MFS_1_like domain-containing protein

Overview
NameMFS_1_like domain-containing protein
Smed IDSMED30028189
Length (bp)1845
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of MFS_1_like domain-containing protein (SMED30028189) t-SNE clustered cells

Violin plots show distribution of expression levels for MFS_1_like domain-containing protein (SMED30028189) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of MFS_1_like domain-containing protein (SMED30028189) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for MFS_1_like domain-containing protein (SMED30028189) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028189

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30028189SMESG000030270.1 SmedASXL_014429SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30028189SMESG000030270.1 dd_Smed_v6_9284_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of MFS_1_like domain-containing protein vs. Ensembl Human
Match: MFSD6 (major facilitator superfamily domain containing 6 [Source:HGNC Symbol;Acc:HGNC:24711])

HSP 1 Score: 58.5362 bits (140), Expect = 2.776e-8
Identity = 65/290 (22.41%), Postives = 121/290 (41.72%), Query Frame = 3
Query:   69 KMICKINRDLLIIKSLYFFELSVVACLFIYLNPFMVERGVSGSELAVINFVAHIVAFFTRPFFGYMADKHQRYREILAVSAALCFII-NLVQLFI------------PKYQKSNQYFLLANFEGNDNF-------------------------TVCFSNSSNI----LCQPCNNGSSSQVLDVSIYRYPINISCSGIPIFKLNSTNHFNASNFCNNLSTPCFDYLKSLNKSETNSGLTWSLTFWLFLICKILGHTFYSANISLTDAVTFVTLGKDKCHKFGVTRMFGTLG 812
            K   KIN DLLI K  YFF  S    L+  L  +  + G+S S+  ++  + + + F + PF+G +AD+ ++ + +L  S  LC+++ NL   F+            P    +N    L     N +F                         TV    + N+      QP     +++++D+++       S +  P+   + T            S P    +   ++ E  +       F + L+  I+G  F ++++++ D VT   LGK +  ++G+ RM+G+LG
Sbjct:   59 KHCVKINNDLLISKVFYFFFYSAYGSLYPLLPVYYKQLGMSPSQSGLLVGIRYFIEFCSAPFWGVVADRFKKGKIVLLFS-LLCWVLFNLGIGFVKPATLRCVPKIRPTTHPTNASHQLTILPTNSSFTSFLTISPKMREKRNLLETRLNVSDTVTLPTAPNMNSEPTLQPQTGEITNRMMDLTLN------SSTATPVSPGSVTKETTTVIVTTTKSLPSDQVMLVYDQQEVEA------IFLVILVVVIIGEFFSASSVTIVDTVTLQYLGKHR-DRYGLQRMWGSLG 334          
BLAST of MFS_1_like domain-containing protein vs. Ensembl Human
Match: MFSD6 (major facilitator superfamily domain containing 6 [Source:HGNC Symbol;Acc:HGNC:24711])

HSP 1 Score: 58.5362 bits (140), Expect = 2.776e-8
Identity = 65/290 (22.41%), Postives = 121/290 (41.72%), Query Frame = 3
Query:   69 KMICKINRDLLIIKSLYFFELSVVACLFIYLNPFMVERGVSGSELAVINFVAHIVAFFTRPFFGYMADKHQRYREILAVSAALCFII-NLVQLFI------------PKYQKSNQYFLLANFEGNDNF-------------------------TVCFSNSSNI----LCQPCNNGSSSQVLDVSIYRYPINISCSGIPIFKLNSTNHFNASNFCNNLSTPCFDYLKSLNKSETNSGLTWSLTFWLFLICKILGHTFYSANISLTDAVTFVTLGKDKCHKFGVTRMFGTLG 812
            K   KIN DLLI K  YFF  S    L+  L  +  + G+S S+  ++  + + + F + PF+G +AD+ ++ + +L  S  LC+++ NL   F+            P    +N    L     N +F                         TV    + N+      QP     +++++D+++       S +  P+   + T            S P    +   ++ E  +       F + L+  I+G  F ++++++ D VT   LGK +  ++G+ RM+G+LG
Sbjct:   59 KHCVKINNDLLISKVFYFFFYSAYGSLYPLLPVYYKQLGMSPSQSGLLVGIRYFIEFCSAPFWGVVADRFKKGKIVLLFS-LLCWVLFNLGIGFVKPATLRCVPKIRPTTHPTNASHQLTILPTNSSFTSFLTISPKMREKRNLLETRLNVSDTVTLPTAPNMNSEPTLQPQTGEITNRMMDLTLN------SSTATPVSPGSVTKETTTVIVTTTKSLPSDQVMLVYDQQEVEA------IFLVILVVVIIGEFFSASSVTIVDTVTLQYLGKHR-DRYGLQRMWGSLG 334          
BLAST of MFS_1_like domain-containing protein vs. Ensembl Fly
Match: CG15706 (gene:FBgn0034093 transcript:FBtr0340024)

HSP 1 Score: 85.8853 bits (211), Expect = 2.932e-17
Identity = 119/473 (25.16%), Postives = 203/473 (42.92%), Query Frame = 3
Query:   81 KINRDLLIIKSLYFFELSVVACLFIYLNPFMVERGVSGSELAVINFVAHIVAFFTRPFFGYMADKHQRYREILAVSAALCFIINLVQL--------FIPKYQKSNQYFLLANFEGNDNFTVCFSNSSNILCQPCNNGSSSQV-LDVSIYRYPINISCSGIPIFKLNSTNHFNASNFCNNLSTPC-FDY-LKSLNKSETNSGLTWSLTFWLFLICKILGHTFYSANISLTDAVTFVTLGKDKCHKFGVTRMFGTLGILVFSLTTAVMLQLFFQQPNYSWISYLKSVSSYTPCFILGLAMFAFVVLFSL-LLGNDKPLHSEPFWTSLGLLFRNLEXXXXXXXXXXXXXXXXTLIEYYFIVIFQM-----FPQMPKYFPGLIFAVMTIA-EAIFNGASSIILKFANDEFWISFAFFTWALRWLSYYLITNYWFFLMIE-FLNGPAFGLLLPCMMAHISKFANRSTQGRVQCVFAGL 1442
            ++NR LL IK+ +FF ++ +  +   L+    + GV    +  I     ++    +P  G++AD     R+ + +S  L   +             FIP  + S Q+ +      ND  T+    SSN  CQ  +     Q   +V  +   I  + SG+    LN        ++   L+ P   D+   S      NS +  +  FWLF+    +G   ++   S++DA  F  LG ++  K+G  R++GT+G    ++   +++          W +   +V S TP  I+ + +F+ + LFS+  L   K   SE  W+ +  L R   I +F  F+   G I S +I + F  + Q+     +    K   GL+ A   +A E  F   S  I+K       +S  FF +A+R      I N W+ + +E F  G  + L   C++A+ S  A   T   VQ + AG+
Sbjct:    3 RLNRRLLPIKAHFFFFMAAMGPILPQLSVIGKQIGVPPDVMGYITAALPLLYVLAKPLVGFLADYFTSLRKFIFISLILIMTLAFAGFYFLPDNSHFIPLDEGSAQWNVTLLTNPNDCNTII--QSSNAFCQTTHQAKCIQEEKEVGEFSALIVANESGL---NLNQNLLHGNESYHICLTQPAAIDWNSASCEVRHVNSCIYGAGKFWLFVCLLCIGIVGFNVTNSISDACCFDLLGDEEQEKYGAQRVWGTIGFGATAMLAGIVVNW--------WTT--DAVKSLTPALII-MCVFSLLDLFSVSKLKLPKLGGSESIWSDVWQLVRKPPILVFLFFATMAGIIDSFIIYFMFWHLEQVAEATGYMHQIKLIEGLVVAAECLAGEVPFFFYSGKIIKKLGYVHCMSMCFFFYAVRLSLIAWIPNPWYLVGVELFFQGITYALCYTCIVAYASAVAPPGTSATVQGLMAGM 459          
BLAST of MFS_1_like domain-containing protein vs. Ensembl Fly
Match: CG15706 (gene:FBgn0034093 transcript:FBtr0344080)

HSP 1 Score: 85.8853 bits (211), Expect = 2.932e-17
Identity = 119/473 (25.16%), Postives = 203/473 (42.92%), Query Frame = 3
Query:   81 KINRDLLIIKSLYFFELSVVACLFIYLNPFMVERGVSGSELAVINFVAHIVAFFTRPFFGYMADKHQRYREILAVSAALCFIINLVQL--------FIPKYQKSNQYFLLANFEGNDNFTVCFSNSSNILCQPCNNGSSSQV-LDVSIYRYPINISCSGIPIFKLNSTNHFNASNFCNNLSTPC-FDY-LKSLNKSETNSGLTWSLTFWLFLICKILGHTFYSANISLTDAVTFVTLGKDKCHKFGVTRMFGTLGILVFSLTTAVMLQLFFQQPNYSWISYLKSVSSYTPCFILGLAMFAFVVLFSL-LLGNDKPLHSEPFWTSLGLLFRNLEXXXXXXXXXXXXXXXXTLIEYYFIVIFQM-----FPQMPKYFPGLIFAVMTIA-EAIFNGASSIILKFANDEFWISFAFFTWALRWLSYYLITNYWFFLMIE-FLNGPAFGLLLPCMMAHISKFANRSTQGRVQCVFAGL 1442
            ++NR LL IK+ +FF ++ +  +   L+    + GV    +  I     ++    +P  G++AD     R+ + +S  L   +             FIP  + S Q+ +      ND  T+    SSN  CQ  +     Q   +V  +   I  + SG+    LN        ++   L+ P   D+   S      NS +  +  FWLF+    +G   ++   S++DA  F  LG ++  K+G  R++GT+G    ++   +++          W +   +V S TP  I+ + +F+ + LFS+  L   K   SE  W+ +  L R   I +F  F+   G I S +I + F  + Q+     +    K   GL+ A   +A E  F   S  I+K       +S  FF +A+R      I N W+ + +E F  G  + L   C++A+ S  A   T   VQ + AG+
Sbjct:    3 RLNRRLLPIKAHFFFFMAAMGPILPQLSVIGKQIGVPPDVMGYITAALPLLYVLAKPLVGFLADYFTSLRKFIFISLILIMTLAFAGFYFLPDNSHFIPLDEGSAQWNVTLLTNPNDCNTII--QSSNAFCQTTHQAKCIQEEKEVGEFSALIVANESGL---NLNQNLLHGNESYHICLTQPAAIDWNSASCEVRHVNSCIYGAGKFWLFVCLLCIGIVGFNVTNSISDACCFDLLGDEEQEKYGAQRVWGTIGFGATAMLAGIVVNW--------WTT--DAVKSLTPALII-MCVFSLLDLFSVSKLKLPKLGGSESIWSDVWQLVRKPPILVFLFFATMAGIIDSFIIYFMFWHLEQVAEATGYMHQIKLIEGLVVAAECLAGEVPFFFYSGKIIKKLGYVHCMSMCFFFYAVRLSLIAWIPNPWYLVGVELFFQGITYALCYTCIVAYASAVAPPGTSATVQGLMAGM 459          
BLAST of MFS_1_like domain-containing protein vs. Ensembl Fly
Match: CG15706 (gene:FBgn0034093 transcript:FBtr0087191)

HSP 1 Score: 85.8853 bits (211), Expect = 2.932e-17
Identity = 119/473 (25.16%), Postives = 203/473 (42.92%), Query Frame = 3
Query:   81 KINRDLLIIKSLYFFELSVVACLFIYLNPFMVERGVSGSELAVINFVAHIVAFFTRPFFGYMADKHQRYREILAVSAALCFIINLVQL--------FIPKYQKSNQYFLLANFEGNDNFTVCFSNSSNILCQPCNNGSSSQV-LDVSIYRYPINISCSGIPIFKLNSTNHFNASNFCNNLSTPC-FDY-LKSLNKSETNSGLTWSLTFWLFLICKILGHTFYSANISLTDAVTFVTLGKDKCHKFGVTRMFGTLGILVFSLTTAVMLQLFFQQPNYSWISYLKSVSSYTPCFILGLAMFAFVVLFSL-LLGNDKPLHSEPFWTSLGLLFRNLEXXXXXXXXXXXXXXXXTLIEYYFIVIFQM-----FPQMPKYFPGLIFAVMTIA-EAIFNGASSIILKFANDEFWISFAFFTWALRWLSYYLITNYWFFLMIE-FLNGPAFGLLLPCMMAHISKFANRSTQGRVQCVFAGL 1442
            ++NR LL IK+ +FF ++ +  +   L+    + GV    +  I     ++    +P  G++AD     R+ + +S  L   +             FIP  + S Q+ +      ND  T+    SSN  CQ  +     Q   +V  +   I  + SG+    LN        ++   L+ P   D+   S      NS +  +  FWLF+    +G   ++   S++DA  F  LG ++  K+G  R++GT+G    ++   +++          W +   +V S TP  I+ + +F+ + LFS+  L   K   SE  W+ +  L R   I +F  F+   G I S +I + F  + Q+     +    K   GL+ A   +A E  F   S  I+K       +S  FF +A+R      I N W+ + +E F  G  + L   C++A+ S  A   T   VQ + AG+
Sbjct:    3 RLNRRLLPIKAHFFFFMAAMGPILPQLSVIGKQIGVPPDVMGYITAALPLLYVLAKPLVGFLADYFTSLRKFIFISLILIMTLAFAGFYFLPDNSHFIPLDEGSAQWNVTLLTNPNDCNTII--QSSNAFCQTTHQAKCIQEEKEVGEFSALIVANESGL---NLNQNLLHGNESYHICLTQPAAIDWNSASCEVRHVNSCIYGAGKFWLFVCLLCIGIVGFNVTNSISDACCFDLLGDEEQEKYGAQRVWGTIGFGATAMLAGIVVNW--------WTT--DAVKSLTPALII-MCVFSLLDLFSVSKLKLPKLGGSESIWSDVWQLVRKPPILVFLFFATMAGIIDSFIIYFMFWHLEQVAEATGYMHQIKLIEGLVVAAECLAGEVPFFFYSGKIIKKLGYVHCMSMCFFFYAVRLSLIAWIPNPWYLVGVELFFQGITYALCYTCIVAYASAVAPPGTSATVQGLMAGM 459          
BLAST of MFS_1_like domain-containing protein vs. Ensembl Fly
Match: CG15706 (gene:FBgn0034093 transcript:FBtr0344081)

HSP 1 Score: 85.8853 bits (211), Expect = 2.932e-17
Identity = 119/473 (25.16%), Postives = 203/473 (42.92%), Query Frame = 3
Query:   81 KINRDLLIIKSLYFFELSVVACLFIYLNPFMVERGVSGSELAVINFVAHIVAFFTRPFFGYMADKHQRYREILAVSAALCFIINLVQL--------FIPKYQKSNQYFLLANFEGNDNFTVCFSNSSNILCQPCNNGSSSQV-LDVSIYRYPINISCSGIPIFKLNSTNHFNASNFCNNLSTPC-FDY-LKSLNKSETNSGLTWSLTFWLFLICKILGHTFYSANISLTDAVTFVTLGKDKCHKFGVTRMFGTLGILVFSLTTAVMLQLFFQQPNYSWISYLKSVSSYTPCFILGLAMFAFVVLFSL-LLGNDKPLHSEPFWTSLGLLFRNLEXXXXXXXXXXXXXXXXTLIEYYFIVIFQM-----FPQMPKYFPGLIFAVMTIA-EAIFNGASSIILKFANDEFWISFAFFTWALRWLSYYLITNYWFFLMIE-FLNGPAFGLLLPCMMAHISKFANRSTQGRVQCVFAGL 1442
            ++NR LL IK+ +FF ++ +  +   L+    + GV    +  I     ++    +P  G++AD     R+ + +S  L   +             FIP  + S Q+ +      ND  T+    SSN  CQ  +     Q   +V  +   I  + SG+    LN        ++   L+ P   D+   S      NS +  +  FWLF+    +G   ++   S++DA  F  LG ++  K+G  R++GT+G    ++   +++          W +   +V S TP  I+ + +F+ + LFS+  L   K   SE  W+ +  L R   I +F  F+   G I S +I + F  + Q+     +    K   GL+ A   +A E  F   S  I+K       +S  FF +A+R      I N W+ + +E F  G  + L   C++A+ S  A   T   VQ + AG+
Sbjct:    3 RLNRRLLPIKAHFFFFMAAMGPILPQLSVIGKQIGVPPDVMGYITAALPLLYVLAKPLVGFLADYFTSLRKFIFISLILIMTLAFAGFYFLPDNSHFIPLDEGSAQWNVTLLTNPNDCNTII--QSSNAFCQTTHQAKCIQEEKEVGEFSALIVANESGL---NLNQNLLHGNESYHICLTQPAAIDWNSASCEVRHVNSCIYGAGKFWLFVCLLCIGIVGFNVTNSISDACCFDLLGDEEQEKYGAQRVWGTIGFGATAMLAGIVVNW--------WTT--DAVKSLTPALII-MCVFSLLDLFSVSKLKLPKLGGSESIWSDVWQLVRKPPILVFLFFATMAGIIDSFIIYFMFWHLEQVAEATGYMHQIKLIEGLVVAAECLAGEVPFFFYSGKIIKKLGYVHCMSMCFFFYAVRLSLIAWIPNPWYLVGVELFFQGITYALCYTCIVAYASAVAPPGTSATVQGLMAGM 459          
BLAST of MFS_1_like domain-containing protein vs. Ensembl Fly
Match: CG15706 (gene:FBgn0034093 transcript:FBtr0344079)

HSP 1 Score: 85.8853 bits (211), Expect = 2.932e-17
Identity = 119/473 (25.16%), Postives = 203/473 (42.92%), Query Frame = 3
Query:   81 KINRDLLIIKSLYFFELSVVACLFIYLNPFMVERGVSGSELAVINFVAHIVAFFTRPFFGYMADKHQRYREILAVSAALCFIINLVQL--------FIPKYQKSNQYFLLANFEGNDNFTVCFSNSSNILCQPCNNGSSSQV-LDVSIYRYPINISCSGIPIFKLNSTNHFNASNFCNNLSTPC-FDY-LKSLNKSETNSGLTWSLTFWLFLICKILGHTFYSANISLTDAVTFVTLGKDKCHKFGVTRMFGTLGILVFSLTTAVMLQLFFQQPNYSWISYLKSVSSYTPCFILGLAMFAFVVLFSL-LLGNDKPLHSEPFWTSLGLLFRNLEXXXXXXXXXXXXXXXXTLIEYYFIVIFQM-----FPQMPKYFPGLIFAVMTIA-EAIFNGASSIILKFANDEFWISFAFFTWALRWLSYYLITNYWFFLMIE-FLNGPAFGLLLPCMMAHISKFANRSTQGRVQCVFAGL 1442
            ++NR LL IK+ +FF ++ +  +   L+    + GV    +  I     ++    +P  G++AD     R+ + +S  L   +             FIP  + S Q+ +      ND  T+    SSN  CQ  +     Q   +V  +   I  + SG+    LN        ++   L+ P   D+   S      NS +  +  FWLF+    +G   ++   S++DA  F  LG ++  K+G  R++GT+G    ++   +++          W +   +V S TP  I+ + +F+ + LFS+  L   K   SE  W+ +  L R   I +F  F+   G I S +I + F  + Q+     +    K   GL+ A   +A E  F   S  I+K       +S  FF +A+R      I N W+ + +E F  G  + L   C++A+ S  A   T   VQ + AG+
Sbjct:    3 RLNRRLLPIKAHFFFFMAAMGPILPQLSVIGKQIGVPPDVMGYITAALPLLYVLAKPLVGFLADYFTSLRKFIFISLILIMTLAFAGFYFLPDNSHFIPLDEGSAQWNVTLLTNPNDCNTII--QSSNAFCQTTHQAKCIQEEKEVGEFSALIVANESGL---NLNQNLLHGNESYHICLTQPAAIDWNSASCEVRHVNSCIYGAGKFWLFVCLLCIGIVGFNVTNSISDACCFDLLGDEEQEKYGAQRVWGTIGFGATAMLAGIVVNW--------WTT--DAVKSLTPALII-MCVFSLLDLFSVSKLKLPKLGGSESIWSDVWQLVRKPPILVFLFFATMAGIIDSFIIYFMFWHLEQVAEATGYMHQIKLIEGLVVAAECLAGEVPFFFYSGKIIKKLGYVHCMSMCFFFYAVRLSLIAWIPNPWYLVGVELFFQGITYALCYTCIVAYASAVAPPGTSATVQGLMAGM 459          
BLAST of MFS_1_like domain-containing protein vs. Ensembl Mouse
Match: Mfsd6 (major facilitator superfamily domain containing 6 [Source:MGI Symbol;Acc:MGI:1922925])

HSP 1 Score: 57.7658 bits (138), Expect = 3.511e-8
Identity = 61/281 (21.71%), Postives = 122/281 (43.42%), Query Frame = 3
Query:   69 KMICKINRDLLIIKSLYFFELSVVACLFIYLNPFMVERGVSGSELAVINFVAHIVAFFTRPFFGYMADKHQRYREILAVSAALCFII-NLVQLFI------------PKYQKSNQYFLLANFEGNDNFTVCFSNSSNILCQPCNNGSSSQ--VLDVSIYRYPINISCSGIPIFKLNSTNHFNASNFCNNLSTPCFDYLKSLNKSETNSGLTWSLT------------------FWLFLICKILGHTFYSANISLTDAVTFVTLGKDKCHKFGVTRMFGTLG 812
            K   K+N DLLI K  YFF  S    L+  L  +  + G+S S+  ++  + + + F + PF+G +AD+ ++ + +L  S  LC+++ NL   F+            P    +N    +     N +    FS    +L +     S ++  + D+ +    + ++       +  +  H   +    N ST       ++ +  T + +T + +                  F + L+  I+G  F ++++++ D VT   LGK +  ++G+ RM+G+LG
Sbjct:   60 KHCVKVNNDLLISKVFYFFFYSAYGSLYPLLPVYYKQLGMSPSQSGLLVGIRYFIEFCSAPFWGVVADRFRKGKIVLLFS-LLCWVLFNLGIGFVKPATLRCLPKIPPTAHPTNVSHPVTVLPMNSSTVAFFSTPPKLLQKRDVQLSETEPNISDIDLVSTALTLTSEPTRRPQTEAITH-PVTGLILNTSTVTLPPTGNVTRETTIAVVTTTKSLPSDQVTLVYDQQEVEAIFLIILVVVIIGEFFSASSVTIVDTVTLQYLGKHR-DRYGLQRMWGSLG 337          
BLAST of MFS_1_like domain-containing protein vs. Ensembl Mouse
Match: Mfsd6 (major facilitator superfamily domain containing 6 [Source:MGI Symbol;Acc:MGI:1922925])

HSP 1 Score: 56.6102 bits (135), Expect = 7.615e-8
Identity = 61/281 (21.71%), Postives = 122/281 (43.42%), Query Frame = 3
Query:   69 KMICKINRDLLIIKSLYFFELSVVACLFIYLNPFMVERGVSGSELAVINFVAHIVAFFTRPFFGYMADKHQRYREILAVSAALCFII-NLVQLFI------------PKYQKSNQYFLLANFEGNDNFTVCFSNSSNILCQPCNNGSSSQ--VLDVSIYRYPINISCSGIPIFKLNSTNHFNASNFCNNLSTPCFDYLKSLNKSETNSGLTWSLT------------------FWLFLICKILGHTFYSANISLTDAVTFVTLGKDKCHKFGVTRMFGTLG 812
            K   K+N DLLI K  YFF  S    L+  L  +  + G+S S+  ++  + + + F + PF+G +AD+ ++ + +L  S  LC+++ NL   F+            P    +N    +     N +    FS    +L +     S ++  + D+ +    + ++       +  +  H   +    N ST       ++ +  T + +T + +                  F + L+  I+G  F ++++++ D VT   LGK +  ++G+ RM+G+LG
Sbjct:   60 KHCVKVNNDLLISKVFYFFFYSAYGSLYPLLPVYYKQLGMSPSQSGLLVGIRYFIEFCSAPFWGVVADRFRKGKIVLLFS-LLCWVLFNLGIGFVKPATLRCLPKIPPTAHPTNVSHPVTVLPMNSSTVAFFSTPPKLLQKRDVQLSETEPNISDIDLVSTALTLTSEPTRRPQTEAITH-PVTGLILNTSTVTLPPTGNVTRETTIAVVTTTKSLPSDQVTLVYDQQEVEAIFLIILVVVIIGEFFSASSVTIVDTVTLQYLGKHR-DRYGLQRMWGSLG 337          
BLAST of MFS_1_like domain-containing protein vs. UniProt/SwissProt
Match: sp|A1DWM3|MFSD6_PIG (Major facilitator superfamily domain-containing protein 6 OS=Sus scrofa OX=9823 GN=MFSD6 PE=2 SV=1)

HSP 1 Score: 59.6918 bits (143), Expect = 6.901e-8
Identity = 71/298 (23.83%), Postives = 122/298 (40.94%), Query Frame = 3
Query:   69 KMICKINRDLLIIKSLYFFELSVVACLFIYLNPFMVERGVSGSELAVINFVAHIVAFFTRPFFGYMADKHQRYREILAVSAALCFII-NL------------VQLFIPKYQKSNQ----YFLLAN-----------------------------FEGNDNFTVCFSNSSNILC----QPCNNGSSSQVLDVSIYRYPINISCSGIPIFKLNSTNHFNASNFCNNLSTPCFDYLKSLNKSETNSGLTWSLTFWLFLICKILGHTFYSANISLTDAVTFVTLGKDKCHKFGVTRMFGTLG 812
            K   KIN DLLI K  YFF  S    L+  L  +  + G+S S+  ++  + + + F + PF+G +AD+ ++ + +L  S  LC+++ NL            V    P  + +N       L AN                              E N   TV FS + N       QP  +  + +V+D++ +      +  G      N+T     S      S P        ++ E  +       F + L+  I+G  F ++++++ D VT   LGK +  ++G+ RM+G+LG
Sbjct:   60 KHCVKINNDLLISKVFYFFFYSAYGSLYPLLPVYYKQLGMSPSQSGLLVGIRYFIEFCSAPFWGVVADRFKKGKVVLLFS-LLCWVLFNLGIGFVKPATLRCVPKIPPTARPTNSSHPFTILPANSSIVPSITTSTRTREKRNLPPYDGLEMLVSEPNVTETVIFSTAPNKTSAPTLQPQTDEITDRVMDLTSHPSTAPSTPPG------NTTRETTTSLVTTTKSLPSDQVTLVYDQQEVEA------IFLVILVVVIIGEFFSASSVTIVDTVTLQYLGKHR-DRYGLQRMWGSLG 343          
BLAST of MFS_1_like domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6ZSS7|MFSD6_HUMAN (Major facilitator superfamily domain-containing protein 6 OS=Homo sapiens OX=9606 GN=MFSD6 PE=1 SV=2)

HSP 1 Score: 58.5362 bits (140), Expect = 1.333e-7
Identity = 65/290 (22.41%), Postives = 121/290 (41.72%), Query Frame = 3
Query:   69 KMICKINRDLLIIKSLYFFELSVVACLFIYLNPFMVERGVSGSELAVINFVAHIVAFFTRPFFGYMADKHQRYREILAVSAALCFII-NLVQLFI------------PKYQKSNQYFLLANFEGNDNF-------------------------TVCFSNSSNI----LCQPCNNGSSSQVLDVSIYRYPINISCSGIPIFKLNSTNHFNASNFCNNLSTPCFDYLKSLNKSETNSGLTWSLTFWLFLICKILGHTFYSANISLTDAVTFVTLGKDKCHKFGVTRMFGTLG 812
            K   KIN DLLI K  YFF  S    L+  L  +  + G+S S+  ++  + + + F + PF+G +AD+ ++ + +L  S  LC+++ NL   F+            P    +N    L     N +F                         TV    + N+      QP     +++++D+++       S +  P+   + T            S P    +   ++ E  +       F + L+  I+G  F ++++++ D VT   LGK +  ++G+ RM+G+LG
Sbjct:   59 KHCVKINNDLLISKVFYFFFYSAYGSLYPLLPVYYKQLGMSPSQSGLLVGIRYFIEFCSAPFWGVVADRFKKGKIVLLFS-LLCWVLFNLGIGFVKPATLRCVPKIRPTTHPTNASHQLTILPTNSSFTSFLTISPKMREKRNLLETRLNVSDTVTLPTAPNMNSEPTLQPQTGEITNRMMDLTLN------SSTATPVSPGSVTKETTTVIVTTTKSLPSDQVMLVYDQQEVEA------IFLVILVVVIIGEFFSASSVTIVDTVTLQYLGKHR-DRYGLQRMWGSLG 334          
BLAST of MFS_1_like domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8CBH5|MFSD6_MOUSE (Major facilitator superfamily domain-containing protein 6 OS=Mus musculus OX=10090 GN=Mfsd6 PE=1 SV=1)

HSP 1 Score: 57.7658 bits (138), Expect = 2.456e-7
Identity = 61/281 (21.71%), Postives = 122/281 (43.42%), Query Frame = 3
Query:   69 KMICKINRDLLIIKSLYFFELSVVACLFIYLNPFMVERGVSGSELAVINFVAHIVAFFTRPFFGYMADKHQRYREILAVSAALCFII-NLVQLFI------------PKYQKSNQYFLLANFEGNDNFTVCFSNSSNILCQPCNNGSSSQ--VLDVSIYRYPINISCSGIPIFKLNSTNHFNASNFCNNLSTPCFDYLKSLNKSETNSGLTWSLT------------------FWLFLICKILGHTFYSANISLTDAVTFVTLGKDKCHKFGVTRMFGTLG 812
            K   K+N DLLI K  YFF  S    L+  L  +  + G+S S+  ++  + + + F + PF+G +AD+ ++ + +L  S  LC+++ NL   F+            P    +N    +     N +    FS    +L +     S ++  + D+ +    + ++       +  +  H   +    N ST       ++ +  T + +T + +                  F + L+  I+G  F ++++++ D VT   LGK +  ++G+ RM+G+LG
Sbjct:   60 KHCVKVNNDLLISKVFYFFFYSAYGSLYPLLPVYYKQLGMSPSQSGLLVGIRYFIEFCSAPFWGVVADRFRKGKIVLLFS-LLCWVLFNLGIGFVKPATLRCLPKIPPTAHPTNVSHPVTVLPMNSSTVAFFSTPPKLLQKRDVQLSETEPNISDIDLVSTALTLTSEPTRRPQTEAITH-PVTGLILNTSTVTLPPTGNVTRETTIAVVTTTKSLPSDQVTLVYDQQEVEAIFLIILVVVIIGEFFSASSVTIVDTVTLQYLGKHR-DRYGLQRMWGSLG 337          
BLAST of MFS_1_like domain-containing protein vs. TrEMBL
Match: A0A267FST2 (MFS domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig032673g3 PE=4 SV=1)

HSP 1 Score: 138.658 bits (348), Expect = 5.277e-31
Identity = 135/481 (28.07%), Postives = 214/481 (44.49%), Query Frame = 3
Query:   84 INRDLLIIKSLYFFELSVVACLFIYLNPFMVERGVSGSELAVINFVAHIVAFFTRPFFGYMADKHQRYREILAVSAALCFIINLVQLFIPKYQKS---NQYFLLANFEGNDN--FTVCFSNSSNI----------LCQPCNNGSSSQVLDVSIYRYPINISCSGIPIFKLNSTNHFNASNFCNNLSTPCFDYLKSLNKSETNSGLTWSLTFWLFLICKILGHTFYSANISLTDAVTFVTLGKDKCHKFGVTRMFGTLGILVFSLTTAVMLQLFFQQPNYSWISYLKSVSSYTPCFILGLAMFAFVVLFSLLLGND------KPLHSEPF----WTSLGLLFRNLEXXXXXXXXXXXXXXXXTLIEYYFIVIFQMFPQMPKYFPGLIFAVMTIAEAIFNGASSIILKFANDEFWISFAFFTWALRWLSYYLITNYWFFLMIEFLNGPAFGLLLPCMMAHISKFANRSTQGRVQCVFAGLFFN 1451
            IN+DL+  K LYF  LS+V+ L +YLN F+++RG++  EL +I+ V +IV F  RP  G +AD++Q YR +L     L        L +P+  ++   N+ F + N   ND    ++C +  S            LC  C + S  ++   +I R     S S          ++  ++ F +N S       + L  S + +   W++ F L L+ K +G   YS  + L DAVTF  LG  K   +G TRM+G+ GI + +L T   L        Y +       + YT  FIL   + A     ++ L          PL + P     W  +G+ +            +        + E +  V+ +     P YF G++FAV  + EA     S  I+    +       F  +ALR+L   L+ N W  L +  L+G +FGL+ P M+   +K A    QG VQ + +GL+F 
Sbjct:    3 INKDLIKPKILYFLFLSIVSSLIMYLNMFLMQRGINEFELGLIDTVGYIVGFLMRPVCGAVADRYQAYRPVLLALMLLSAAGFDGMLLLPQPLQAAAYNETFSIVNASYNDTGYASLCLATDSMTNNSYYQAPISLCN-CKSASKDRLDRGTITRLNFLGSESDKQCILYEPASYNYSAKFVSNNSKLICKACQ-LTNSSSKAKSNWNVNFLLALVLKTIGLAGYSPLLCLLDAVTFSLLGP-KPSDYGWTRMYGSFGIFITALLTGFAL--------YGYSMAWSFRTDYTASFILATVLLAVAAAVTVTLKVPTSTRTLNPLKALPLMCLSW-RIGIFY----------ILVLLSGAAFGIFESFLAVMLRTMFDPPLYFFGIMFAVQVLVEAPLFALSGCIVSRIGEPACFVIGFLAFALRFLLTSLVPNCWLLLPVNCLHGLSFGLMFPAMLVFAAKQAPEGWQGTVQGLVSGLYFG 461          
BLAST of MFS_1_like domain-containing protein vs. TrEMBL
Match: A0A1I8JJH3 (MFS domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig032673g2 PE=4 SV=1)

HSP 1 Score: 137.117 bits (344), Expect = 1.498e-30
Identity = 136/482 (28.22%), Postives = 215/482 (44.61%), Query Frame = 3
Query:   84 INRDLLIIKSLYFFELSVVACLFIYLNPFMVERGVSGSELAVINFVAHIVAFFTRPFFGYMADKHQRYREILAVSAALCFIINLVQLFIPKYQKS---NQYFLLANFEGNDN--FTVCFSNSSNI----------LCQPCNNGSSSQVLDVSIYRYPINISCSGIP-IFKLNSTNHFNASNFCNNLSTPCFDYLKSLNKSETNSGLTWSLTFWLFLICKILGHTFYSANISLTDAVTFVTLGKDKCHKFGVTRMFGTLGILVFSLTTAVMLQLFFQQPNYSWISYLKSVSSYTPCFILGLAMFAFVVLFSLLLGND------KPLHSEPF----WTSLGLLFRNLEXXXXXXXXXXXXXXXXTLIEYYFIVIFQMFPQMPKYFPGLIFAVMTIAEAIFNGASSIILKFANDEFWISFAFFTWALRWLSYYLITNYWFFLMIEFLNGPAFGLLLPCMMAHISKFANRSTQGRVQCVFAGLFFN 1451
            IN+DL+  K LYF  LS+V+ L +YLN F+++RG++  EL +I+ V +IV F  RP  G +AD++Q YR +L     L        L +P+  ++   N+ F + N   ND    ++C +  S            LC  C + S  ++   +I R     S S    I    ++ +++A    NN    C      L  S + +   W++ F L L+ K +G   YS  + L DAVTF  LG  K   +G TRM+G+ GI + +L T   L        Y +       + YT  FIL   + A     ++ L          PL + P     W  +G+ +            +        + E +  V+ +     P YF G++FAV  + EA     S  I+    +       F  +ALR+L   L+ N W  L +  L+G +FGL+ P M+   +K +    QG VQ + +GL+F 
Sbjct:    3 INKDLIKPKILYFLFLSIVSSLIMYLNMFLMQRGINEFELGLIDTVGYIVGFLMRPVCGAVADRYQAYRPVLLALMLLSAAGFDGMLLLPQPLQAAAYNETFSIVNASYNDTGYASLCLATDSMTNNSYYQAPISLCN-CKSASKDRLDRGTITRLNFLGSESDKQCILYEPASYNYSAKFVSNNSKLIC--KACQLTNSSSKAKSNWNVNFLLALVLKTIGLAGYSPLLCLLDAVTFSLLGP-KPSDYGWTRMYGSFGIFITALLTGFAL--------YGYSMAWSFRTDYTASFILATVLLAVAAAVTVTLKVPTSTRTLNPLKALPLMCLSW-RIGIFY----------ILVLLSGAAFGIFESFLAVMLRTMFDPPLYFFGIMFAVQVLVEAPLFALSGCIVSRIGEPACFVIGFLAFALRFLLTSLVPNCWLLLPVNCLHGLSFGLMFPAMLVFAAKQSPEGWQGTVQGLVSGLYFG 461          
BLAST of MFS_1_like domain-containing protein vs. TrEMBL
Match: A0A1I8FYA3 (MFS domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig032673g1 PE=4 SV=1)

HSP 1 Score: 134.42 bits (337), Expect = 1.281e-29
Identity = 134/482 (27.80%), Postives = 212/482 (43.98%), Query Frame = 3
Query:   84 INRDLLIIKSLYFFELSVVACLFIYLNPFMVERGVSGSELAVINFVAHIVAFFTRPFFGYMADKHQRYREILAVSAALCFIINLVQLFIPKYQKS---NQYFLLANFEGNDN--FTVCFSNSSNI----------LCQPCNNGSSSQVLDVSIYRYP-INISCSGIPIFKLNSTNHFNASNFCNNLSTPCFDYLKSLNKSETNSGLTWSLTFWLFLICKILGHTFYSANISLTDAVTFVTLGKDKCHKFGVTRMFGTLGILVFSLTTAVMLQLFFQQPNYSWISYLKSVSSYTPCFILGLAMFAFVVLFSLLLGND------KPLHSEPF----WTSLGLLFRNLEXXXXXXXXXXXXXXXXTLIEYYFIVIFQMFPQMPKYFPGLIFAVMTIAEAIFNGASSIILKFANDEFWISFAFFTWALRWLSYYLITNYWFFLMIEFLNGPAFGLLLPCMMAHISKFANRSTQGRVQCVFAGLFFN 1451
            IN+DL+  K LYF  LS+V+ L +YLN F+++RG++  EL +I+ V +IV F  RP  G +AD +Q YR +L     L        L +P+  ++   N+ F + N   ND    ++C +  S            LC  C + S  ++    I R   + +      I    +  +++A    NN    C      L  S + +   W++ F L L+ K +G   YS  + L DAVTF  LG  K   +G TRM+G+ GI + +L T   L        Y +       + YT  FIL   + A     ++ L          PL + P     W  +G+ +            +        + E +  V+ +     P YF G++FAV  + EA     S  I+    +       F  +ALR+L   L+ N W  L +  L+G +FGL+ P M+   +K +    QG VQ + +GL+F 
Sbjct:    3 INKDLIKPKILYFLFLSIVSSLIMYLNMFLMQRGINEFELGLIDTVGYIVGFLMRPVCGAVADHYQAYRPVLLALMLLSAAGFNGMLLLPQPLQAAVYNETFSIVNASYNDTGYASLCLATDSMTNNSYYQAPISLCN-CKSASKDRLDSGIIARLNFLGLESDKQCILYEPALYNYSAKFVSNNSKLIC--KACQLTNSSSKAKSNWNVNFLLALVLKTIGLAGYSPLLCLLDAVTFSLLGP-KPSDYGWTRMYGSFGIFITALLTGFAL--------YGYSMAWSFRTDYTASFILATVLLAVAAAVTVTLKVPTSTRTLNPLKALPLMCLSW-RIGIFY----------ILVLLSGAAFGIFESFLAVMLRTMFDPPLYFFGIMFAVQVLVEAPLFALSGCIVSRIGEPACFVIGFLAFALRFLLTSLVPNCWLLLPVNCLHGLSFGLMFPAMLVFAAKQSPEGWQGTVQGLVSGLYFG 461          
BLAST of MFS_1_like domain-containing protein vs. TrEMBL
Match: A0A195FX43 (Major facilitator superfamily domain-containing protein 6 OS=Trachymyrmex septentrionalis OX=34720 GN=ALC56_00470 PE=4 SV=1)

HSP 1 Score: 107.071 bits (266), Expect = 1.770e-20
Identity = 139/583 (23.84%), Postives = 239/583 (40.99%), Query Frame = 3
Query:   72 MICKINRDLLIIKSLYFFELSVVACLFIYLNPFMVERGVSGSELAVINFVAHIVAFFTRPFFGYMADKHQRYREILAVSAALCFIINLVQLFIPKYQKSNQYFLLAN-------------FEGNDNFTVCFSN-SSNILCQPCNNGSSSQVLDVS-----------------IYRYPINISCSGIPIFK-LNSTNHFNASNFCNNLSTPC---------FDYLKSLNKSETNSGLTWSLTFWLFLICKILGHTFYSANISLTDAVTFVTLGKDKCHKFGVTRMFGTLGILVFSLTTAVMLQLFFQQPNYSWISYLKSVSSYTPCF-ILGLAMFAFVVLFSLLLGNDKPLHSEPFWTSLGLLFRNL-----EXXXXXXXXXXXXXXXXTLIEYYFI------VIFQMFPQMPKYFPGLIFAVMT-IAEAIFNGASSIILKFANDEFWISFAFFTWALRWLSYYLITNYWFFLMIEFLNGPAFGLLLPCMMAHISKFANRSTQGRVQCVFAGLFFNXXXXXXXXXXXXXXDQFGYHALFVSMIAISAFCSIIYYPLQKLLIPYCA-------NKATNRENQDDKL 1637
            M+  +N++L  IKS YF   +    +  +L     + G S + +  I  V  I     +P FG +ADK + ++ I  +  A+  I      FIP+ +K+ +  L+ +             F       V   N  +N +CQ    G S   L++S                 +Y+  +  +C  + +   L+ T H       + L T C         F+YL    K   +     +  F+LFL   I+     +  +S+ DA+ F  LG ++ + +G  +M+G+LG  +F ++   ++ L   +  Y           YT  F I+ +AMFA +++ + L  N +    EP       LFR L     E  +        G    T + + F+      +         K   GL+  V   + E  FN  S  +LK       +S     +A+R+++Y +I+N W FL++E L+GP+FGL  P M+++  K     T+  +Q     +F  IG A G+   G +LD +G  A   +    +     +++ +Q LL    A       N   N  N DD +
Sbjct:    1 MLQNVNKELAPIKSHYFLFNAATGPMVQFLPTIGKQLGFSATVVGTIYTVLPISGLIAKPLFGGLADKFKLHKTIFLIFEAILAIAFFSIYFIPEIEKNAKVTLICDKDVSYLEICPQIEFSKKALSAVILENIHANTVCQLSCKGVSHGFLELSGKNISTNSTFEFGAGFDVYQDLLTKNCVNVRLRTFLDDTAHVPVCG--DQLRTWCTAICHNNNAFNYLLQEAKDSQSDMKHSTYQFYLFLWAAIISWIGMAVVVSIADAICFDLLGNERRNDYGKQKMWGSLGFGIFGISAGYLIDL-SSKGQYE--------KDYTSIFYIMLVAMFADILVSATLKKNPECSADEPS------LFRELLSVIKEGRVLVFAWWCIGAGMCTAVIWNFLFWYSEDIAATSHITWSKTLQGLMTGVQCFLGELPFNFVSGRVLKKLGHVNVMSLVLLIYAIRFMAYSIISNAWLFLILELLHGPSFGLCWPTMVSYGDKVTPSGTKATMQGFIGAVFEGIGVASGSFICGWLLDSYGGVATLRTFSVGALLWLSVFWLMQLLLRKLKAYPLYRGHNHLANYANPDDAI 566          
BLAST of MFS_1_like domain-containing protein vs. TrEMBL
Match: A0A151WW36 (Major facilitator superfamily domain-containing protein 6 OS=Trachymyrmex zeteki OX=64791 GN=ALC60_08684 PE=4 SV=1)

HSP 1 Score: 103.99 bits (258), Expect = 1.701e-19
Identity = 131/517 (25.34%), Postives = 209/517 (40.43%), Query Frame = 3
Query:   72 MICKINRDLLIIKSLYFFELSVVACLFIYLNPFMVERGVSGSELAVINFVAHIVAFFTRPFFGYMADKHQRYREILAVSAALCFIINLVQLFIPKYQKSNQYFLLAN-------------FEGNDNFTVCFSN-SSNILCQPCNNGSSSQVLDVS-----------------IYRYPINISCSGIPIFK-LNSTNHFNASNFCNNLSTPC---------FDYLKSLNKSETNSGLTWSLTFWLFLICKILGHTFYSANISLTDAVTFVTLGKDKCHKFGVTRMFGTLGILVFSLTTAVMLQLFFQQPNYSWISYLKSVSSYTPCF-ILGLAMFAFVVLFSLLLGNDKPLHS--EPFWTSLGLLFRNL-----EXXXXXXXXXXXXXXXXTLIEYYFIVIFQM------FPQMPKYFPGLIFAVMT-IAEAIFNGASSIILKFANDEFWISFAFFTWALRWLSYYLITNYWFFLMIEFLNGPAFGLLLPCMMAHISKFANRST----QGRVQCVFAGL 1442
            M+  +N+DL  IKS YF   +    +  +L     + G S + +  I  V  I     +P FG +ADK + ++ I  +  A+  I      FIP   KS +  L+ +             F       V   N  +N +CQ    G S   L++S                 IY+  +  +C  + +   L+ T H       N L T C         F++L    K   N     +  F LFL   I+     +  +S+ DA+ F  LG ++ + +G  +M+G+LG  +F ++   ++ L   +  Y           YT  F I+ +AMFA  +L S  L    P  S  EP       LFR L     E  +        G    T + + F+  +             K   GL+  V   + E  FN  S  +LK       +S     +A+R+++Y +I+N W FL++E L+GP+FGL  P M+++  K     T    QG +  VF G+
Sbjct:    1 MLQNMNKDLAPIKSHYFLFNAATGPMVQFLPTIGKQLGFSATVIGTIYTVLPISGLIAKPLFGGLADKFKLHKTIFLIFEAILAIAFFSIYFIPGIDKSAKVTLICDKDVSYLEICPQTEFSKKALSAVILENIHANTVCQLSCKGVSHGFLELSGKNISTNSTFEFGAGFDIYQDLLTKNCVNVRLRTFLDDTAHVPVCG--NQLRTWCTATCHNNSAFNHLLQEAKDSQNDMKHSTYQFHLFLWAAIISWIGMAVVVSIADAICFDLLGNERRNDYGKQKMWGSLGFGIFGISAGYLIDL-SSKGQYE--------KDYTSIFYIMLVAMFA-DILVSATLKKKNPECSADEPS------LFRELLSVIKEGRVLVFAWWCIGAGMCTAVIWNFLFWYSEDLAATSHITWSKTLQGLMTGVQCFLGELPFNFLSGRVLKKLGHVNVMSLVLLIYAIRFMAYSIISNAWLFLILELLHGPSFGLCWPTMVSYGDKVTPSGTKATMQGFIGAVFEGI 499          
BLAST of MFS_1_like domain-containing protein vs. Ensembl Sea Lamprey
Match: mfsd6a (major facilitator superfamily domain containing 6a [Source:NCBI gene;Acc:100034426])

HSP 1 Score: 48.9062 bits (115), Expect = 3.509e-6
Identity = 28/82 (34.15%), Postives = 47/82 (57.32%), Query Frame = 3
Query:   81 KINRDLLIIKSLYFFELSVVACLFIYLNPFMVERGVSGSELAVINFVAHIVAFFTRPFFGYMADKHQRYREILAVSAALCFI 326
            KIN DLLI K+ YFF  S    LF  L  +  + G++ S+  ++  + + + F + P +G +AD+ Q+ + +L  S  LC+I
Sbjct:   57 KINDDLLISKAFYFFFYSAYGSLFPLLPVYYKQLGINASQSGLLVGIRYFIEFCSAPLWGALADRFQKGKHLLLFS-LLCWI 137          
BLAST of MFS_1_like domain-containing protein vs. Ensembl Nematostella
Match: EDO37607 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SF93])

HSP 1 Score: 60.8474 bits (146), Expect = 1.282e-9
Identity = 34/95 (35.79%), Postives = 55/95 (57.89%), Query Frame = 3
Query:   81 KINRDLLIIKSLYFFELSVVACLFIYLNPFMVERGVSGSELAVINFVAHIVAFFTRPFFGYMADKHQRYREILAVSAALCFIINLVQLFI-PKYQ 362
            KINR+LL+ K+ YFF LS +  LF YL  +  + G+  S + ++     I  F + PF+  MADK+++ + IL +SA    I+ L   F+ P ++
Sbjct:    5 KINRELLVYKAFYFFFLSGLGALFPYLPVYFRQMGLPASNVGLLIGFRPIAQFASAPFWAVMADKYRKRKAILIMSALAWLIMTLALAFVEPTHE 99          
BLAST of MFS_1_like domain-containing protein vs. Ensembl Nematostella
Match: EDO37430 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFX7])

HSP 1 Score: 52.373 bits (124), Expect = 5.143e-7
Identity = 72/266 (27.07%), Postives = 112/266 (42.11%), Query Frame = 3
Query:  681 LICKILGHTFYSANISLTDAVTFVTLGKDKCHKFGVTRMFGTLGILVFSLTTAVMLQLFFQQPNYSWISYLKSVSSYTPCFILGLAMF---AFVVLFSLLLGND---KPLHSEPFWTSLGLLFRNLEXXXXXXXXXXXXXXXXTLIEYYFIVIFQMFPQM--PKYFPGLIFAVMTIAEAIFNGASSIILKFANDEFWISFAFFTWALRWLSYYLITNYWFFLMIEFLNGPAFGLLLPCMMAHISKFA----NRSTQGRVQCVFAGL 1442
            L+  I G+   S ++SL D VT   LG DK H++GV R++G+LG  V +     ++         S  S    V  YTPCF    A F   A +  F     ND   K   S+  +T   LL     + +   F          +I +    +F    ++   +    +I AV  IAE      S+ +L F      +   F  +A+R  +YYLIT+ W  L +E L+G         M+A +S+ +      + QG +  +  GL
Sbjct:    2 LLLLIFGNIIASPSLSLADTVTMHNLGGDK-HRYGVQRLWGSLGFGVAAFGIGALVSARGYCMGDSGDSQTVDVD-YTPCF-YSFAAFLSCALITSFKFNFPNDTCPKGKTSDRLYTVRSLLRGRFLMFLLVAFHFGF------MIAFTKTFLFWHLKELGGTQLLFCIITAVNCIAEVTMYFLSAKLLTFITHTRVLYMGFLCYAIRAFAYYLITSPWMVLTVEILSGITSAASWAAMLAFVSENSTPGYTATFQGVIHAIHWGL 258          
BLAST of MFS_1_like domain-containing protein vs. Ensembl Nematostella
Match: EDO31681 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SX88])

HSP 1 Score: 51.2174 bits (121), Expect = 9.115e-7
Identity = 63/264 (23.86%), Postives = 114/264 (43.18%), Query Frame = 3
Query:  108 KSLYFFELSVVACLFIYLNPFMVERGVSGSELAVINFVAHIVAFFTRPFFGYMADKHQRYREILAVSAALCFIINLVQLFIPKYQKSNQYFLLAN-FEGNDNFTVCFSNSSNILCQPCNNGSSSQVLDVSIYRYPINISCSGIPIFKLNSTNHFNASNFCN--------NLSTPCFDYLKSLNK--SETNSGLTWSLTFWLFLICKILGHTFYSANISLTDAVTFVTLGKDKCHKFGVTRMFGTLGILVFSLTTAVMLQLFFQQ 866
            K+ Y F +       +YL  +  + G+    + V+  ++  +      F G +A+K +  + +L +S     +  L+ L IP+ + +    L  + F+ N ++ V + +   +  Q      +S+  D S    P  + C    I  LN    +NAS F          NL+ P      + +    + +  L    TFW+ L    +G        SL DA T   LGKDK +KFG  R++G +G ++  LT  + L+L +++
Sbjct:   33 KAFYMFFIGAFWMKIVYLPLYFKQIGLPADYVGVLAGISPFLRGAGSFFLGLLAEKPETRKVVLLLSLVAQTLTPLLCL-IPRPEHAMPALLPESPFDFNSSWFVEWRDVFPVRDQSMLEMDTSEFEDCS----PNTLGCLEDDI--LNEAVPYNASGFIPYNYTLAALNLTFPTTPSPNTTSPYLPKIDIKLDIQQTFWVLLAIITIGEFLGGPARSLADAATLQALGKDK-NKFGYIRLWGNIGQMI--LTIIIYLELRYEK 286          
BLAST of MFS_1_like domain-containing protein vs. Ensembl Nematostella
Match: EDO47060 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNH1])

HSP 1 Score: 48.521 bits (114), Expect = 5.909e-6
Identity = 60/259 (23.17%), Postives = 95/259 (36.68%), Query Frame = 3
Query:   78 CKINRDLLIIKSLYFFELSVVACLFIYLNPFMVERGVSGSELAVINFVAHIVAFFTRPFFGYMADKHQRYREILAVSAALCFIINLVQLFIPKYQKSNQYFLLANFEGNDNFTVCFSNSSNILCQPCNNGSSSQVLDVSIYRYPINISCSGIPIFKLNSTNHFNASNFCNNLSTPCFDYLKSLNKSETNSGLTWSLTFWLFLICKILGHTFYSANISLTDA-VTFVTLGKDKCHKFGVTRMFGTLGILVFSLTTAVMLQ 851
            C INR  L  K  YF +    A +  +++ F    G+S ++  V+  +   V     P +G +ADK  RYR IL ++  L  II               YF L        +     N +  +  P    +++ ++D             G+            AS            Y   L  S+T         FWL L+  + G  FY+  + + DA VT+     +    FG  RMF  LG  + SL + + + 
Sbjct:   30 CSINRSTLRYKVFYFAQQLSAATILTFMSVFFRYMGMSATQTGVLIGLRPFVRLLAAPMWGIIADKTGRYRCILLMNIVLSVII---------------YFSLTGVLAVHEYDTARMNVTQPV-SPTKGHNTTALMD-------------GV----------LEASK-----------YHPYLTNSQT---------FWLLLVIVLCGDVFYAPILPVMDATVTY----WEGSQNFGKQRMFDALGFSLGSLLSGLAMD 225          
BLAST of MFS_1_like domain-containing protein vs. Planmine SMEST
Match: SMESG000030270.1 (SMESG000030270.1)

HSP 1 Score: 1013.83 bits (2620), Expect = 0.000e+0
Identity = 534/541 (98.71%), Postives = 536/541 (99.08%), Query Frame = 3
Query:   72 MICKINRDLLIIKSLYFFELSVVACLFIYLNPFMVERGVSGSELAVINFVAHIVAFFTRPFFGYMADKHQRYREILAVSAALCFIINLVQLFIPKYQKSNQYFLLANFEGNDNFTVCFSNSSNILCQPCNNGSSSQVLDVSIYRYPINISCSGIPIFKLNSTNHFNASNFCNNLSTPCFDYLKSLNKSETNSGLTWSLTFWLFLICKILGHTFYSANISLTDAVTFVTLGKDKCHKFGVTRMFGTLGILVFSLTTAVMLQLFFQQPNYSWISYLKSVSSYTPCFILGLAMFAFVVLFSLLLGNDKPLHSEPFWTSLGLLFRNLEXXXXXXXXXXXXXXXXTLIEYYFIVIFQMFPQMPKYFPGLIFAVMTIAEAIFNGASSIILKFANDEFWISFAFFTWALRWLSYYLITNYWFFLMIEFLNGPAFGLLLPCMMAHISKFANRSTQGRVQCVFAGLFFNXXXXXXXXXXXXXXDQFGYHALFVSMIAISAFCSIIYYPLQKLLIPYCANKATNRENQDDKLNVENRNPLLEVEINGTIPC 1694
            MICKINRDLLIIKSLYFFELSVVACLFIYLNPFMVERGVSGSELAVINFVAHIVAFFTRPFFGYMADKHQRYREILAVSAALCFIINLVQLFIPKYQKSN YFLLANFE NDNFTVCFSNSSNILCQPCNNGSSSQVLD+SIYRYPINI CSGIPIF+LNSTNHFNASNFCNNLSTPCFDYLKSLNKSETNSGLT SLTFWLFLICKILGHTFYSANISLTDAVTFVTLGKDKCHKFGVTRMFGTLGILVFSLTTAVMLQLFFQQPNYSWISYLKSVSSYTPCFILGLAMFAFVVLFSLLLGNDKPLHSEPFWTSLGLLFRNLEISIFFIFSIFGGFIFSTLIEYYFIVIFQMFPQMPKYFPGLIFAVMTIAEAIFNGASSIILKFANDEFWISFAFFTWALRWLSYYLITNYWFFLMIEFLNGPAFGLLLPCMMAHISKFANRSTQGRVQCVFAGLFFNIGGALGALYGGIILDQFGYHALFVSMIAISAFCSIIYYPLQKLLIPYCANKA NRENQDDKLNVENRNPLLEVEINGTIPC
Sbjct:    1 MICKINRDLLIIKSLYFFELSVVACLFIYLNPFMVERGVSGSELAVINFVAHIVAFFTRPFFGYMADKHQRYREILAVSAALCFIINLVQLFIPKYQKSNPYFLLANFEENDNFTVCFSNSSNILCQPCNNGSSSQVLDISIYRYPINIQCSGIPIFQLNSTNHFNASNFCNNLSTPCFDYLKSLNKSETNSGLTCSLTFWLFLICKILGHTFYSANISLTDAVTFVTLGKDKCHKFGVTRMFGTLGILVFSLTTAVMLQLFFQQPNYSWISYLKSVSSYTPCFILGLAMFAFVVLFSLLLGNDKPLHSEPFWTSLGLLFRNLEISIFFIFSIFGGFIFSTLIEYYFIVIFQMFPQMPKYFPGLIFAVMTIAEAIFNGASSIILKFANDEFWISFAFFTWALRWLSYYLITNYWFFLMIEFLNGPAFGLLLPCMMAHISKFANRSTQGRVQCVFAGLFFNIGGALGALYGGIILDQFGYHALFVSMIAISAFCSIIYYPLQKLLIPYCANKAANRENQDDKLNVENRNPLLEVEINGTIPC 541          
BLAST of MFS_1_like domain-containing protein vs. Planmine SMEST
Match: SMESG000008715.1 (SMESG000008715.1)

HSP 1 Score: 284.263 bits (726), Expect = 7.685e-88
Identity = 200/555 (36.04%), Postives = 324/555 (58.38%), Query Frame = 3
Query:   72 MICKINRDLLIIKSLYFFELSVVACLFIYLNPFMVERGVSGSELAVINFVAHIVAFFTRPFFGYMADKHQRYREI---LAVSAALCFIINLVQLFIPKY-QKSNQYFLLAN-FEGNDN----FTVCFSNSSNILCQPCN--NGSSSQVLDVSIYRYPINISCSGIPIFKLNSTNHFNA----SNFCNNLSTPCFDYLKSLNKSE--TNSGLTWSLTFWLFLICKILGHTFYSANISLTDAVTFVTLGKDKCHKFGVTRMFGTLGILVFSLTTAVMLQLFFQQPNY-SWISYLKSVSSYTPCFILGLAMFAFVVLFSLLLGNDKPLHSEPF------------WTSLGLLFRNLEXXXXXXXXXXXXXXXXTLIEYYFIVIFQMFPQMPKYFPGLIFAVMTIAEAIFNGASSIILKFANDEFWISFAFFTWALRWLSYYLITNYWFFLMIEFLNGPAFGLLLPCMMAHISKFANRSTQGRVQCVFAGLFFNXXXXXXXXXXXXXXDQFGYHALFVSMIAISAFCSIIYYPLQKLLIPYCANKATN---RENQDDKL 1637
            M+ K+++ L  ++ LYFFELSV + + IYL+PFMV+ GV+ SELAVINF  HIV FF+RP FG++ADK+Q ++++   +A+++++ F + L    +P++  K   Y L  N F  ND+      +C SN S + C P N  N +   +  +++ RY  N +C+       N +N+  A    S  C N+   C ++ KS    E      LTWS TFW+  I +I+G    S   +LTD++ F+ LG  + +++G TRMFGT+G+ V S  T  +L L      Y S I+ ++S S ++ CF+L + ++  +++    + +DK +  +               TSL ++  +  ++IFF+F++  GF+ +   EY+ +++FQ F  +PK+ PGL+  +MT++E++  G S  +L     EFW+SF+F  W  RWL+Y  I  +W FL+ E ++G  FGL +  M+++I K  + STQGRVQ +F+ L+FNIGG  G L+GGIIL  F ++ LF+ M  IS   +++YYPLQ  ++P C   ++     E +DD L
Sbjct:    1 MLDKVDKILCRLQCLYFFELSVYSVIIIYLSPFMVKWGVTMSELAVINFAVHIVTFFSRPLFGFIADKYQNFKQLIIFIAITSSISFFLFLA---VPRHVPKVLNYSLEKNLFMVNDSRIGFMGICASNISGV-CWPSNMSNCTFCGLSKINLTRYYYNETCAFYRFDSANQSNYNKAILSDSMKCLNVDQNCGNHTKSHVFFEIYKKISLTWSSTFWMLGILRIIGFAVCSPLSNLTDSLIFIVLGPKRSNEYGHTRMFGTVGVFVLSFVTGGLLYLMDILTKYSSLIANIQSYSQFSLCFLLEVLVYVTIIVIVSFVTHDKVVQEKRKSRNKSCIRKFMDKTSLNMVCFDSNLAIFFLFTVLAGFVETVHCEYFMVILFQKFNYVPKFLPGLLVGIMTLSESLVFGISRKMLDLCRYEFWVSFSFLVWFFRWLTYTFIKYFWQFLITEIIHGFTFGLQIASMVSYIGKRTDPSTQGRVQGLFSSLYFNIGGCSGGLFGGIILHNFDFNGLFIIMCVISLIFALVYYPLQVWIVPLCCKTSSKLIFDETKDDIL 551          
BLAST of MFS_1_like domain-containing protein vs. Planmine SMEST
Match: SMESG000008712.1 (SMESG000008712.1)

HSP 1 Score: 273.863 bits (699), Expect = 8.431e-84
Identity = 199/557 (35.73%), Postives = 310/557 (55.66%), Query Frame = 3
Query:   72 MICKINRDLLIIKSLYFFELSVVACLFIYLNPFMVERGVSGSELAVINFVAHIVAFFTRPFFGYMADKHQRYREILAVSAALCFIINLVQLFIPK-YQKSNQYFLLANFEGNDN-----FTVCFSNSSNILCQPCN--NGSSSQVLDVSIYRYPINISCSGIPIFKLNSTNHFNASNFCNNLSTPCFDYLKSLNKSET---NS------------GLTWSLTFWLFLICKILGHTFYSANISLTDAVTFVTLGKDKCHKFGVTRMFGTLGILVFSLTTAVMLQLFFQQPNYS-WISYLKSVSSYTPCFILGLAMFAFVV----LFSLLLGNDKPLH--SEPFW------TSLGLLFRNLEXXXXXXXXXXXXXXXXTLIEYYFIVIFQMFPQMPKYFPGLIFAVMTIAEAIFNGASSIILKFANDEFWISFAFFTWALRWLSYYLITNYWFFLMIEFLNGPAFGLLLPCMMAHISKFANRSTQGRVQCVFAGLFFNXXXXXXXXXXXXXXDQFGYHALFVSMIAISAFCSIIYYPLQKLLIPYCANKATNRENQDDK 1634
            M   I+++LL +K LY F LS+ + + +Y++PF+++ G++ SELA++ F AHI+ FFTRP FG++AD++Q Y++I+ V+A    ++  + L  PK   K   Y ++ NF  + N       +C  N S I C P N  N + S +  +++  +  N +C+    ++ +S N  N +N       P  + LK LN  +    NS             LTWS TFW+  I KIL    YS   +LTD++ F+ LG+++ +++   RMFGT+G+LVFS+ T + L +      YS WI+ ++  S ++ CF+L       V+       L   +++ L    +  W      TSL  +  N+E++IFF+F I GG + +  IEYY +VI++ FP  PK+ PGL+ + M I+E    G S  +  +   E  +S  F  W  RWL Y  +  YW FL++E ++G  FGL    M+ +I K  + S QGR+Q +F+ LFFNIGG LG L GGIILD +G + LF SM  IS    +IYYPLQ  LIP C   + N+  ++++
Sbjct:    1 MFSSIDKELLPLKLLYVFVLSIYSIILLYVSPFLIQWGITVSELAILTFSAHILTFFTRPLFGFIADRYQDYKKIIVVTACGSAVLFFLHLAAPKNIPKVLSYSIVKNFHLSKNNKISSLGICVLNISGI-CWPSNMSNCAFSGLSKINLTHHYNNETCA---FYRFDSANQSNYNN------APLSNSLKCLNVDQNCGNNSQSHVFFEIYEKISLTWSSTFWILGILKILSFAIYSPLSNLTDSLIFLVLGQNRSNEYSYMRMFGTIGVLVFSIITGLSLFMMDILSTYSSWIAKIQLYSQFSICFLLQAVALIIVIVVIYFIELKKSSEEKLKYKKKSCWSKFLDATSLKFVCSNVELTIFFLFVILGGSVVTVHIEYYMLVIYRKFPTAPKFLPGLLISFMMISEITVLGVSGKMFNYFRYEILVSATFVFWFFRWLLYSFLDKYWQFLILELIHGTTFGLQFSAMVTYIGKTTSSSAQGRIQGLFSSLFFNIGGCLGGLVGGIILDNYGMNGLFRSMSVISLILGLIYYPLQVWLIPRCCKTSLNKRIKNEE 547          
BLAST of MFS_1_like domain-containing protein vs. Planmine SMEST
Match: SMESG000008712.1 (SMESG000008712.1)

HSP 1 Score: 233.802 bits (595), Expect = 5.336e-69
Identity = 190/561 (33.87%), Postives = 299/561 (53.30%), Query Frame = 3
Query:   72 MICKINRDLLIIKSLYFFELSVVACLFIYLNPFMVERGVSGSELAVINFVAHIVAFFTRPFFGYMADKHQRYREILAVSAALCFIINLVQLFIPK-YQKSNQYFLLANFEGNDNFTVCFSNSSNILCQPCNNGSSSQVLDVSIYRYPINIS-CSGIPIFKLNSTNHFN----------ASNFCNNLSTPCFDYLKSLNKSE---TNS------------GLTWSLTFWLFLICKILGHTFYSANISLTDAVTFVTLGKDKCHKFGVTRMFGTLGILVFSLTTAVMLQLFFQQPNY-SWISYLKSVSSYTPCFILGLAMFAFVV----LFSLLLGNDKPL--HSEPFW------TSLGLLFRNLEXXXXXXXXXXXXXXXXTLIEYYFIVIFQMFPQMPKYFPGLIFAVMTIAEAIFNGASSIILKFANDEFWISFAFFTWALRWLSYYLITNYWFFLMIEFLNGPAFGLLLPCMMAHISKFANRSTQGRVQCVFAGLFFNXXXXXXXXXXXXXXDQFGYHALFVSMIAISAFCSIIYYPLQKLLIPYCANKATNRENQDDK 1634
            M   I+++LL +K LY F LS+ + + +Y++PF+++ G++ SELA++ F AHI+ FFTRP FG++AD++Q Y++I+ V+A    ++  + L  PK   K   Y ++ NF  + N  +    SS  +C          VL++S   +P N+S C+   + K+N T+H+N          ++N  N  + P  + LK LN  +    NS             LTWS TFW+  I KIL    YS   +LTD++ F+ LG+++ +++   RMFGT+G+LVFS+ T + L +      Y SWI+ ++  S ++ CF+L       V+       L   +++ L    +  W      TSL  +  N+E++IFF+F I GG + +  IEYY +VI++ FP  PK+ PGL+ + M I+E    G S  +                            NY+     + ++G  FGL    M+ +I K  + S QGR+Q +F+ LFFNIGG LG L GGIILD +G + LF SM  IS    +IYYPLQ  LIP C   + N+  ++++
Sbjct:    1 MFSSIDKELLPLKLLYVFVLSIYSIILLYVSPFLIQWGITVSELAILTFSAHILTFFTRPLFGFIADRYQDYKKIIVVTACGSAVLFFLHLAAPKNIPKVLSYSIVKNFHLSKNNKI----SSLGIC----------VLNISGICWPSNMSNCAFSGLSKINLTHHYNNETCAFYRFDSANQSNYNNAPLSNSLKCLNVDQNCGNNSQSHVFFEIYEKISLTWSSTFWILGILKILSFAIYSPLSNLTDSLIFLVLGQNRSNEYSYMRMFGTIGVLVFSIITGLSLFMMDILSTYSSWIAKIQLYSQFSICFLLQAVALIIVIVVIYFIELKKSSEEKLKYKKKSCWSKFLDATSLKFVCSNVELTIFFLFVILGGSVVTVHIEYYMLVIYRKFPTAPKFLPGLLISFMMISEITVLGVSGKMF---------------------------NYF-----KLIHGTTFGLQFSAMVTYIGKTTSSSAQGRIQGLFSSLFFNIGGCLGGLVGGIILDNYGMNGLFRSMSVISLILGLIYYPLQVWLIPRCCKTSLNKRIKNEE 515          
BLAST of MFS_1_like domain-containing protein vs. Planmine SMEST
Match: SMESG000008712.1 (SMESG000008712.1)

HSP 1 Score: 200.29 bits (508), Expect = 2.820e-57
Identity = 160/500 (32.00%), Postives = 260/500 (52.00%), Query Frame = 3
Query:   72 MICKINRDLLIIKSLYFFELSVVACLFIYLNPFMVERGVSGSELAVINFVAHIVAFFTRPFFGYMADKHQRYREILAVSAALCFIINLVQLFIPK-YQKSNQYFLLANFEGNDNFTVCFSNSSNILCQPCNNGSSSQVLDVSIYRYPINIS-CSGIPIFKLNSTNHFN----------ASNFCNNLSTPCFDYLKSLNKSE---TNS------------GLTWSLTFWLFLICKILGHTFYSANISLTDAVTFVTLGKDKCHKFGVTRMFGTLGILVFSLTTAVMLQLFFQQPNY-SWISYLKSVSSYTPCFILGLAMFAFVV----LFSLLLGNDKPL--HSEPFW------TSLGLLFRNLEXXXXXXXXXXXXXXXXTLIEYYFIVIFQMFPQMPKYFPGLIFAVMTIAEAIFNGASSIILKFANDEFWISFAFFTWALRWLSYYLITNYWFFLMIEFLNGPAFGLLLPCMMAHISKFANRSTQGRVQCVFAGLFFN 1451
            M   I+++LL +K LY F LS+ + + +Y++PF+++ G++ SELA++ F AHI+ FFTRP FG++AD++Q Y++I+ V+A    ++  + L  PK   K   Y ++ NF  + N  +    SS  +C          VL++S   +P N+S C+   + K+N T+H+N          ++N  N  + P  + LK LN  +    NS             LTWS TFW+  I KIL    YS   +LTD++ F+ LG+++ +++   RMFGT+G+LVFS+ T + L +      Y SWI+ ++  S ++ CF+L       V+       L   +++ L    +  W      TSL  +  N+E++IFF+F I GG + +  IEYY +VI++ FP  PK+ PGL+ + M I+E    G S  +                            NY+     + ++G  FGL    M+ +I K  + S QGR+Q +F+ LFFN
Sbjct:    1 MFSSIDKELLPLKLLYVFVLSIYSIILLYVSPFLIQWGITVSELAILTFSAHILTFFTRPLFGFIADRYQDYKKIIVVTACGSAVLFFLHLAAPKNIPKVLSYSIVKNFHLSKNNKI----SSLGIC----------VLNISGICWPSNMSNCAFSGLSKINLTHHYNNETCAFYRFDSANQSNYNNAPLSNSLKCLNVDQNCGNNSQSHVFFEIYEKISLTWSSTFWILGILKILSFAIYSPLSNLTDSLIFLVLGQNRSNEYSYMRMFGTIGVLVFSIITGLSLFMMDILSTYSSWIAKIQLYSQFSICFLLQAVALIIVIVVIYFIELKKSSEEKLKYKKKSCWSKFLDATSLKFVCSNVELTIFFLFVILGGSVVTVHIEYYMLVIYRKFPTAPKFLPGLLISFMMISEITVLGVSGKMF---------------------------NYF-----KLIHGTTFGLQFSAMVTYIGKTTSSSAQGRIQGLFSSLFFN 454          
The following BLAST results are available for this feature:
BLAST of MFS_1_like domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
MFSD62.776e-822.41major facilitator superfamily domain containing 6 ... [more]
MFSD62.776e-822.41major facilitator superfamily domain containing 6 ... [more]
back to top
BLAST of MFS_1_like domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MFS_1_like domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG157062.932e-1725.16gene:FBgn0034093 transcript:FBtr0340024[more]
CG157062.932e-1725.16gene:FBgn0034093 transcript:FBtr0344080[more]
CG157062.932e-1725.16gene:FBgn0034093 transcript:FBtr0087191[more]
CG157062.932e-1725.16gene:FBgn0034093 transcript:FBtr0344081[more]
CG157062.932e-1725.16gene:FBgn0034093 transcript:FBtr0344079[more]
back to top
BLAST of MFS_1_like domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MFS_1_like domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MFS_1_like domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Mfsd63.511e-821.71major facilitator superfamily domain containing 6 ... [more]
Mfsd67.615e-821.71major facilitator superfamily domain containing 6 ... [more]
back to top
BLAST of MFS_1_like domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|A1DWM3|MFSD6_PIG6.901e-823.83Major facilitator superfamily domain-containing pr... [more]
sp|Q6ZSS7|MFSD6_HUMAN1.333e-722.41Major facilitator superfamily domain-containing pr... [more]
sp|Q8CBH5|MFSD6_MOUSE2.456e-721.71Major facilitator superfamily domain-containing pr... [more]
back to top
BLAST of MFS_1_like domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267FST25.277e-3128.07MFS domain-containing protein OS=Macrostomum ligna... [more]
A0A1I8JJH31.498e-3028.22MFS domain-containing protein OS=Macrostomum ligna... [more]
A0A1I8FYA31.281e-2927.80MFS domain-containing protein OS=Macrostomum ligna... [more]
A0A195FX431.770e-2023.84Major facilitator superfamily domain-containing pr... [more]
A0A151WW361.701e-1925.34Major facilitator superfamily domain-containing pr... [more]
back to top
BLAST of MFS_1_like domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MFS_1_like domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mfsd6a3.509e-634.15major facilitator superfamily domain containing 6a... [more]
back to top
BLAST of MFS_1_like domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MFS_1_like domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO376071.282e-935.79Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO374305.143e-727.07Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO316819.115e-723.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO470605.909e-623.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of MFS_1_like domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MFS_1_like domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000030270.10.000e+098.71SMESG000030270.1[more]
SMESG000008715.17.685e-8836.04SMESG000008715.1[more]
SMESG000008712.18.431e-8435.73SMESG000008712.1[more]
SMESG000008712.15.336e-6933.87SMESG000008712.1[more]
SMESG000008712.12.820e-5732.00SMESG000008712.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028189 ID=SMED30028189|Name=MFS_1_like domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1845bp
ATTTATAGTAAAATCATTTATAATATTTATAATATTTTTAATATTTAATT
TGTCGTGAGTTTGCATAGAAAATGATTTGTAAAATCAATAGAGATCTATT
AATAATAAAATCTCTTTACTTTTTTGAACTTTCTGTTGTAGCATGCCTGT
TTATTTACTTAAATCCTTTTATGGTCGAACGTGGAGTGTCTGGATCAGAG
CTAGCTGTTATTAATTTTGTAGCTCACATTGTGGCTTTTTTCACTCGACC
TTTCTTTGGCTACATGGCTGACAAACATCAAAGATACAGAGAAATTCTTG
CTGTTAGCGCGGCTCTGTGCTTCATCATAAATTTGGTGCAATTATTTATT
CCCAAGTATCAAAAGTCTAACCAGTATTTCTTATTGGCCAATTTTGAAGG
AAATGACAATTTTACCGTTTGCTTTTCCAATTCATCGAACATACTTTGTC
AACCTTGTAACAATGGTTCGAGTTCACAAGTTTTAGATGTTTCTATTTAT
CGGTATCCAATCAACATATCGTGCTCGGGAATTCCGATCTTCAAATTGAA
TTCAACCAATCATTTTAATGCTTCTAATTTTTGCAATAATTTATCCACAC
CTTGTTTTGATTACCTCAAGTCTTTGAATAAATCAGAAACCAATTCTGGA
CTGACATGGTCATTAACGTTTTGGTTGTTTTTGATTTGCAAAATCCTTGG
ACATACGTTCTATTCAGCGAATATTAGTCTCACTGATGCCGTAACATTTG
TCACGTTAGGAAAGGACAAATGCCATAAGTTTGGGGTTACAAGAATGTTT
GGAACTCTGGGAATCCTTGTATTCTCTTTAACAACAGCAGTTATGTTGCA
ACTCTTCTTCCAACAACCGAATTACTCATGGATTTCATATCTAAAATCTG
TTAGTAGCTATACTCCATGTTTTATTTTGGGCTTAGCTATGTTCGCTTTT
GTTGTGCTATTTTCGTTACTTTTGGGAAATGACAAACCGTTGCACTCGGA
ACCATTTTGGACGTCTCTGGGTTTGCTTTTTCGTAATCTTGAAATTTCAA
TATTTTTTATTTTTTCAATTTTTGGAGGATTTATTTTTTCAACGCTCATC
GAATACTATTTTATTGTAATATTTCAAATGTTTCCTCAAATGCCGAAATA
TTTCCCAGGACTTATATTTGCTGTTATGACAATCGCCGAGGCGATCTTTA
ACGGCGCTTCTTCTATTATTCTAAAATTTGCGAACGATGAATTTTGGATA
TCTTTTGCGTTCTTTACATGGGCCCTCAGATGGTTGAGTTATTATTTAAT
TACAAATTATTGGTTCTTCTTGATGATTGAATTCCTCAACGGGCCAGCCT
TCGGGCTATTGCTACCATGTATGATGGCGCATATCAGCAAATTCGCCAAC
AGATCAACGCAAGGCCGGGTGCAATGCGTTTTTGCTGGGTTATTTTTCAA
TATCGGAGGGGCTCTTGGTGCTCTGTATGGAGGAATAATTCTTGACCAAT
TTGGCTACCATGCTTTATTCGTATCAATGATAGCTATCTCGGCCTTTTGT
TCCATTATATATTACCCATTGCAGAAGTTATTGATACCGTACTGTGCTAA
TAAGGCGACCAACCGAGAGAACCAGGATGATAAGTTAAATGTGGAGAATC
GCAATCCCTTGTTAGAGGTTGAAATTAATGGAACAATTCCTTGTTAAAGT
TCGATCCTATTGTTATTAAACGTTCGGTTTTATCATGGGTTTTAAGGTGT
GTTTTAGTTGATTGGTTAATTTTGTTTTACGTTTTGTTTAAATGAGAAAA
TGTAATAATTTTTAATTTGTGTTTTATTAATAAATATTCAGTGAC
back to top

protein sequence of SMED30028189-orf-1

>SMED30028189-orf-1 ID=SMED30028189-orf-1|Name=SMED30028189-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=542bp
MICKINRDLLIIKSLYFFELSVVACLFIYLNPFMVERGVSGSELAVINFV
AHIVAFFTRPFFGYMADKHQRYREILAVSAALCFIINLVQLFIPKYQKSN
QYFLLANFEGNDNFTVCFSNSSNILCQPCNNGSSSQVLDVSIYRYPINIS
CSGIPIFKLNSTNHFNASNFCNNLSTPCFDYLKSLNKSETNSGLTWSLTF
WLFLICKILGHTFYSANISLTDAVTFVTLGKDKCHKFGVTRMFGTLGILV
FSLTTAVMLQLFFQQPNYSWISYLKSVSSYTPCFILGLAMFAFVVLFSLL
LGNDKPLHSEPFWTSLGLLFRNLEISIFFIFSIFGGFIFSTLIEYYFIVI
FQMFPQMPKYFPGLIFAVMTIAEAIFNGASSIILKFANDEFWISFAFFTW
ALRWLSYYLITNYWFFLMIEFLNGPAFGLLLPCMMAHISKFANRSTQGRV
QCVFAGLFFNIGGALGALYGGIILDQFGYHALFVSMIAISAFCSIIYYPL
QKLLIPYCANKATNRENQDDKLNVENRNPLLEVEINGTIPC*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036259MFS_trans_sf
IPR024989MFS_assoc_dom
IPR020846MFS_dom
Vocabulary: molecular function
TermDefinition
GO:0022857transmembrane transporter activity
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:1.20.1250.20coord: 4..107
e-value: 3.1E-8
score: 35.2
NoneNo IPR availableGENE3DG3DSA:1.20.1250.20coord: 314..503
e-value: 8.5E-28
score: 99.1
NoneNo IPR availablePANTHERPTHR16172UNCHARACTERIZEDcoord: 1..515
NoneNo IPR availableCDDcd17335MFS_MFSD6coord: 11..493
e-value: 4.16586E-23
score: 99.1953
NoneNo IPR availableTMHMMTMhelixcoord: 41..63
NoneNo IPR availableTMHMMTMhelixcoord: 198..220
NoneNo IPR availableTMHMMTMhelixcoord: 9..31
NoneNo IPR availableTMHMMTMhelixcoord: 414..431
NoneNo IPR availableTMHMMTMhelixcoord: 75..94
NoneNo IPR availableTMHMMTMhelixcoord: 365..384
NoneNo IPR availableTMHMMTMhelixcoord: 278..300
NoneNo IPR availableTMHMMTMhelixcoord: 478..500
NoneNo IPR availableTMHMMTMhelixcoord: 452..474
NoneNo IPR availableTMHMMTMhelixcoord: 241..263
NoneNo IPR availableTMHMMTMhelixcoord: 391..410
NoneNo IPR availableTMHMMTMhelixcoord: 328..350
IPR024989Major facilitator superfamily associated domainPFAMPF12832MFS_1_likecoord: 10..483
e-value: 7.1E-48
score: 163.4
IPR020846Major facilitator superfamily domainPROSITEPS50850MFScoord: 310..541
score: 9.123
IPR036259MFS transporter superfamilySUPERFAMILYSSF103473MFS general substrate transportercoord: 6..504