+CQ+KRD++
Sbjct:    1 MAQAPTVIVTQPGFVRAPQNSNWQTSLCDCFSDCGVCLCGTFCFTCLGCQVAADMNECC-----LCGTTVAMRTLYRTRYGIPGSICDDYMVTLFCPVCSVCQLKRDIN 104          
BLAST of Placenta specific protein 8 vs. Ensembl Mouse
Match: Plac8 (placenta-specific 8 [Source:MGI Symbol;Acc:MGI:2445289])

HSP 1 Score: 64.6994 bits (156), Expect = 2.552e-13
Identity = 40/109 (36.70%), Postives = 57/109 (52.29%), Query Frame = 2
Query:  176 MTSNQTVIIQQP--VIQYGGREWSSSLCSCFDDMESCCCVFLVAPCYLCCLYSKYGECCCTPMIVPGADMALRIQHRNRHKIQGTILNDCCVSVFCGFCSMCQVKRDMD 496
            M    TVI+ QP  V       W +SLC CF D   C C      C  C + +   ECC     + G  +A+R  +R R+ I G+I +D  V++FC  CS+CQ+KRD++
Sbjct:    1 MAQAPTVIVTQPGFVRAPQNSNWQTSLCDCFSDCGVCLCGTFCFTCLGCQVAADMNECC-----LCGTTVAMRTLYRTRYGIPGSICDDYMVTLFCPVCSVCQLKRDIN 104          
BLAST of Placenta specific protein 8 vs. Ensembl Mouse
Match: Cnfn (cornifelin [Source:MGI Symbol;Acc:MGI:1919633])

HSP 1 Score: 63.5438 bits (153), Expect = 7.619e-13
Identity = 31/87 (35.63%), Postives = 47/87 (54.02%), Query Frame = 2
Query:  233 EWSSSLCSCFDDMESCCCVFLVAPCYLCCLYSKYGECCCTPMIVPGADMALRIQHRNRHKIQGTILNDCCVSVFCGFCSMCQVKRDM 493
            +W + L  C +DM  C C      C  C +   +GECCC P + PG   +LR   R R+ IQG++ +D     FC  C++CQ+ R++
Sbjct:   22 DWHTGLTDCCNDMPVCLCGTFAPLCLACRISDDFGECCCAPYL-PGGLHSLRTGMRERYHIQGSVGHDWAALTFCLPCALCQMAREL 107          
BLAST of Placenta specific protein 8 vs. UniProt/SwissProt
Match: sp|Q08EJ0|PL8L1_MOUSE (PLAC8-like protein 1 OS=Mus musculus OX=10090 GN=Plac8l1 PE=2 SV=2)

HSP 1 Score: 71.2478 bits (173), Expect = 2.915e-14
Identity = 47/139 (33.81%), Postives = 68/139 (48.92%), Query Frame = 2
Query:  134 QMQFTSPIYQQQPQMTSN------QTVIIQQPV------------IQYGGREWSSSLCSCFDDMESCCCVFLVAPCYLCCLYSKYGECCCTPMIVPGADMALRIQHRNRHKIQGTILNDCCVSVFCGFCSMCQVKRDMD 496
             +   SP+  +   + SN        V+++QP+            +Q GG +WS+ L S   D + C    L   C  C +   YGEC C P++ PG+  ALRI  R RH+IQGT+  DC V   C   S+CQV R++ 
Sbjct:   21 HLPLFSPMPSEDEHLISNLRSHVPARVVVKQPIRGAIGRTTVAAIVQTGG-DWSTGLFSVCRDRKICFWGLLCPMCLECDIARHYGECLCWPLL-PGSTFALRIGTRERHRIQGTLCEDCVVVHCCWPFSICQVARELK 157          
BLAST of Placenta specific protein 8 vs. UniProt/SwissProt
Match: sp|A1L4L8|PL8L1_HUMAN (PLAC8-like protein 1 OS=Homo sapiens OX=9606 GN=PLAC8L1 PE=2 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 2.242e-13
Identity = 44/117 (37.61%), Postives = 59/117 (50.43%), Query Frame = 2
Query:  146 TSPIYQQQPQMTSNQTVIIQQPVIQYGGREWSSSLCSCFDDMESCCCVFLVAPCYLCCLYSKYGECCCTPMIVPGADMALRIQHRNRHKIQGTILNDCCVSVFCGFCSMCQVKRDMD 496
             S + +Q  +  S +T I    ++Q GG  WS+ L S   D   C C      C  C +   YGEC C P++ PG+  ALRI  R RHKIQGT+  D      C   S+CQV R++ 
Sbjct:   45 ASAVVKQPVRGASGRTTITA--IVQTGG-GWSTGLFSVCRDRRICFCGLFCPMCLECDIARHYGECLCWPLL-PGSTFALRIGTRERHKIQGTLCEDWLAVHCCWAFSICQVARELK 157          
BLAST of Placenta specific protein 8 vs. UniProt/SwissProt
Match: sp|Q0VBW2|CNFN_BOVIN (Cornifelin OS=Bos taurus OX=9913 GN=CNFN PE=3 SV=1)

HSP 1 Score: 66.6254 bits (161), Expect = 3.230e-13
Identity = 33/87 (37.93%), Postives = 48/87 (55.17%), Query Frame = 2
Query:  233 EWSSSLCSCFDDMESCCCVFLVAPCYLCCLYSKYGECCCTPMIVPGADMALRIQHRNRHKIQGTILNDCCVSVFCGFCSMCQVKRDM 493
            +W + L  C +DM  C C      C  C +   +GECCCTP + PG   +LR   R R++IQG+I  D     FC  C++CQ+ R++
Sbjct:   22 DWHTGLTDCCNDMPVCLCGTFAPLCLACRISDDFGECCCTPYL-PGGLHSLRTGMRERYRIQGSIGKDWAALTFCLPCALCQMAREL 107          
BLAST of Placenta specific protein 8 vs. UniProt/SwissProt
Match: sp|Q9JI48|PLAC8_MOUSE (Placenta-specific gene 8 protein OS=Mus musculus OX=10090 GN=Plac8 PE=1 SV=1)

HSP 1 Score: 64.6994 bits (156), Expect = 1.785e-12
Identity = 40/109 (36.70%), Postives = 57/109 (52.29%), Query Frame = 2
Query:  176 MTSNQTVIIQQP--VIQYGGREWSSSLCSCFDDMESCCCVFLVAPCYLCCLYSKYGECCCTPMIVPGADMALRIQHRNRHKIQGTILNDCCVSVFCGFCSMCQVKRDMD 496
            M    TVI+ QP  V       W +SLC CF D   C C      C  C + +   ECC     + G  +A+R  +R R+ I G+I +D  V++FC  CS+CQ+KRD++
Sbjct:    1 MAQAPTVIVTQPGFVRAPQNSNWQTSLCDCFSDCGVCLCGTFCFTCLGCQVAADMNECC-----LCGTTVAMRTLYRTRYGIPGSICDDYMVTLFCPVCSVCQLKRDIN 104          
BLAST of Placenta specific protein 8 vs. UniProt/SwissProt
Match: sp|Q6DK99|CNFNB_XENLA (Cornifelin homolog B OS=Xenopus laevis OX=8355 GN=cnfn-b PE=3 SV=1)

HSP 1 Score: 64.3142 bits (155), Expect = 2.732e-12
Identity = 38/97 (39.18%), Postives = 56/97 (57.73%), Query Frame = 2
Query:  206 QPVIQYGGREWSSSLCSCFDDMESCCCVFLVAPCYLCCLYSK-YGECCCTPMIVPGADMALRIQHRNRHKIQGTILNDCCVSVFCGFCSMCQVKRDM 493
            Q  +     +W+S +  C +DM +C C   V PC L C  SK YGECCC P +  G+ +A+R   R R+ I+G+I ND     FC  C++CQ+ R++
Sbjct:   13 QGYMSSNSSQWNSDVFDCCEDMGTCLCGTFV-PCILACKVSKDYGECCCLPCLF-GSVLAVRTGIRERYHIEGSICNDWVCLSFCAPCTLCQMAREL 107          
BLAST of Placenta specific protein 8 vs. TrEMBL
Match: A0A0P0DI19 (Placenta specific protein 8 OS=Dugesia japonica OX=6161 GN=Plac 8 PE=2 SV=1)

HSP 1 Score: 125.561 bits (314), Expect = 2.745e-33
Identity = 64/123 (52.03%), Postives = 85/123 (69.11%), Query Frame = 2
Query:  155 IYQQQPQMTSNQTVIIQQPVIQYGGREWSSSLCSCFDDMESCCCVFLVAPCYLCCLYSKYGECCCTPMIVPGADMALRIQHRNRHKIQGTILNDCCVSVFCGFCSMCQVKRDMDYVINTKGSL 523
            +  +QP  TS + V+I QP  +   R WSS +CSCF+D+E C        CYLCC+Y +Y EC C+ ++VP + MALRIQHRNRH I+GTI +DC  S   G C+MCQ+KRDM ++I+TKGSL
Sbjct:   13 VVNKQPGKTS-ENVVISQPKSE---RMWSSEICSCFEDIEICLWSTFFPQCYLCCMYMEYNECFCSSLLVPNSLMALRIQHRNRHGIKGTICDDCIKSTCYGPCTMCQLKRDMKHIISTKGSL 131          
BLAST of Placenta specific protein 8 vs. TrEMBL
Match: G7Y8A7 (PLAC8-like protein 1 OS=Clonorchis sinensis OX=79923 GN=CLF_102652 PE=4 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 1.450e-32
Identity = 60/145 (41.38%), Postives = 89/145 (61.38%), Query Frame = 2
Query:  101 NETAPPYSQQPQMQFTSP---IYQQQPQMTSNQTVIIQ-QPVIQYGGREWSSSLCSCFDDMESCCCVFLVAPCYLCCLYSKYGECCCTPMIVPGADMALRIQHRNRHKIQGTILNDCCVSVFCGFCSMCQVKRDMDYVINTKGSL 523
            +E  P Y  + Q  F SP   +YQ  P + +   ++ Q +PV+  G R+W   LC C ++  +C    L  PC +C +Y  YGECCCTP++VP ADM L ++HR+RH+I G++  DCC  + CG C++C++ RDM +V   KGSL
Sbjct:   16 SEAKPLYPTEMQPAFPSPAQPLYQTPPAVPTVNVIVEQPKPVVSEGYRDWKDGLCDCGNNCGNCILTALFYPCMVCHMYKLYGECCCTPLVVPMADMVLSVKHRSRHRIVGSVAGDCCTFMCCGPCALCRLYRDMTFVEALKGSL 160          
BLAST of Placenta specific protein 8 vs. TrEMBL
Match: A0A4V3SFF2 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_004386 PE=4 SV=1)

HSP 1 Score: 119.398 bits (298), Expect = 1.764e-30
Identity = 59/144 (40.97%), Postives = 85/144 (59.03%), Query Frame = 2
Query:  101 NETAPPYSQQPQMQFTSPI-YQQQPQMTSNQTVIIQQP--VIQYGGREWSSSLCSCFDDMESCCCVFLVAPCYLCCLYSKYGECCCTPMIVPGADMALRIQHRNRHKIQGTILNDCCVSVFCGFCSMCQVKRDMDYVINTKGSL 523
            +E  P Y  Q Q  + SP    Q P       V+++QP  V+  G R+W   LC C ++  +C    L  PC  C +Y +YGECCCTP++VP A M L ++HR+RH+I G++  DCC  + CG C++C++ RDM +V   KGSL
Sbjct:   16 SEAEPIYPTQMQPVYPSPTQLYQTPPAVPTVNVVVEQPKAVVSEGYRDWKDGLCDCGNNCGNCILTTLFYPCVECHMYKRYGECCCTPLVVPMAGMVLSVKHRSRHRIVGSVAGDCCTFLCCGPCALCRLYRDMVFVEAIKGSL 159          
BLAST of Placenta specific protein 8 vs. TrEMBL
Match: A0A4Z2DCA3 (Cornifelin OS=Schistosoma japonicum OX=6182 GN=EWB00_002377 PE=4 SV=1)

HSP 1 Score: 109.383 bits (272), Expect = 3.523e-27
Identity = 57/116 (49.14%), Postives = 77/116 (66.38%), Query Frame = 2
Query:  176 MTSNQTVIIQQPVI---QYGGREWSSSLCSCFDDMESCCCVFLVAPCYLCCLYSKYGECCCTPMIVPGADMALRIQHRNRHKIQGTILNDCCVSVFCGFCSMCQVKRDMDYVINTK 514
            M +NQ V+  QPV    Q   REW+S LC+CFDD+ +CC V     CY+C LY+K GE C  P    G  + LRI+HR  HKI GT++ND C++ FCG  ++CQ+KRD+DYV +T+
Sbjct:    1 METNQPVV-HQPVAMQRQTFEREWNSGLCACFDDLPTCCLVLFCPQCYMCYLYNKEGESCWVPFCGAGI-LPLRIKHRIMHKIMGTLINDVCITCFCGPLAVCQLKRDIDYVKSTR 114          
BLAST of Placenta specific protein 8 vs. TrEMBL
Match: A0A3Q0KMC6 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 105.531 bits (262), Expect = 1.189e-25
Identity = 52/114 (45.61%), Postives = 73/114 (64.04%), Query Frame = 2
Query:  182 SNQTVIIQQPVI---QYGGREWSSSLCSCFDDMESCCCVFLVAPCYLCCLYSKYGECCCTPMIVPGADMALRIQHRNRHKIQGTILNDCCVSVFCGFCSMCQVKRDMDYVINTK 514
             N + ++QQP     Q   REWSS LC+CFDD+ +CC V     CY+C LY+K GE C  P+   G  + LRI+HR  H+I GT++ND C + FCG  ++CQ+KRD+DY  + +
Sbjct:    2 ENSSPVVQQPTSIQRQTSEREWSSGLCACFDDLPTCCLVLFCPHCYMCYLYNKEGESCWIPVCGAGI-LPLRIKHRIMHEIMGTLMNDVCTTCFCGQLAICQLKRDIDYTKSIR 114          
BLAST of Placenta specific protein 8 vs. Ensembl Cavefish
Match: ponzr2 (cornifelin homolog [Source:NCBI gene;Acc:103025611])

HSP 1 Score: 84.7297 bits (208), Expect = 2.205e-20
Identity = 48/144 (33.33%), Postives = 75/144 (52.08%), Query Frame = 2
Query:  134 QMQFTSPIYQQQPQMTSNQTVIIQQPVIQYGGR---EWSSSLCSCFDDMESCCCVFLVAPCYLCCLYSKYGECCCTPM-----IVPGADMALRIQHRNRHKIQGTILNDCCVSVFCGFCSMCQVKRDMD------YVINTKGSL 523
            Q +  S        MT+   V+I  P +    R   EW S +C C DD+  CC  F   PC+ C    +YG+C C P+     IVP A +++R+  R+R+ I+GT+ NDC ++  C  C+ CQ+ R+M+       +IN + +L
Sbjct:   27 QTKSASGASANHSAMTTK--VVITPPSMVLESRVSDEWGSGICDCCDDVPECCFAFWCCPCFACIKTKEYGQCLCLPLLDICGIVPAATLSMRVSMRHRYGIKGTLCNDCLIATCCTSCAWCQMSREMNKRSIPIALINARPTL 168          
BLAST of Placenta specific protein 8 vs. Ensembl Cavefish
Match: ponzr2 (cornifelin homolog [Source:NCBI gene;Acc:103025611])

HSP 1 Score: 83.1889 bits (204), Expect = 9.757e-20
Identity = 44/124 (35.48%), Postives = 69/124 (55.65%), Query Frame = 2
Query:  194 VIIQQPVIQYGGR---EWSSSLCSCFDDMESCCCVFLVAPCYLCCLYSKYGECCCTPM-----IVPGADMALRIQHRNRHKIQGTILNDCCVSVFCGFCSMCQVKRDMD------YVINTKGSL 523
            V+I  P +    R   EW S +C C DD+  CC  F   PC+ C    +YG+C C P+     IVP A +++R+  R+R+ I+GT+ NDC ++  C  C+ CQ+ R+M+       +IN + +L
Sbjct:   49 VVITPPSMVLESRVSDEWGSGICDCCDDVPECCFAFWCCPCFACIKTKEYGQCLCLPLLDICGIVPAATLSMRVSMRHRYGIKGTLCNDCLIATCCTSCAWCQMSREMNKRSIPIALINARPTL 172          
BLAST of Placenta specific protein 8 vs. Ensembl Cavefish
Match: ponzr6 (cornifelin homolog [Source:NCBI gene;Acc:103028345])

HSP 1 Score: 81.2629 bits (199), Expect = 1.993e-19
Identity = 45/117 (38.46%), Postives = 64/117 (54.70%), Query Frame = 2
Query:  182 SNQTVIIQ----QPVIQYGGREWSSSLCSCFDDMESCCCVFLVAPCYLCCLYSKYGECCCTPMI-------VPGADMALRIQHRNRHKIQGTILNDCCVSVFCGFCSMCQVKRDMDY 499
            +N TVI+Q    QP       +WSS +C C +DM  CC  F    C +C    KYGEC C P++       +P    ++R   R R+ IQG++ +DCCVS  CG C+ CQ+ R++ Y
Sbjct:    2 ANPTVIVQPVAFQPPDNQRIVQWSSGICDCCEDMGICCFGFWCPYCLMCNTTKKYGECMCLPLVELCFGGLIPPVTYSMRSSMRERYHIQGSMCDDCCVSTCCGICAWCQIARELKY 118          
BLAST of Placenta specific protein 8 vs. Ensembl Cavefish
Match: ponzr6 (cornifelin homolog [Source:NCBI gene;Acc:103028345])

HSP 1 Score: 80.8777 bits (198), Expect = 2.138e-19
Identity = 45/117 (38.46%), Postives = 64/117 (54.70%), Query Frame = 2
Query:  182 SNQTVIIQ----QPVIQYGGREWSSSLCSCFDDMESCCCVFLVAPCYLCCLYSKYGECCCTPMI-------VPGADMALRIQHRNRHKIQGTILNDCCVSVFCGFCSMCQVKRDMDY 499
            +N TVI+Q    QP       +WSS +C C +DM  CC  F    C +C    KYGEC C P++       +P    ++R   R R+ IQG++ +DCCVS  CG C+ CQ+ R++ Y
Sbjct:    2 ANPTVIVQPVAFQPPDNQRIVQWSSGICDCCEDMGICCFGFWCPYCLMCNTTKKYGECMCLPLVELCFGGLIPPVTYSMRSSMRERYHIQGSMCDDCCVSTCCGICAWCQIARELKY 118          
BLAST of Placenta specific protein 8 vs. Ensembl Cavefish
Match: ponzr6 (cornifelin homolog [Source:NCBI gene;Acc:103028345])

HSP 1 Score: 81.6481 bits (200), Expect = 2.152e-19
Identity = 45/117 (38.46%), Postives = 64/117 (54.70%), Query Frame = 2
Query:  182 SNQTVIIQ----QPVIQYGGREWSSSLCSCFDDMESCCCVFLVAPCYLCCLYSKYGECCCTPMI-------VPGADMALRIQHRNRHKIQGTILNDCCVSVFCGFCSMCQVKRDMDY 499
            +N TVI+Q    QP       +WSS +C C +DM  CC  F    C +C    KYGEC C P++       +P    ++R   R R+ IQG++ +DCCVS  CG C+ CQ+ R++ Y
Sbjct:    2 ANPTVIVQPVAFQPPDNQRIVQWSSGICDCCEDMGICCFGFWCPYCLMCNTTKKYGECMCLPLVELCFGGLIPPVTYSMRSSMRERYHIQGSMCDDCCVSTCCGICAWCQIARELKY 118          
BLAST of Placenta specific protein 8 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009354.1 (pep scaffold:Pmarinus_7.0:GL483774:7229:14014:-1 gene:ENSPMAG00000008464.1 transcript:ENSPMAT00000009354.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 82.0333 bits (201), Expect = 1.651e-20
Identity = 44/109 (40.37%), Postives = 59/109 (54.13%), Query Frame = 2
Query:  194 VIIQQPVIQY----GGREWSSSLCSCFDDMESCCCVFLVAPCYLCCLYSKYGECCCTPMIVPGADMALRIQHRNRHKIQGTILNDCCVSVFCGFCSMCQVKRDMDYVIN 508
            V++ QPV       G  +WSS +  CF D E C C F   P   C + S +GEC C PM+ PGA MALR   R RH I+GT+ +D      C  C+ CQ+ R++ +  N
Sbjct:    5 VLVTQPVAHTVNVQGQAQWSSHMMDCFQDTEICVCGFFCLPLLQCKVASDFGECFCVPML-PGALMALRTGIRERHHIEGTVFDDFVSLWCCNHCTTCQMARELRHQKN 112          
BLAST of Placenta specific protein 8 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001184.1 (pep scaffold:Pmarinus_7.0:GL488356:6425:7851:-1 gene:ENSPMAG00000001063.1 transcript:ENSPMAT00000001184.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 55.0694 bits (131), Expect = 1.006e-10
Identity = 28/65 (43.08%), Postives = 41/65 (63.08%), Query Frame = 2
Query:  305 CYLCCLYSKYGECCCTPMIVPGADMALRIQHRNRHKIQGTILNDCCVSVFCGFCSMCQVKRDMDY 499
            C  C +   +GEC C P I+PG+ MALR   R R+ IQG+I +DC +  FC  C+ CQ+ R++ +
Sbjct:   20 CLNCRMAKDFGECFCLP-ILPGSSMALRTAIRERYHIQGSICDDCVMLTFCFCCATCQMAREIKH 83          
BLAST of Placenta specific protein 8 vs. Ensembl Nematostella
Match: EDO42612 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0W1])

HSP 1 Score: 54.6842 bits (130), Expect = 7.907e-10
Identity = 35/92 (38.04%), Postives = 53/92 (57.61%), Query Frame = 2
Query:  230 REWSSSLCSCFDDMESCCCVFLVAPCYLCCLYS-KYGECCCTPMIVPGADMALRIQHRNRHKIQGTILNDCCVSVFCGFCSMCQVKRDMDYV 502
            R+W S +C CFDD+ SC   +   PC+L    S + GE CC P   PGA + LR++ R    IQG+++ND C       C +CQ+ R++ ++
Sbjct:   52 RDWHSGMCGCFDDIGSCLLGYF-CPCFLLIDVSQRMGEGCCFPCCCPGALVGLRVKLRVEQNIQGSLINDYCAVQCLPLCVLCQLSRELKHL 142          
BLAST of Placenta specific protein 8 vs. Ensembl Nematostella
Match: EDO42647 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0V8])

HSP 1 Score: 53.1434 bits (126), Expect = 1.678e-9
Identity = 33/96 (34.38%), Postives = 47/96 (48.96%), Query Frame = 2
Query:  230 REWSSSLCSCFDDMESCCCVFLVAPCYLCCLYSKYGE-----CCCTPMIVPGADMALRIQHRNRHKIQGTILNDCCVSVFCGFCSMCQVKRDMDYV 502
            R+WSS L  C  D+  C   FL     LC +  + GE     CCC  +    A   LR + R    IQG++ ND      C  C++CQ+ R++D+V
Sbjct:   28 RDWSSGLFECTKDIGGCLVTFLCPCVTLCQISQRMGEGLAYGCCCADI----AAFTLRAKLRTEQNIQGSLCNDAIHVSCCMHCALCQMSRELDHV 119          
BLAST of Placenta specific protein 8 vs. Ensembl Nematostella
Match: EDO50068 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFB0])

HSP 1 Score: 46.2098 bits (108), Expect = 5.603e-7
Identity = 28/94 (29.79%), Postives = 46/94 (48.94%), Query Frame = 2
Query:  230 REWSSSLCSCFDDMESCCCVFLVAPCYLCCLYSKYGEC-------CCTPMIVPGADM----ALRIQHRNRHKIQGTILNDCCVSVFCGFCSMCQ 478
             +W++ L  CF+D  +C   + +APCY    + K  E        C     VP  D+    ++R + R +H I G+ + DC  ++ C FCS+ Q
Sbjct:    3 NDWNNGLFGCFNDCGTCLITY-IAPCYT---FGKNAEAVGDSCLLCGLAFFVPVVDLIVMSSVRGKIREQHGISGSFIGDCAATICCPFCSLVQ 92          
BLAST of Placenta specific protein 8 vs. Ensembl Nematostella
Match: EDO44794 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUR8])

HSP 1 Score: 42.743 bits (99), Expect = 9.594e-6
Identity = 28/97 (28.87%), Postives = 46/97 (47.42%), Query Frame = 2
Query:  236 WSSSLCSCFDDMESCCCVFLVAPCYLCCLYSK-YGECCCTPMIVP---------GADMALRIQHRNRHKIQGTILNDCCVSVFCGFCSMCQVKRDMD 496
            WSS +C CF+D+ +C   +   PC +    ++  GE C     +          GA +  +I  R +H I+G+  NDC +  FC  C+  Q  R++ 
Sbjct:    3 WSSGICGCFEDINTCALTYFC-PCVVAGKNAEAVGENCFLHGFLSTLGCVGIFCGAKIREKI--REKHGIEGSFGNDCIMHWFCPLCAYSQEARELK 96          
BLAST of Placenta specific protein 8 vs. Ensembl Medaka
Match: ponzr3 (cornifelin homolog A [Source:NCBI gene;Acc:101160195])

HSP 1 Score: 89.3521 bits (220), Expect = 1.001e-22
Identity = 46/110 (41.82%), Postives = 60/110 (54.55%), Query Frame = 2
Query:  191 TVIIQQP---VIQYGGREWSSSLCSCFDDMESCCCVFLVAPCYLCCLYSKYGECCCTPMI-----VPGADMALRIQHRNRHKIQGTILNDCCVSVFCGFCSMCQVKRDMD 496
            TV   QP   +      EWSS +C CFDD+ SCC  F   PC+ C    K GEC C P++     +P    A+R+  R ++ I+GTI  DC  S FCG CS CQ+ R+M 
Sbjct:    4 TVKTTQPRPYITTSTSNEWSSGICDCFDDLRSCCFAFWCFPCFACITSKKAGECLCLPLLDGFGCIPPITTAMRVSIRKQYGIEGTICRDCVFSFFCGPCSWCQISREMK 113          
BLAST of Placenta specific protein 8 vs. Ensembl Medaka
Match: ENSORLT00000045016.1 (cornifelin homolog B [Source:NCBI gene;Acc:101159215])

HSP 1 Score: 66.6254 bits (161), Expect = 1.096e-13
Identity = 47/152 (30.92%), Postives = 67/152 (44.08%), Query Frame = 2
Query:  185 NQTVIIQ-QPVIQ-YGGREWSSSLCSCFDDMESCCCVFLVAPCYLCCLYSKYGECCCTPM-------IVPGADMALRIQHRNRHKI-------------------------QGTILNDCCVSVFCGFCSMCQVKRDMD------YVINTKGS 520
            ++ VI Q QPV++    +EW+S +C CF D+  CC  F   PC+ C    K+GE  C P+       ++P   +A R+  R+R  I                         QGTI  DC  S FC  C  CQ+ R+M        +IN K +
Sbjct:    2 SKLVISQPQPVMESRDSQEWTSEVCDCFKDLPQCCFAFWCFPCFACITSKKFGEPLCLPLLEFCFGGLIPPITLATRVSMRHRFGIKVSRSLTGGFLQPHVLHDLNPVCGLQGTICRDCVYSTFCTPCVWCQMAREMKSREITVVMINAKNT 153          
BLAST of Placenta specific protein 8 vs. Ensembl Medaka
Match: ENSORLT00000037158.1 (cornifelin homolog B [Source:NCBI gene;Acc:101174737])

HSP 1 Score: 63.5438 bits (153), Expect = 9.284e-13
Identity = 37/110 (33.64%), Postives = 56/110 (50.91%), Query Frame = 2
Query:  212 VIQYGGREWSSSLCSCFDDMESCCCVFLVAPCYLCCLYSKYGECCC----------------TPMIVPGADMALRIQHRNRHKIQGTILNDCCVSVFCGFCSMCQVKRDM 493
            V++   R W+S L SC DDM SCC  F   PC  C +   +GE  C                 P+ VP A ++LR+  R+ + I+G++  D   S FC +C+ CQ+ R++
Sbjct:    6 VLKKFHRTWNSGLLSCCDDMNSCCYGFWCCPCLACTVAGSFGENRCLPLCDICSPTAFSSFGIPLCVPPAGLSLRVGIRHMYGIKGSLCRDIATSCFCVWCNWCQMHREL 115          
BLAST of Placenta specific protein 8 vs. Ensembl Medaka
Match: ENSORLT00000028572.1 (cornifelin homolog [Source:NCBI gene;Acc:101172524])

HSP 1 Score: 63.1586 bits (152), Expect = 9.764e-13
Identity = 41/116 (35.34%), Postives = 55/116 (47.41%), Query Frame = 2
Query:  146 TSPIYQQQPQMTSNQTVIIQQPVIQYGGREWSSSLCSCFDDMESCCCVFLVAPCYLCCLYSKYGECCCTPMIVPGADMALRIQHRNRHKIQGTILNDCCVSVFCGFCSMCQVKRDM 493
            ++P+   QP      T +      Q G  EWS+ LCSCF+D   C   F       C    KYGE  C    VPG   A+R   R  + IQGT+ ND  +   CG C MC++ R++
Sbjct:    2 SNPVVTHQPGAGGYGTNV------QTG--EWSTGLCSCFNDCLICALGFFCPAGLSCYTAHKYGENFCLG-CVPGGMTAMRTHMRLTYGIQGTVCNDAIMVFCCGLCEMCRMAREI 108          
BLAST of Placenta specific protein 8 vs. Ensembl Medaka
Match: ENSORLT00000033288.1 (cornifelin homolog B [Source:NCBI gene;Acc:101174737])

HSP 1 Score: 63.1586 bits (152), Expect = 1.065e-12
Identity = 36/109 (33.03%), Postives = 55/109 (50.46%), Query Frame = 2
Query:  215 IQYGGREWSSSLCSCFDDMESCCCVFLVAPCYLCCLYSKYGECCC----------------TPMIVPGADMALRIQHRNRHKIQGTILNDCCVSVFCGFCSMCQVKRDM 493
            + +   EW+S L SC DDM SCC  F   PC  C +   +GE  C                 P+ VP A ++LR+  R+ + I+G++  D   S FC +C+ CQ+ R++
Sbjct:    1 MSHKSSEWNSGLLSCCDDMNSCCYGFWCCPCLACTVAGSFGENRCLPLCDICSPTAFSSFGIPLCVPPAGLSLRVGIRHMYGIKGSLCRDIATSCFCVWCNWCQMHREL 109          
BLAST of Placenta specific protein 8 vs. Planmine SMEST
Match: SMESG000050229.1 (SMESG000050229.1)

HSP 1 Score: 162.925 bits (411), Expect = 3.440e-51
Identity = 86/150 (57.33%), Postives = 98/150 (65.33%), Query Frame = 2
Query:   80 SN*F*IMNETAPPYSQQPQMQFTSPIYQQQPQMTSNQTVIIQQPVIQYGGREWSSSLCSCFDDMESCCCVFLVAPCYLCCLYSKYGECCCTPMIVPGADMALRIQHRNRHKIQGTILNDCCVSVFCGFCSMCQVKRDMDYVINTKGSLYL 529
            SN F   ++   P  QQP       +   QP      TVIIQQP I  GGR WSS +CSCFDDMESCCCV L   CY   LYS+YGECCC+   VP A  ALRIQHRNRHKI G+ILND C +VFC   S CQ+KRDMDYV+ TKG+L +
Sbjct:    8 SNKFNSADDANEPILQQPPAY--PGVSVGQPSYPGQTTVIIQQPNISSGGRLWSSGICSCFDDMESCCCVMLCPTCYTARLYSRYGECCCSSCCVPNALFALRIQHRNRHKISGSILNDMCTAVFCYCLSACQMKRDMDYVVATKGTLAM 155          
BLAST of Placenta specific protein 8 vs. Planmine SMEST
Match: SMESG000050221.1 (SMESG000050221.1)

HSP 1 Score: 156.377 bits (394), Expect = 1.212e-48
Identity = 79/141 (56.03%), Postives = 98/141 (69.50%), Query Frame = 2
Query:  146 TSPIYQQQPQ---MTSNQT----------VIIQQPVIQYGGREWSSSLCSCFDDMESCCCVFLVAPCYLCCLYSKYGECCCTPMIVPGADMALRIQHRNRHKIQGTILNDCCVSVFCGFCSMCQVKRDMDYVINTKGSLYL 529
            T PI QQ P+   ++++QT          VIIQQP I  GGR WSS +CSCFDDMESCCC  L+  CY+  LYS+Y EC C+   +P A  ALRIQHRNRHK+ GTILNDC  + +C  C++CQ+KRDMDYV+ TKGSL +
Sbjct:   11 TDPILQQPPEYPGISTHQTSYVGNHGQTTVIIQQPSISTGGRLWSSGICSCFDDMESCCCTILLPTCYIGRLYSRYNECICSSCCIPNALFALRIQHRNRHKVSGTILNDCMTASWCYLCAVCQLKRDMDYVVATKGSLAM 151          
BLAST of Placenta specific protein 8 vs. Planmine SMEST
Match: SMESG000050216.1 (SMESG000050216.1)

HSP 1 Score: 147.902 bits (372), Expect = 2.133e-45
Identity = 80/142 (56.34%), Postives = 94/142 (66.20%), Query Frame = 2
Query:  104 ETAPPYSQQPQMQFTSPIYQQQPQMTSNQTVIIQQPVIQYGGREWSSSLCSCFDDMESCCCVFLVAPCYLCCLYSKYGECCCTPMIVPGADMALRIQHRNRHKIQGTILNDCCVSVFCGFCSMCQVKRDMDYVINTKGSLYL 529
            E  P Y  + Q     P+ Q QP      TVI+QQ     GGR+WSS +CSC DDMESCCCVF     Y   L SKYGECCC   ++P   MALRIQHRNRHKI G +LNDCC S++CG C +CQ+KRDMDYV+ TKG+L L
Sbjct:   10 EKPPGYGGEFQ-----PVIQNQPYAGGQTTVIVQQTTQNIGGRDWSSPMCSCCDDMESCCCVFFFGCFYTQYLMSKYGECCCAACLIPAPVMALRIQHRNRHKIMGNMLNDCCTSLYCGLCVLCQIKRDMDYVLATKGTLEL 146          
BLAST of Placenta specific protein 8 vs. Planmine SMEST
Match: SMESG000050210.1 (SMESG000050210.1)

HSP 1 Score: 140.584 bits (353), Expect = 1.137e-42
Identity = 78/137 (56.93%), Postives = 95/137 (69.34%), Query Frame = 2
Query:  131 PQMQFTS-PIYQQQPQMTS----NQTVIIQQPVIQYGGREWSSSLCSCFDDMESCCCVFLVAPCYLCCLYSKYGECCCTPMIVPGADMALRIQHRNRHKIQGTILNDCCVSVFCGFCSMCQVKRDMDYVINTKGSLY 526
            PQ Q T  P+  Q  Q+ S     QTVIIQQ       R+W+S LC+C DDMESCCCV     CYLC +Y +Y ECCCT  +V  + M LRIQHRNRHKI G+ILNDCC ++ C  CS+CQ+KRDM+YVI+TKGSL+
Sbjct:    4 PQNQATVFPVVTQPAQVFSLQSVPQTVIIQQQA--ENKRQWNSGLCACIDDMESCCCVAFCPYCYLCHMYCQYDECCCTACLVGCSPMILRIQHRNRHKIMGSILNDCCTTLCCMQCSICQLKRDMNYVISTKGSLH 138          
BLAST of Placenta specific protein 8 vs. Planmine SMEST
Match: SMESG000050208.1 (SMESG000050208.1)

HSP 1 Score: 135.576 bits (340), Expect = 1.112e-40
Identity = 70/120 (58.33%), Postives = 82/120 (68.33%), Query Frame = 2
Query:  167 QPQMTSNQTVIIQQPVIQYG-GREWSSSLCSCFDDMESCCCVFLVAPCYLCCLYSKYGECCCTPMIVPGADMALRIQHRNRHKIQGTILNDCCVSVFCGFCSMCQVKRDMDYVINTKGSL 523
            QP M   QTVI  Q  I     R WSS LC+CFDD+ESCCCV     CY+C LY +Y ECCCT   + G  + L +QHRNRHKIQGTI NDC  S  C  CS+C++KRDMD+V+NTKGSL
Sbjct:   12 QPAMVIPQTVITTQQFITTSLVRNWSSGLCACFDDLESCCCVMCFPHCYVCHLYMRYDECCCTGCCLMGNPIYLAVQHRNRHKIQGTIFNDCLESFLCYQCSICRLKRDMDHVMNTKGSL 131          
The following BLAST results are available for this feature:
BLAST of Placenta specific protein 8 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PLAC8L14.669e-1437.61PLAC8 like 1 [Source:HGNC Symbol;Acc:HGNC:31746][more]
CNFN2.756e-1234.48cornifelin [Source:HGNC Symbol;Acc:HGNC:30183][more]
CNFN2.756e-1234.48cornifelin [Source:HGNC Symbol;Acc:HGNC:30183][more]
PLAC83.572e-1131.43placenta associated 8 [Source:HGNC Symbol;Acc:HGNC... [more]
PLAC83.572e-1131.43placenta associated 8 [Source:HGNC Symbol;Acc:HGNC... [more]
back to top
BLAST of Placenta specific protein 8 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Placenta specific protein 8 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Placenta specific protein 8 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ponzr57.289e-2138.53plac8 onzin related protein 5 [Source:ZFIN;Acc:ZDB... [more]
ponzr57.573e-2138.53plac8 onzin related protein 5 [Source:ZFIN;Acc:ZDB... [more]
ponzr23.397e-1840.71plac8 onzin related protein 2 [Source:ZFIN;Acc:ZDB... [more]
ponzr23.397e-1840.71plac8 onzin related protein 2 [Source:ZFIN;Acc:ZDB... [more]
ponzr31.864e-1737.96plac8 onzin related protein 3 [Source:ZFIN;Acc:ZDB... [more]
back to top
BLAST of Placenta specific protein 8 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000008293.11.189e-1738.60novel protein similar to cornifelin [Source:NCBI g... [more]
ifi351.308e-1738.60interferon induced protein 35 [Source:Xenbase;Acc:... [more]
ifi352.283e-1540.91interferon induced protein 35 [Source:Xenbase;Acc:... [more]
eps15l12.141e-1436.29epidermal growth factor receptor pathway substrate... [more]
myo193.388e-1438.20myosin XIX [Source:Xenbase;Acc:XB-GENE-999897][more]
back to top
BLAST of Placenta specific protein 8 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Plac8l14.167e-1533.81PLAC8-like 1 [Source:MGI Symbol;Acc:MGI:1916651][more]
Plac82.552e-1336.70placenta-specific 8 [Source:MGI Symbol;Acc:MGI:244... [more]
Plac82.552e-1336.70placenta-specific 8 [Source:MGI Symbol;Acc:MGI:244... [more]
Plac82.552e-1336.70placenta-specific 8 [Source:MGI Symbol;Acc:MGI:244... [more]
Cnfn7.619e-1335.63cornifelin [Source:MGI Symbol;Acc:MGI:1919633][more]
back to top
BLAST of Placenta specific protein 8 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q08EJ0|PL8L1_MOUSE2.915e-1433.81PLAC8-like protein 1 OS=Mus musculus OX=10090 GN=P... [more]
sp|A1L4L8|PL8L1_HUMAN2.242e-1337.61PLAC8-like protein 1 OS=Homo sapiens OX=9606 GN=PL... [more]
sp|Q0VBW2|CNFN_BOVIN3.230e-1337.93Cornifelin OS=Bos taurus OX=9913 GN=CNFN PE=3 SV=1[more]
sp|Q9JI48|PLAC8_MOUSE1.785e-1236.70Placenta-specific gene 8 protein OS=Mus musculus O... [more]
sp|Q6DK99|CNFNB_XENLA2.732e-1239.18Cornifelin homolog B OS=Xenopus laevis OX=8355 GN=... [more]
back to top
BLAST of Placenta specific protein 8 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0P0DI192.745e-3352.03Placenta specific protein 8 OS=Dugesia japonica OX... [more]
G7Y8A71.450e-3241.38PLAC8-like protein 1 OS=Clonorchis sinensis OX=799... [more]
A0A4V3SFF21.764e-3040.97Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A4Z2DCA33.523e-2749.14Cornifelin OS=Schistosoma japonicum OX=6182 GN=EWB... [more]
A0A3Q0KMC61.189e-2545.61Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
back to top
BLAST of Placenta specific protein 8 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ponzr22.205e-2033.33cornifelin homolog [Source:NCBI gene;Acc:103025611... [more]
ponzr29.757e-2035.48cornifelin homolog [Source:NCBI gene;Acc:103025611... [more]
ponzr61.993e-1938.46cornifelin homolog [Source:NCBI gene;Acc:103028345... [more]
ponzr62.138e-1938.46cornifelin homolog [Source:NCBI gene;Acc:103028345... [more]
ponzr62.152e-1938.46cornifelin homolog [Source:NCBI gene;Acc:103028345... [more]
back to top
BLAST of Placenta specific protein 8 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000009354.11.651e-2040.37pep scaffold:Pmarinus_7.0:GL483774:7229:14014:-1 g... [more]
ENSPMAT00000001184.11.006e-1043.08pep scaffold:Pmarinus_7.0:GL488356:6425:7851:-1 ge... [more]
back to top
BLAST of Placenta specific protein 8 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Placenta specific protein 8 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO426127.907e-1038.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO426471.678e-934.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO500685.603e-729.79Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO447949.594e-628.87Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Placenta specific protein 8 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ponzr31.001e-2241.82cornifelin homolog A [Source:NCBI gene;Acc:1011601... [more]
ENSORLT00000045016.11.096e-1330.92cornifelin homolog B [Source:NCBI gene;Acc:1011592... [more]
ENSORLT00000037158.19.284e-1333.64cornifelin homolog B [Source:NCBI gene;Acc:1011747... [more]
ENSORLT00000028572.19.764e-1335.34cornifelin homolog [Source:NCBI gene;Acc:101172524... [more]
ENSORLT00000033288.11.065e-1233.03cornifelin homolog B [Source:NCBI gene;Acc:1011747... [more]
back to top
BLAST of Placenta specific protein 8 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000050229.13.440e-5157.33SMESG000050229.1[more]
SMESG000050221.11.212e-4856.03SMESG000050221.1[more]
SMESG000050216.12.133e-4556.34SMESG000050216.1[more]
SMESG000050210.11.137e-4256.93SMESG000050210.1[more]
SMESG000050208.11.112e-4058.33SMESG000050208.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028199 ID=SMED30028199|Name=Placenta specific protein 8|organism=Schmidtea mediterranea sexual|type=transcript|length=631bp
CCAATCAAAATCAAGGAACCCATTTAATTCAAAACCAATTTACTTTGTGT
ACTTTCTGATAGTGAGTTTTACGAAAATTTCAAACTAATTTTAAATAATG
AATGAAACTGCCCCACCTTATAGTCAACAACCACAAATGCAATTTACAAG
TCCAATTTATCAACAGCAGCCTCAGATGACATCCAACCAGACTGTGATTA
TACAACAACCCGTGATTCAATATGGCGGGCGAGAATGGAGTTCTTCATTG
TGTTCATGTTTCGACGACATGGAGTCATGTTGTTGTGTGTTTCTTGTGGC
ACCATGCTATTTGTGCTGCTTGTATTCAAAATATGGGGAATGTTGCTGCA
CTCCTATGATAGTTCCAGGAGCTGATATGGCATTAAGAATTCAACATCGA
AATAGACATAAAATTCAAGGTACCATTTTGAATGACTGTTGTGTCAGTGT
CTTTTGTGGATTTTGTTCCATGTGCCAGGTGAAACGAGACATGGATTATG
TAATAAACACAAAAGGATCTTTGTATCTATAATGCTTCTTATAAGAAACT
GACCAATAACATTTATGTTTGATTATTTATTATAATTGTCTTATATTTCA
TATTAAATACAATGGTTTTCTTCAAAAAAAA
back to top

protein sequence of SMED30028199-orf-1

>SMED30028199-orf-1 ID=SMED30028199-orf-1|Name=SMED30028199-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=145bp
MNETAPPYSQQPQMQFTSPIYQQQPQMTSNQTVIIQQPVIQYGGREWSSS
LCSCFDDMESCCCVFLVAPCYLCCLYSKYGECCCTPMIVPGADMALRIQH
RNRHKIQGTILNDCCVSVFCGFCSMCQVKRDMDYVINTKGSLYL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR006461PLAC_motif_containing
Vocabulary: molecular function
TermDefinition
GO:0003682chromatin binding
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
Vocabulary: biological process
TermDefinition
GO:0008284positive regulation of cell proliferation
GO:0009409response to cold
GO:0040015negative regulation of multicellular organism growth
GO:0042742defense response to bacterium
GO:0043066negative regulation of apoptotic process
GO:0045944positive regulation of transcription from RNA polymerase II promoter
GO:0050873brown fat cell differentiation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006461PLAC8 motif-containing proteinPFAMPF04749PLAC8coord: 47..130
e-value: 1.8E-12
score: 48.1
IPR006461PLAC8 motif-containing proteinTIGRFAMTIGR01571TIGR01571coord: 45..132
e-value: 8.8E-15
score: 53.3
IPR006461PLAC8 motif-containing proteinPANTHERPTHR15907FAMILY NOT NAMEDcoord: 26..134
NoneNo IPR availablePANTHERPTHR15907:SF93PLACENTA-SPECIFIC 8, TANDEM DUPLICATE 1-RELATEDcoord: 26..134