SMED30028183

Overview
NameSMED30028183
Smed IDSMED30028183
Length (bp)2018
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30028183 (SMED30028183) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30028183 (SMED30028183) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30028183 (SMED30028183) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30028183 (SMED30028183) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028183

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
testis primordiumSMED30028183SMESG000071581.1 gnl|ti|1450467405_WUSTLGPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Alignments
SMED30028183 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.008258:11617..13762 +10054
Homology
BLAST of SMED30028183 vs. Ensembl Human
Match: ZNF525 (zinc finger protein 525 [Source:HGNC Symbol;Acc:HGNC:29423])

HSP 1 Score: 56.225 bits (134), Expect = 1.227e-7
Identity = 55/193 (28.50%), Postives = 81/193 (41.97%), Query Frame = 2
Query:  905 TDESEEKLQPKSSESVKKYSPTTSVVNIESSEKKHDIIFSSTKFNQTYKCTVCDRQFKRKFCLTRHKRVHQNYKTYLCNICGLGFDLLNQLKRHLRNTHACSR----ENLRRSCRNNSKSEQVIKAPTEQYCPIDCTWSMPKASSQLSLLPAKQIAASTAPSDISTSKTVCFNQFPFPPGL---IIANSGKKP 1462
            T   E +++ KS + ++    +    N  S  +KH II    K    YKC VCD+ F RK  L RH+R H   K Y CN CG  F  ++ L  H R  H   +    E   ++ R+NS  ++  +  T +  P  C       S +  L   + I     P +       C   F F   L    I ++G+KP
Sbjct:  203 TQRQEVRMREKSFQCIE----SGKAFNYSSLLRKHQIIHLGEK---QYKCDVCDKVFIRKRYLARHRRCHTGEKPYKCNECGKSFSQMSSLTYHHR-LHTGEKPYKCEECDKAFRHNSALQRHRRIHTGEK-PHKCNECGKTFSQKSYLACHRSIHTGKKPYECEE----CDKAFSFKSNLESHRITHTGEKP 382          
BLAST of SMED30028183 vs. Ensembl Human
Match: ZNF525 (zinc finger protein 525 [Source:HGNC Symbol;Acc:HGNC:29423])

HSP 1 Score: 56.225 bits (134), Expect = 1.436e-7
Identity = 55/193 (28.50%), Postives = 81/193 (41.97%), Query Frame = 2
Query:  905 TDESEEKLQPKSSESVKKYSPTTSVVNIESSEKKHDIIFSSTKFNQTYKCTVCDRQFKRKFCLTRHKRVHQNYKTYLCNICGLGFDLLNQLKRHLRNTHACSR----ENLRRSCRNNSKSEQVIKAPTEQYCPIDCTWSMPKASSQLSLLPAKQIAASTAPSDISTSKTVCFNQFPFPPGL---IIANSGKKP 1462
            T   E +++ KS + ++    +    N  S  +KH II    K    YKC VCD+ F RK  L RH+R H   K Y CN CG  F  ++ L  H R  H   +    E   ++ R+NS  ++  +  T +  P  C       S +  L   + I     P +       C   F F   L    I ++G+KP
Sbjct:  167 TQRQEVRMREKSFQCIE----SGKAFNYSSLLRKHQIIHLGEK---QYKCDVCDKVFIRKRYLARHRRCHTGEKPYKCNECGKSFSQMSSLTYHHR-LHTGEKPYKCEECDKAFRHNSALQRHRRIHTGEK-PHKCNECGKTFSQKSYLACHRSIHTGKKPYECEE----CDKAFSFKSNLESHRITHTGEKP 346          
BLAST of SMED30028183 vs. Ensembl Human
Match: ZNF808 (zinc finger protein 808 [Source:HGNC Symbol;Acc:HGNC:33230])

HSP 1 Score: 54.6842 bits (130), Expect = 5.060e-7
Identity = 32/85 (37.65%), Postives = 42/85 (49.41%), Query Frame = 2
Query:  938 SSESVKKYSPTTSVVNIESSEKKHDIIFSSTKFNQTYKCTVCDRQFKRKFCLTRHKRVHQNYKTYLCNICGLGFDLLNQLKRHLR 1192
            S E   K +      N +SS  +H I+ +  K    YKC  CD+ F +K  L RHKR+H   K Y C +C   F   +QL RH R
Sbjct:  394 SGEKTYKCNECGKAFNHQSSLARHHILHTGEK---PYKCEECDKVFSQKSTLERHKRIHTGEKPYKCKVCDTAFTCNSQLARHRR 475          

HSP 2 Score: 51.6026 bits (122), Expect = 4.879e-6
Identity = 25/51 (49.02%), Postives = 31/51 (60.78%), Query Frame = 2
Query: 1040 QTYKCTVCDRQFKRKFCLTRHKRVHQNYKTYLCNICGLGFDLLNQLKRHLR 1192
            ++YKCTVCD+ F R   L RH R+H   K Y CN CG  F+  + L RH R
Sbjct:  789 KSYKCTVCDKAFVRNSYLARHIRIHTAEKPYKCNECGKAFNEQSHLSRHHR 839          
BLAST of SMED30028183 vs. Ensembl Human
Match: ZNF557 (zinc finger protein 557 [Source:HGNC Symbol;Acc:HGNC:28632])

HSP 1 Score: 54.299 bits (129), Expect = 5.596e-7
Identity = 53/177 (29.94%), Postives = 73/177 (41.24%), Query Frame = 2
Query: 1046 YKCTVCDRQFKRKFCLTRHKRVHQNYKTYLCNICGLGFDLLNQLKRHLR--------NTHACSRENLRRSCRNNSKSEQVIKAPTEQYCPIDCTWSMPKASSQLSLLPAKQI---AASTAPSDISTSKTVCFNQFPFPPGLIIANSGKKPSPSAF-SQTFTTPT--SVSTQYQVRQM 1534
            YKC  C R+F+ +   TRHKRVH     Y+CN CG  F   + L  H            H C R   RR     S   Q I+  T +  P  C       ++  SL   ++I     S   SD   S    FN        +  ++GKKP    +  ++FT+ +  SV T+   RQM
Sbjct:  257 YKCNQCFREFRTQSIFTRHKRVHTGEGHYVCNQCGKAFGTRSSLSSHYSIHTGEYPYECHDCGRTFRRR-----SNLTQHIRTHTGEK-PYTCNECGKSFTNSFSLTIHRRIHNGEKSYECSDCGKS----FNVLSSVKKHMRTHTGKKPYECNYCGKSFTSNSYLSVHTRMHNRQM 423          
BLAST of SMED30028183 vs. Ensembl Human
Match: ZNF808 (zinc finger protein 808 [Source:HGNC Symbol;Acc:HGNC:33230])

HSP 1 Score: 54.299 bits (129), Expect = 7.007e-7
Identity = 32/85 (37.65%), Postives = 42/85 (49.41%), Query Frame = 2
Query:  938 SSESVKKYSPTTSVVNIESSEKKHDIIFSSTKFNQTYKCTVCDRQFKRKFCLTRHKRVHQNYKTYLCNICGLGFDLLNQLKRHLR 1192
            S E   K +      N +SS  +H I+ +  K    YKC  CD+ F +K  L RHKR+H   K Y C +C   F   +QL RH R
Sbjct:  325 SGEKTYKCNECGKAFNHQSSLARHHILHTGEK---PYKCEECDKVFSQKSTLERHKRIHTGEKPYKCKVCDTAFTCNSQLARHRR 406          

HSP 2 Score: 51.2174 bits (121), Expect = 6.269e-6
Identity = 25/51 (49.02%), Postives = 31/51 (60.78%), Query Frame = 2
Query: 1040 QTYKCTVCDRQFKRKFCLTRHKRVHQNYKTYLCNICGLGFDLLNQLKRHLR 1192
            ++YKCTVCD+ F R   L RH R+H   K Y CN CG  F+  + L RH R
Sbjct:  720 KSYKCTVCDKAFVRNSYLARHIRIHTAEKPYKCNECGKAFNEQSHLSRHHR 770          
BLAST of SMED30028183 vs. Ensembl Celegans
Match: lsl-1 (LSY-2-Like [Source:UniProtKB/TrEMBL;Acc:O02273])

HSP 1 Score: 58.5362 bits (140), Expect = 4.715e-9
Identity = 33/91 (36.26%), Postives = 49/91 (53.85%), Query Frame = 2
Query: 1001 KKHDIIFSSTKFNQTYKCTVCDRQFKRKFCLTRHKRVHQNYKTYLCNICGLGFDLLNQLKRHLRNTHACSRENLRRSCR---NNSKSEQVI 1264
            ++H +I + TK    Y C VC R F+ K  +  H+ VH  Y  Y+C  CG  F L   +K+H+R TH  S+E L  + R   +N +S  +I
Sbjct:   53 QQHSVIHTDTK---PYICDVCGRGFRYKSNMFEHRTVHTGYTPYVCPFCGKQFRLKGNMKKHMR-THVTSKEELEAAYRPYSSNRRSSGII 139          
BLAST of SMED30028183 vs. Ensembl Celegans
Match: lsl-1 (LSY-2-Like [Source:UniProtKB/TrEMBL;Acc:O02273])

HSP 1 Score: 58.5362 bits (140), Expect = 4.715e-9
Identity = 33/91 (36.26%), Postives = 49/91 (53.85%), Query Frame = 2
Query: 1001 KKHDIIFSSTKFNQTYKCTVCDRQFKRKFCLTRHKRVHQNYKTYLCNICGLGFDLLNQLKRHLRNTHACSRENLRRSCR---NNSKSEQVI 1264
            ++H +I + TK    Y C VC R F+ K  +  H+ VH  Y  Y+C  CG  F L   +K+H+R TH  S+E L  + R   +N +S  +I
Sbjct:   53 QQHSVIHTDTK---PYICDVCGRGFRYKSNMFEHRTVHTGYTPYVCPFCGKQFRLKGNMKKHMR-THVTSKEELEAAYRPYSSNRRSSGII 139          
BLAST of SMED30028183 vs. Ensembl Celegans
Match: Y37E11B.1 (pep chromosome:WBcel235:IV:3578937:3580992:1 gene:WBGene00021374.1 transcript:Y37E11B.1b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y37E11B.1)

HSP 1 Score: 51.9878 bits (123), Expect = 1.595e-7
Identity = 34/114 (29.82%), Postives = 57/114 (50.00%), Query Frame = 2
Query:  857 TDNSAVQSDLISKSNETDESEEKLQPKSSESVKKYSPTTSVVNIESSE--KKHDIIFSSTKFNQTYKCTVCDRQFKRKFCLTRHKRVHQNYKTYLCNICGLGFDLLNQLKRHLR 1192
            T   A Q ++  +  ++DES  K +    E+ +K   +T      ++E  +KH I+    K  ++  C VC +++  K  L +HKR H+  K + C +C   FDL +  K HLR
Sbjct:    7 TSRDAAQCEICGRILKSDESLRKHERIHDEAERKLECSTCQKRFHNAELLRKHQIVHDIPK--KSIICEVCGKKYSSKSALAKHKRTHETDKRFTCPMCYASFDLSDPFKIHLR 118          
BLAST of SMED30028183 vs. Ensembl Celegans
Match: lin-48 (Putative zinc finger transcription factor [Source:UniProtKB/TrEMBL;Acc:G5EDU6])

HSP 1 Score: 51.2174 bits (121), Expect = 1.127e-6
Identity = 24/61 (39.34%), Postives = 33/61 (54.10%), Query Frame = 2
Query: 1031 KFNQTYKCTVCDRQFKRKFCLTRHKRVHQNYKTYLCNICGLGFDLLNQLKRHLRNTHACSR 1213
            +F  +  C +C ++F  +  L RH + H + K YLC  CG GF+    LKRH R TH   R
Sbjct:  128 EFQDSLTCHICGKKFGLQRLLNRHIKCHSDLKRYLCTFCGKGFNDTFDLKRHTR-THTGVR 187          
BLAST of SMED30028183 vs. Ensembl Celegans
Match: egl-43 (pep chromosome:WBcel235:II:9960333:9962344:1 gene:WBGene00001207.1 transcript:R53.3b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:egl-43)

HSP 1 Score: 50.8322 bits (120), Expect = 1.818e-6
Identity = 21/52 (40.38%), Postives = 27/52 (51.92%), Query Frame = 2
Query: 1046 YKCTVCDRQFKRKFCLTRHKRVHQNYKTYLCNICGLGFDLLNQLKRHLRNTH 1201
            Y C  C + F R   LTRH R H   + Y C  C   F + + L+RH+RN H
Sbjct:  223 YTCKFCQKVFPRSANLTRHLRTHTGEQPYKCQYCERSFSISSNLQRHVRNIH 274          
BLAST of SMED30028183 vs. Ensembl Fly
Match: klu (gene:FBgn0013469 transcript:FBtr0076247)

HSP 1 Score: 56.225 bits (134), Expect = 9.484e-8
Identity = 29/84 (34.52%), Postives = 38/84 (45.24%), Query Frame = 2
Query: 1040 QTYKCTVCDRQFKRKFCLTRHKRVHQNYKTYLCNICGLGFDLLNQLKRHLRNTH--------------ACSRENLRRSCRNNSK 1249
            + Y C VC R F R   LTRH R+H   K Y C +CG  F   + L  H R TH              AC R+ + R  R +++
Sbjct:  624 KAYSCDVCRRSFARSDMLTRHMRLHTGVKPYTCKVCGQVFSRSDHLSTHQR-THTGEKPYKCPQCPYAACRRDMITRHMRTHTR 706          
BLAST of SMED30028183 vs. Ensembl Fly
Match: klu (gene:FBgn0013469 transcript:FBtr0333361)

HSP 1 Score: 56.225 bits (134), Expect = 9.484e-8
Identity = 29/84 (34.52%), Postives = 38/84 (45.24%), Query Frame = 2
Query: 1040 QTYKCTVCDRQFKRKFCLTRHKRVHQNYKTYLCNICGLGFDLLNQLKRHLRNTH--------------ACSRENLRRSCRNNSK 1249
            + Y C VC R F R   LTRH R+H   K Y C +CG  F   + L  H R TH              AC R+ + R  R +++
Sbjct:  624 KAYSCDVCRRSFARSDMLTRHMRLHTGVKPYTCKVCGQVFSRSDHLSTHQR-THTGEKPYKCPQCPYAACRRDMITRHMRTHTR 706          
BLAST of SMED30028183 vs. Ensembl Fly
Match: klu (gene:FBgn0013469 transcript:FBtr0345346)

HSP 1 Score: 56.225 bits (134), Expect = 9.484e-8
Identity = 29/84 (34.52%), Postives = 38/84 (45.24%), Query Frame = 2
Query: 1040 QTYKCTVCDRQFKRKFCLTRHKRVHQNYKTYLCNICGLGFDLLNQLKRHLRNTH--------------ACSRENLRRSCRNNSK 1249
            + Y C VC R F R   LTRH R+H   K Y C +CG  F   + L  H R TH              AC R+ + R  R +++
Sbjct:  624 KAYSCDVCRRSFARSDMLTRHMRLHTGVKPYTCKVCGQVFSRSDHLSTHQR-THTGEKPYKCPQCPYAACRRDMITRHMRTHTR 706          
BLAST of SMED30028183 vs. Ensembl Fly
Match: klu (gene:FBgn0013469 transcript:FBtr0330080)

HSP 1 Score: 55.8398 bits (133), Expect = 1.224e-7
Identity = 29/84 (34.52%), Postives = 38/84 (45.24%), Query Frame = 2
Query: 1040 QTYKCTVCDRQFKRKFCLTRHKRVHQNYKTYLCNICGLGFDLLNQLKRHLRNTH--------------ACSRENLRRSCRNNSK 1249
            + Y C VC R F R   LTRH R+H   K Y C +CG  F   + L  H R TH              AC R+ + R  R +++
Sbjct:  624 KAYSCDVCRRSFARSDMLTRHMRLHTGVKPYTCKVCGQVFSRSDHLSTHQR-THTGEKPYKCPQCPYAACRRDMITRHMRTHTR 706          
BLAST of SMED30028183 vs. Ensembl Fly
Match: erm (gene:FBgn0031375 transcript:FBtr0330200)

HSP 1 Score: 52.373 bits (124), Expect = 1.084e-6
Identity = 23/61 (37.70%), Postives = 30/61 (49.18%), Query Frame = 2
Query: 1004 KHDIIFSSTKFNQTYKCTVCDRQFKRKFCLTRHKRVHQNYKTYLCNICGLGFDLLNQLKRH 1186
            +H II +S K    +KC  C + F R   L  H R+H  YK ++C  CG GF      K H
Sbjct:  355 RHKIIHTSEK---PHKCQTCGKAFNRSSTLNTHSRIHAGYKPFVCEYCGKGFHQKGNYKNH 412          

HSP 2 Score: 51.9878 bits (123), Expect = 1.517e-6
Identity = 24/67 (35.82%), Postives = 34/67 (50.75%), Query Frame = 2
Query: 1001 KKHDIIFSSTKFNQTYKCTVCDRQFKRKFCLTRHKRVHQNYKTYLCNICGLGFDLLNQLKRHLRNTH 1201
            K H +  S  K    YKC +C++ F + + LT H   H + K Y C +C  GF     LK+H+R  H
Sbjct:  410 KNHKLTHSGEK---AYKCNICNKAFHQVYNLTFHMHTHNDKKPYTCRVCAKGFCRNFDLKKHMRKLH 473          

HSP 3 Score: 51.2174 bits (121), Expect = 3.046e-6
Identity = 32/112 (28.57%), Postives = 51/112 (45.54%), Query Frame = 2
Query:  851 RKTDNSAVQSDLISKSNETDESEEKLQPKSSESVKKYSPTTSVVNIESSEKKHDIIFSSTKFNQTYKCTVCDRQFKRKFCLTRHKRVHQNYKTYLCNICGLGFDLLNQLKRH 1186
            R   +S +Q++L  K +  D+ E    P S+ +    + + S     S E       S  K  +T+ C  C + F   + LTRH  VH   + ++C +CG GF   + L RH
Sbjct:  246 RTAQSSGLQANLKRKRSPQDQGEVTPPPASTATSATGARSRSPSPQGSIEDSSPGSASGGK-PKTFSCLECGKVFNAHYNLTRHMPVHTGARPFVCKVCGKGFRQASTLCRH 356          
BLAST of SMED30028183 vs. Ensembl Zebrafish
Match: si:ch1073-224n8.1 (si:ch1073-224n8.1 [Source:ZFIN;Acc:ZDB-GENE-030131-5649])

HSP 1 Score: 54.6842 bits (130), Expect = 2.701e-7
Identity = 30/70 (42.86%), Postives = 38/70 (54.29%), Query Frame = 2
Query:  992 SSEKKHDIIFSSTKFNQTYKCTVCDRQFKRKFCLTRHKRVHQNYKTYLCNICGLGFDLLNQLKRHLRNTH 1201
            SS KKH  I +  K    Y CTVC R+F+    L  H R+H   K Y C+ CG  F  L+ L++H R TH
Sbjct:  404 SSLKKHLRIHTGEK---PYPCTVCGRRFRESGALKTHLRIHTGEKPYSCSDCGTQFRHLDGLRKH-RRTH 469          
BLAST of SMED30028183 vs. Ensembl Zebrafish
Match: vezf1b (vascular endothelial zinc finger 1b [Source:ZFIN;Acc:ZDB-GENE-060825-121])

HSP 1 Score: 52.7582 bits (125), Expect = 1.042e-6
Identity = 21/58 (36.21%), Postives = 36/58 (62.07%), Query Frame = 2
Query: 1046 YKCTVCDRQFKRKFCLTRHKRVHQN--YKTYLCNICGLGFDLLNQLKRHLRNTHACSR 1213
            ++C +C ++FKRK  +T H R H    +K Y+C++CG GF   + L  H+++ H+  R
Sbjct:  220 FECPICHQRFKRKDRMTYHVRSHDGGVHKPYICSVCGKGFSRPDHLSCHVKHVHSTER 277          
BLAST of SMED30028183 vs. Ensembl Zebrafish
Match: vezf1a (vascular endothelial zinc finger 1a [Source:ZFIN;Acc:ZDB-GENE-040108-4])

HSP 1 Score: 52.373 bits (124), Expect = 1.339e-6
Identity = 21/58 (36.21%), Postives = 36/58 (62.07%), Query Frame = 2
Query: 1046 YKCTVCDRQFKRKFCLTRHKRVHQN--YKTYLCNICGLGFDLLNQLKRHLRNTHACSR 1213
            ++C +C ++FKRK  +T H R H    +K Y+C++CG GF   + L  H+++ H+  R
Sbjct:  226 FECPICQQRFKRKDRMTYHVRSHDGGVHKPYVCSVCGKGFSRPDHLSCHVKHVHSSER 283          
BLAST of SMED30028183 vs. Ensembl Zebrafish
Match: ovol1a (ovo-like zinc finger 1a [Source:ZFIN;Acc:ZDB-GENE-031010-37])

HSP 1 Score: 51.6026 bits (122), Expect = 1.524e-6
Identity = 25/59 (42.37%), Postives = 33/59 (55.93%), Query Frame = 2
Query: 1037 NQTYKCTVCDRQFKRKFCLTRHKRVHQNYKTYLCNICGLGFDLLNQLKRHLRNTHACSR 1213
              TY C VC + F+ +  L RH + H   K +LC+ CG GF+    LKRH+R TH   R
Sbjct:  156 GATYVCQVCQKVFQFQRMLNRHLKCHSEQKRHLCDFCGKGFNDTFDLKRHVR-THTGVR 213          
BLAST of SMED30028183 vs. Ensembl Zebrafish
Match: znf740a (zinc finger protein 740a [Source:ZFIN;Acc:ZDB-GENE-030131-5064])

HSP 1 Score: 46.9802 bits (110), Expect = 1.635e-6
Identity = 19/49 (38.78%), Postives = 29/49 (59.18%), Query Frame = 2
Query: 1040 QTYKCTVCDRQFKRKFCLTRHKRVHQNYKTYLCNICGLGFDLLNQLKRH 1186
            + Y C++CDR+F +++ L RH   H   K Y C+IC + F     L+RH
Sbjct:    5 KPYACSMCDRRFFQRYHLQRHSLTHTGVKPYACSICDMRFFQRYHLQRH 53          
BLAST of SMED30028183 vs. Ensembl Xenopus
Match: ENSXETT00000035414.1 (zinc finger protein 91 [Source:NCBI gene;Acc:100488674])

HSP 1 Score: 55.0694 bits (131), Expect = 3.913e-7
Identity = 33/84 (39.29%), Postives = 48/84 (57.14%), Query Frame = 2
Query:  944 ESVKKYSPTTSVVNI-ESSEKKHDIIFSSTKFNQTYKCTVCDRQFKRKFCLTRHKRVHQNYKTYLCNICGLGFDLLNQLKRHLR 1192
            E   KYS T+  + + +SS K + + FS       +KC+VC +QF RK  LT HKR+H   + Y C+ CG GF   + ++RH R
Sbjct:   48 EIYTKYSATSVHLPVGQSSNKLNPVCFS------IHKCSVCGKQFSRKSDLTVHKRIHTGERPYKCSYCGKGFCQASMVRRHER 125          
BLAST of SMED30028183 vs. Ensembl Xenopus
Match: ZBTB40 (zinc finger and BTB domain containing 40 [Source:NCBI gene;Acc:548670])

HSP 1 Score: 53.9138 bits (128), Expect = 1.033e-6
Identity = 24/55 (43.64%), Postives = 27/55 (49.09%), Query Frame = 2
Query: 1037 NQTYKCTVCDRQFKRKFCLTRHKRVHQNYKTYLCNICGLGFDLLNQLKRHLRNTH 1201
             + Y C  CD  F +   LTRH R H   K Y+C  CG GF   N L  HLR  H
Sbjct:  994 GKMYACQYCDAVFAQSIELTRHVRTHTGDKPYVCRECGKGFSQANGLSIHLRTFH 1048          
BLAST of SMED30028183 vs. Ensembl Xenopus
Match: egr1 (early growth response 1 [Source:NCBI gene;Acc:100038164])

HSP 1 Score: 52.7582 bits (125), Expect = 1.338e-6
Identity = 46/158 (29.11%), Postives = 72/158 (45.57%), Query Frame = 2
Query: 1046 YKCTVCDRQFKRKFCLTRHKRVHQNYKTYLCNICGLGFDLLNQLKRHLRNTHACSRENLRRSCRNNSKSEQV-IKAPTEQY---------CPIDCTWSMPKASSQLSLLPAKQIAASTA---PSDISTSKTVCFNQFPFPPGLIIANSGKKPSPSAFS 1480
            ++C +C R F R   LT H R H   K + C+ICG  F   ++ KRH       ++ +LR+  +   K+  V + +P   Y          P+  ++S P +S+  S + +   + +TA   PS  ST +T     F   P  I+ NS   P  SA S
Sbjct:  310 FQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRH-------TKIHLRQKDKKADKATPVSVASPVSSYSPSASTSYPSPVPTSYSSPVSSAYPSPVHSSFPSPTTAVTYPSVTSTFQTHGITSF---PSSIVTNSFSSPVSSALS 457          
BLAST of SMED30028183 vs. Ensembl Xenopus
Match: nln (neurolysin (metallopeptidase M3 family) [Source:Xenbase;Acc:XB-GENE-960645])

HSP 1 Score: 52.373 bits (124), Expect = 1.396e-6
Identity = 26/77 (33.77%), Postives = 41/77 (53.25%), Query Frame = 2
Query: 1046 YKCTVCDRQFKRKFCLTRHKRVHQN--YKTYLCNICGLGFDLLNQLKRHLRNTHACSRENLRRSCRNNSKSEQVIKA 1270
            Y C VC ++FKRK  +T H R H    +K Y+C+ CG GF   + L  H+R  H+  R    ++C     ++  ++A
Sbjct:  222 YSCHVCQQRFKRKDRMTYHVRSHDGTVHKPYICSHCGKGFSRPDHLNSHVRQVHSTERPFKCQTCEAAFATKDRLRA 298          
BLAST of SMED30028183 vs. Ensembl Xenopus
Match: egr1 (early growth response 1 [Source:NCBI gene;Acc:100038164])

HSP 1 Score: 52.7582 bits (125), Expect = 1.532e-6
Identity = 46/158 (29.11%), Postives = 72/158 (45.57%), Query Frame = 2
Query: 1046 YKCTVCDRQFKRKFCLTRHKRVHQNYKTYLCNICGLGFDLLNQLKRHLRNTHACSRENLRRSCRNNSKSEQV-IKAPTEQY---------CPIDCTWSMPKASSQLSLLPAKQIAASTA---PSDISTSKTVCFNQFPFPPGLIIANSGKKPSPSAFS 1480
            ++C +C R F R   LT H R H   K + C+ICG  F   ++ KRH       ++ +LR+  +   K+  V + +P   Y          P+  ++S P +S+  S + +   + +TA   PS  ST +T     F   P  I+ NS   P  SA S
Sbjct:  337 FQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRH-------TKIHLRQKDKKADKATPVSVASPVSSYSPSASTSYPSPVPTSYSSPVSSAYPSPVHSSFPSPTTAVTYPSVTSTFQTHGITSF---PSSIVTNSFSSPVSSALS 484          
BLAST of SMED30028183 vs. Ensembl Mouse
Match: Zfp740 (zinc finger protein 740 [Source:MGI Symbol;Acc:MGI:1915994])

HSP 1 Score: 51.6026 bits (122), Expect = 2.676e-7
Identity = 27/69 (39.13%), Postives = 37/69 (53.62%), Query Frame = 2
Query: 1001 KKHDIIFSSTKFNQTYKCTVCDRQFKRKFCLTRHKRVHQNYKTYLCNICGLGFDLLNQLKRHLRNTHAC 1207
            K+H +I +  K    ++C VCD +F +K+ L RHKRVH   K Y C  C   F   ++L RH R    C
Sbjct:   67 KRHVLIHTGEK---PFECDVCDMRFIQKYHLERHKRVHSGEKPYQCERCHQCFSRTDRLLRHKRMCQGC 132          
BLAST of SMED30028183 vs. Ensembl Mouse
Match: Zkscan16 (zinc finger with KRAB and SCAN domains 16 [Source:MGI Symbol;Acc:MGI:3510405])

HSP 1 Score: 55.0694 bits (131), Expect = 2.980e-7
Identity = 27/67 (40.30%), Postives = 37/67 (55.22%), Query Frame = 2
Query:  992 SSEKKHDIIFSSTKFNQTYKCTVCDRQFKRKFCLTRHKRVHQNYKTYLCNICGLGFDLLNQLKRHLR 1192
            SS  KH  I +  K    YKC  C + F++  CLTRH+++H   K +LC  CGL F L + +  H R
Sbjct:  552 SSLSKHQRIHTGEK---PYKCNECGKAFRQNSCLTRHQKIHTGEKPFLCKDCGLSFRLFSSIMYHQR 615          
BLAST of SMED30028183 vs. Ensembl Mouse
Match: Zfp493 (zinc finger protein 493 [Source:MGI Symbol;Acc:MGI:1920208])

HSP 1 Score: 53.1434 bits (126), Expect = 6.301e-7
Identity = 27/72 (37.50%), Postives = 38/72 (52.78%), Query Frame = 2
Query:  977 VVNIESSEKKHDIIFSSTKFNQTYKCTVCDRQFKRKFCLTRHKRVHQNYKTYLCNICGLGFDLLNQLKRHLR 1192
              N  S+ K+H  I +  K    YKC VCD+ FK  F   +H+R+H   K Y C +CG  F+  + L +H R
Sbjct:  117 AFNYSSTLKQHQRIHTGEK---PYKCEVCDKAFKYSFSFKQHQRIHTGEKPYKCEVCGKAFNCSSYLGKHQR 185          
BLAST of SMED30028183 vs. Ensembl Mouse
Match: Zfp740 (zinc finger protein 740 [Source:MGI Symbol;Acc:MGI:1915994])

HSP 1 Score: 50.447 bits (119), Expect = 8.479e-7
Identity = 27/69 (39.13%), Postives = 37/69 (53.62%), Query Frame = 2
Query: 1001 KKHDIIFSSTKFNQTYKCTVCDRQFKRKFCLTRHKRVHQNYKTYLCNICGLGFDLLNQLKRHLRNTHAC 1207
            K+H +I +  K    ++C VCD +F +K+ L RHKRVH   K Y C  C   F   ++L RH R    C
Sbjct:   92 KRHVLIHTGEK---PFECDVCDMRFIQKYHLERHKRVHSGEKPYQCERCHQCFSRTDRLLRHKRMCQGC 157          
BLAST of SMED30028183 vs. Ensembl Mouse
Match: Zfp740 (zinc finger protein 740 [Source:MGI Symbol;Acc:MGI:1915994])

HSP 1 Score: 50.8322 bits (120), Expect = 9.116e-7
Identity = 27/69 (39.13%), Postives = 37/69 (53.62%), Query Frame = 2
Query: 1001 KKHDIIFSSTKFNQTYKCTVCDRQFKRKFCLTRHKRVHQNYKTYLCNICGLGFDLLNQLKRHLRNTHAC 1207
            K+H +I +  K    ++C VCD +F +K+ L RHKRVH   K Y C  C   F   ++L RH R    C
Sbjct:  104 KRHVLIHTGEK---PFECDVCDMRFIQKYHLERHKRVHSGEKPYQCERCHQCFSRTDRLLRHKRMCQGC 169          
BLAST of SMED30028183 vs. UniProt/SwissProt
Match: sp|Q6NTY6|EGR1B_XENLA (Early growth response protein 1-B OS=Xenopus laevis OX=8355 GN=egr1-b PE=2 SV=1)

HSP 1 Score: 59.6918 bits (143), Expect = 5.398e-8
Identity = 48/158 (30.38%), Postives = 72/158 (45.57%), Query Frame = 2
Query: 1046 YKCTVCDRQFKRKFCLTRHKRVHQNYKTYLCNICGLGFDLLNQLKRHLRNTHACSRENLRRSCRNNSKSEQV-IKAPTEQY---------CPIDCTWSMPKASSQLSLLPAKQIAASTA---PSDISTSKTVCFNQFPFPPGLIIANSGKKPSPSAFS 1480
            ++C +C R F R   LT H R H   K + C+ICG  F   ++ KRH       ++ +LR+  +   K+  V I +P   Y          P+  ++S P +S   S + +   + +TA   PS  ST +T C   F   P  I+ NS   P  SA S
Sbjct:  314 FQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRH-------TKIHLRQKDKKADKATPVSIASPVSAYSPSASTSYPSPVPTSYSSPVSSCYPSPVHSSFPSPTTAVTYPSVTSTFQTQCITSF---PSSIVTNSYSSPVSSALS 461          
BLAST of SMED30028183 vs. UniProt/SwissProt
Match: sp|Q3B7N9|MYNN_BOVIN (Myoneurin OS=Bos taurus OX=9913 GN=MYNN PE=2 SV=1)

HSP 1 Score: 55.0694 bits (131), Expect = 1.628e-6
Identity = 29/81 (35.80%), Postives = 43/81 (53.09%), Query Frame = 2
Query:  974 SVVNIESSEKKHDIIFSSTKFNQTYK-----CTVCDRQFKRKFCLTRHKRVHQNYKTYLCNICGLGFDLLNQLKRHLRNTH 1201
            S+ NI S +  +++  S  + +Q Y      C  C + F     L RH R+H+  K Y+C++CG  F   NQLK H+R TH
Sbjct:  272 SMSNIASVKNSYELESSGEELDQRYSKAKPMCNTCGKVFSEASSLRRHMRIHKGVKPYVCHLCGKAFTQCNQLKTHVR-TH 351          
BLAST of SMED30028183 vs. UniProt/SwissProt
Match: sp|P0C6Y7|PRDM9_RAT (Histone-lysine N-methyltransferase PRDM9 OS=Rattus norvegicus OX=10116 GN=Prdm9 PE=3 SV=1)

HSP 1 Score: 55.0694 bits (131), Expect = 1.787e-6
Identity = 28/63 (44.44%), Postives = 34/63 (53.97%), Query Frame = 2
Query: 1046 YKCTVCDRQFKRKFCLTRHKRVHQNYKTYLCNICGLGFDLLNQLKRHLRNTHACSRENLRRSC 1234
            Y C  C R F +K  L RH+R H   K Y+C  CGLGF   + L RHLR TH   +  + R C
Sbjct:  658 YICRECGRGFTQKSSLIRHQRTHTGEKPYICRECGLGFTQKSNLIRHLR-THTGEKPYICREC 719          
BLAST of SMED30028183 vs. UniProt/SwissProt
Match: sp|Q8N4W9|ZN808_HUMAN (Zinc finger protein 808 OS=Homo sapiens OX=9606 GN=ZNF808 PE=1 SV=2)

HSP 1 Score: 54.6842 bits (130), Expect = 2.409e-6
Identity = 32/85 (37.65%), Postives = 42/85 (49.41%), Query Frame = 2
Query:  938 SSESVKKYSPTTSVVNIESSEKKHDIIFSSTKFNQTYKCTVCDRQFKRKFCLTRHKRVHQNYKTYLCNICGLGFDLLNQLKRHLR 1192
            S E   K +      N +SS  +H I+ +  K    YKC  CD+ F +K  L RHKR+H   K Y C +C   F   +QL RH R
Sbjct:  394 SGEKTYKCNECGKAFNHQSSLARHHILHTGEK---PYKCEECDKVFSQKSTLERHKRIHTGEKPYKCKVCDTAFTCNSQLARHRR 475          
BLAST of SMED30028183 vs. UniProt/SwissProt
Match: sp|Q8N988|ZN557_HUMAN (Zinc finger protein 557 OS=Homo sapiens OX=9606 GN=ZNF557 PE=1 SV=2)

HSP 1 Score: 54.299 bits (129), Expect = 2.687e-6
Identity = 53/177 (29.94%), Postives = 73/177 (41.24%), Query Frame = 2
Query: 1046 YKCTVCDRQFKRKFCLTRHKRVHQNYKTYLCNICGLGFDLLNQLKRHLR--------NTHACSRENLRRSCRNNSKSEQVIKAPTEQYCPIDCTWSMPKASSQLSLLPAKQI---AASTAPSDISTSKTVCFNQFPFPPGLIIANSGKKPSPSAF-SQTFTTPT--SVSTQYQVRQM 1534
            YKC  C R+F+ +   TRHKRVH     Y+CN CG  F   + L  H            H C R   RR     S   Q I+  T +  P  C       ++  SL   ++I     S   SD   S    FN        +  ++GKKP    +  ++FT+ +  SV T+   RQM
Sbjct:  257 YKCNQCFREFRTQSIFTRHKRVHTGEGHYVCNQCGKAFGTRSSLSSHYSIHTGEYPYECHDCGRTFRRR-----SNLTQHIRTHTGEK-PYTCNECGKSFTNSFSLTIHRRIHNGEKSYECSDCGKS----FNVLSSVKKHMRTHTGKKPYECNYCGKSFTSNSYLSVHTRMHNRQM 423          
BLAST of SMED30028183 vs. TrEMBL
Match: A0A0R3UHI0 (Uncharacterized protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS6798 PE=4 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 2.623e-9
Identity = 36/89 (40.45%), Postives = 48/89 (53.93%), Query Frame = 2
Query:  962 SPTT-----SVVNIESSEKKHDIIFSSTKFNQTYKCTVCDRQFKRKFCLTRHKRVHQNYKTYLCNICGLGFDLLNQLKRHLRNTHACSR 1213
            SPTT     + VN+ SS+   +I  S    ++ YKC  C + F RKFC  RH+R+H   K Y C+IC   F  L   KRH+R+    SR
Sbjct:  504 SPTTRTGLSAAVNVSSSDSASNIGPSIESIHKVYKCRYCGKTFNRKFCRERHERLHTGVKPYTCDICDEKFIRLEDKKRHVRSILHTSR 592          
BLAST of SMED30028183 vs. TrEMBL
Match: A0A5K3ERV3 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 4.503e-9
Identity = 36/89 (40.45%), Postives = 48/89 (53.93%), Query Frame = 2
Query:  962 SPTT-----SVVNIESSEKKHDIIFSSTKFNQTYKCTVCDRQFKRKFCLTRHKRVHQNYKTYLCNICGLGFDLLNQLKRHLRNTHACSR 1213
            SPTT     + VN+ SS+   +I  S    ++ YKC  C + F RKFC  RH+R+H   K Y C+IC   F  L   KRH+R+    SR
Sbjct:  635 SPTTRTGLSAAVNVSSSDSASNIGPSIESIHKVYKCRYCGKTFNRKFCRERHERLHTGVKPYTCDICDEKFIRLEDKKRHVRSILHTSR 723          
BLAST of SMED30028183 vs. TrEMBL
Match: A0A1A9VB91 (Uncharacterized protein OS=Glossina austeni OX=7395 PE=4 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 2.397e-8
Identity = 51/149 (34.23%), Postives = 71/149 (47.65%), Query Frame = 2
Query:  776 KCNTPVTDNELKIDTQFECQSNCKARKTDNSAVQ--SDLISKSNETDESEEKLQPKSSESVKKYSPTTSVVNI--ESSEKKHDIIFSSTKFN------QTYKCTVCDRQFKRKFCLTRHKRVHQNYKTYLCNICGLGFDLLNQLKRHLR 1192
            +CN  VT    K DTQF+ + +  +  T++ A +  S+   KS E D+  E LQ     S        + + I  E  E   D   S T  N      Q Y C +C   + RK+ L  H R H++ KT+ C+ICG  F L  +LKRHLR
Sbjct:  114 ECNDSVTGQTEKNDTQFQNEDSQDSMNTEDFANEEYSEFWLKSTENDDMFENLQDIGEHSDNDDDGGGAGIEITAEDLENSQDSSLSHTNENNRAKEPQKYICDMCGNSYARKYVLEAHMRRHRHDKTFECDICGQAFLLNFELKRHLR 262          
BLAST of SMED30028183 vs. TrEMBL
Match: A0A1B0G7Y6 (Signal recognition particle subunit srp72 OS=Glossina morsitans morsitans OX=37546 PE=4 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 4.243e-8
Identity = 58/180 (32.22%), Postives = 83/180 (46.11%), Query Frame = 2
Query:  722 FRHFVEEDIPNSKEVNKS------KCNTPVTDNELKIDTQFECQSNCKARKTDNSAVQ--SDLISKSNETDESEEKLQPKSSESVKKYSPTTSVVNIESS--EKKHDIIFSSTKFN------QTYKCTVCDRQFKRKFCLTRHKRVHQNYKTYLCNICGLGFDLLNQLKRHLRNTHACSR 1213
             R FV +D+  SKE +        +CN  VT    K DTQF+ + +  +  T++ A +  S+   KS E D+  E LQ     S        + + I +   E   D   S    N      Q Y C +C   + RK+ L  H R H++ KT+ C+ICG  F L  +LKRHLR  H  +R
Sbjct:  733 LREFVCKDV--SKEDSSENEEYLLECNDSVTGQTEKNDTQFQNEDSQDSMNTEDFANEEYSEFWLKSTENDDMFENLQDIGEHSDNDDDGGGAGIEITADDLENSQDSSISHANENNHAKEPQKYICDMCGNSYARKYVLEAHMRRHRHDKTFECDICGQAFLLNFELKRHLRK-HTSAR 909          
BLAST of SMED30028183 vs. TrEMBL
Match: A0A0L0S3P3 (Uncharacterized protein OS=Allomyces macrogynus (strain ATCC 38327) OX=578462 GN=AMAG_02923 PE=4 SV=1)

HSP 1 Score: 66.6254 bits (161), Expect = 6.324e-8
Identity = 25/59 (42.37%), Postives = 35/59 (59.32%), Query Frame = 2
Query: 1037 NQTYKCTVCDRQFKRKFCLTRHKRVHQNYKTYLCNICGLGFDLLNQLKRHLRNTHACSR 1213
            ++ Y C  CDR F RK    RH+R+H   + YLC  CG+GF   + L RHLR+   C++
Sbjct:  260 DRPYACRYCDRTFARKHDCERHQRLHTGDRPYLCGACGIGFPRHDALARHLRSEPECAK 318          
BLAST of SMED30028183 vs. Ensembl Cavefish
Match: e4f1 (E4F transcription factor 1 [Source:NCBI gene;Acc:103032225])

HSP 1 Score: 56.225 bits (134), Expect = 9.785e-8
Identity = 29/72 (40.28%), Postives = 41/72 (56.94%), Query Frame = 2
Query: 1016 IFSSTKFNQTYKCTVCDRQFKRKFCLTRHKRVHQNYKTYLCNICGLGFDLLNQLKRHLRNTHACSRENLRRS 1231
            +F+ T   + +KC +CD  F+ K  L RHKR H + + Y CN CGL F     L RHL++   C+ E +R S
Sbjct:  163 LFTHTD-RKDFKCELCDTAFRTKGSLIRHKRRHTDERPYRCNQCGLSFRESGALTRHLKSLTPCT-EKIRYS 232          
BLAST of SMED30028183 vs. Ensembl Cavefish
Match: ENSAMXT00000036331.1 (pep primary_assembly:Astyanax_mexicanus-2.0:16:6021823:6042084:-1 gene:ENSAMXG00000040806.1 transcript:ENSAMXT00000036331.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 54.6842 bits (130), Expect = 2.734e-7
Identity = 48/186 (25.81%), Postives = 85/186 (45.70%), Query Frame = 2
Query:  989 ESSEKKHDIIFSSTKFNQTYKCTVCDRQFKRKFCLTRHKRVHQNYKTYLCNICGLGFDLLNQLKRHLR-----NTHACSRENLRRSCRNNSKSEQVIKAPTEQYCPIDCTWSMPKASSQLSLLPAKQIAASTAPSDISTSKTVCFNQFPFPPGLIIANSGKKP-SPSAFSQTFTTPTSVSTQYQVR 1528
            +S+ + H +I +  K    + C+ C++ F  +  L  H+R+H   K + C+ CG+ F+  N L+RH R       + CS   +  + ++N K  Q I    + YC  +C  S    + Q SL   + I     P   S  +    NQ  F   L+I ++G+KP   S   ++F   + + T  ++ 
Sbjct:  375 QSNLRTHQLIHTGEK---PFHCSDCEKSFTTQSNLRTHQRIHTGEKRFHCSDCGMNFNQQNSLQRHQRIHTGEKPYHCSECGMNFNQQSNLKKHQHIHTGVKPYCCSECGKSF---TYQSSLQQHQHIHTGEKPYQCSECEKSFNNQSNFKKHLLI-HTGEKPYQCSDCGKSFNNQSGLRTHQRIH 553          
BLAST of SMED30028183 vs. Ensembl Cavefish
Match: ENSAMXT00000052917.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001042.1:47839:50702:1 gene:ENSAMXG00000035649.1 transcript:ENSAMXT00000052917.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.1434 bits (126), Expect = 9.373e-7
Identity = 40/128 (31.25%), Postives = 64/128 (50.00%), Query Frame = 2
Query:  803 ELKIDTQFECQSNCKARKTDNSAVQSDLISKSNETDESEEKLQPKSSESVKKYSPTTSVVNIESSEKKHDIIFSSTKFNQTYKCTVCDRQFKRKFCLTRHKRVHQNYKTYLCNICGLGFDLLNQLKRH 1186
            E+K + +F      K+  T+ +A+ SD   K   +   EE++    SES K +S     +N++     H  + +  K   TY C+ C R F R+  L  H+R+H   K Y C+ CG+ F+  + LKRH
Sbjct:    9 EIKHENEFS-----KSSSTNKTAINSDSSPKEQTSSNIEEEILHHCSESGKSFSKR---INLQM----HQFVHTEEK---TYYCSQCGRSFNRQNNLRNHQRIHTGEKPYHCSECGVSFNRSSSLKRH 121          
BLAST of SMED30028183 vs. Ensembl Cavefish
Match: vezf1a (vascular endothelial zinc finger 1 [Source:NCBI gene;Acc:103021605])

HSP 1 Score: 52.7582 bits (125), Expect = 1.006e-6
Identity = 21/58 (36.21%), Postives = 36/58 (62.07%), Query Frame = 2
Query: 1046 YKCTVCDRQFKRKFCLTRHKRVHQN--YKTYLCNICGLGFDLLNQLKRHLRNTHACSR 1213
            ++C +C ++FKRK  +T H R H    +K Y+C++CG GF   + L  H+++ H+  R
Sbjct:  232 FECPICQQRFKRKDRMTYHVRSHDGGVHKPYVCSVCGKGFSRPDHLSCHVKHVHSSER 289          
BLAST of SMED30028183 vs. Ensembl Cavefish
Match: vezf1a (vascular endothelial zinc finger 1 [Source:NCBI gene;Acc:103021605])

HSP 1 Score: 52.373 bits (124), Expect = 1.033e-6
Identity = 21/58 (36.21%), Postives = 36/58 (62.07%), Query Frame = 2
Query: 1046 YKCTVCDRQFKRKFCLTRHKRVHQN--YKTYLCNICGLGFDLLNQLKRHLRNTHACSR 1213
            ++C +C ++FKRK  +T H R H    +K Y+C++CG GF   + L  H+++ H+  R
Sbjct:  232 FECPICQQRFKRKDRMTYHVRSHDGGVHKPYVCSVCGKGFSRPDHLSCHVKHVHSSER 289          
BLAST of SMED30028183 vs. Ensembl Sea Lamprey
Match: PRDM15 (PR/SET domain 15 [Source:HGNC Symbol;Acc:HGNC:13999])

HSP 1 Score: 53.9138 bits (128), Expect = 1.049e-7
Identity = 30/91 (32.97%), Postives = 45/91 (49.45%), Query Frame = 2
Query:  932 PKSSESVKKY----SPTTSVVNIESSEKKHDIIFSSTKFNQTYKCTVCDRQFKRKFCLTRHKRVHQNYKTYLCNICGLGFDLLNQLKRHLR 1192
            P+S  +V KY         + N   + ++H +I +  K   T+ C VC + F RK  L  H RVH N + YLC  CG G    + L+ H++
Sbjct:  691 PESDPTVHKYIHPCELCGRIFNSSGNLERHRVIHTGEK---THGCDVCGKCFARKDMLKEHMRVHDNIREYLCAECGKGMKTKHALRHHMK 778          
BLAST of SMED30028183 vs. Ensembl Sea Lamprey
Match: PRDM15 (PR/SET domain 15 [Source:HGNC Symbol;Acc:HGNC:13999])

HSP 1 Score: 53.9138 bits (128), Expect = 1.129e-7
Identity = 30/91 (32.97%), Postives = 45/91 (49.45%), Query Frame = 2
Query:  932 PKSSESVKKY----SPTTSVVNIESSEKKHDIIFSSTKFNQTYKCTVCDRQFKRKFCLTRHKRVHQNYKTYLCNICGLGFDLLNQLKRHLR 1192
            P+S  +V KY         + N   + ++H +I +  K   T+ C VC + F RK  L  H RVH N + YLC  CG G    + L+ H++
Sbjct:  681 PESDPTVHKYIHPCELCGRIFNSSGNLERHRVIHTGEK---THGCDVCGKCFARKDMLKEHMRVHDNIREYLCAECGKGMKTKHALRHHMK 768          
BLAST of SMED30028183 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000923.1 (pep scaffold:Pmarinus_7.0:GL480775:18221:19434:-1 gene:ENSPMAG00000000839.1 transcript:ENSPMAT00000000923.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 46.9802 bits (110), Expect = 6.115e-7
Identity = 23/74 (31.08%), Postives = 36/74 (48.65%), Query Frame = 2
Query:  992 SSEKKHDIIFSSTKFNQTYKCTVCDRQFKRKFCLTRHKRVHQNYKTYLCNICGLGFDLLNQLKRHLRNTHACSR 1213
            ++E++H  + +  +    Y C  C R+F++K  L  H R+H   + Y C  CG  F     L RHLR+     R
Sbjct:   35 ANEERHRRVHTGER---PYACAACGRRFRQKPHLAAHTRLHTGERPYACAACGRRFAKPYSLTRHLRSAAHARR 105          
BLAST of SMED30028183 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004838.1 (pep scaffold:Pmarinus_7.0:GL495265:3215:3667:-1 gene:ENSPMAG00000004400.1 transcript:ENSPMAT00000004838.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 46.9802 bits (110), Expect = 8.962e-7
Identity = 25/71 (35.21%), Postives = 34/71 (47.89%), Query Frame = 2
Query: 1001 KKHDIIFSSTKFNQTYKCTVCDRQFKRKFCLTRHKRVHQNYKTYLCNICGLGFDLLNQLKRHLRNTHACSR 1213
            K+H+   +  K    ++C  C R F R+  L  H+RVH   + Y C +CG  F     LK H R TH   R
Sbjct:   33 KRHERTHAGEK---PHRCDACGRAFARRSGLEYHRRVHTGERPYGCEVCGRAFAQYGNLKVH-RRTHTGER 99          
BLAST of SMED30028183 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009831.1 (pep scaffold:Pmarinus_7.0:GL485667:2222:3316:-1 gene:ENSPMAG00000008891.1 transcript:ENSPMAT00000009831.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 48.1358 bits (113), Expect = 1.424e-6
Identity = 20/52 (38.46%), Postives = 28/52 (53.85%), Query Frame = 2
Query: 1037 NQTYKCTVCDRQFKRKFCLTRHKRVHQNYKTYLCNICGLGFDLLNQLKRHLR 1192
             + +KC VC + F R   L  H+RVH   K Y C++CG+ F     L+ H R
Sbjct:   84 GEAHKCDVCGKAFARPEALLSHQRVHMGEKPYRCSVCGMDFTRAEHLRSHHR 135          
BLAST of SMED30028183 vs. Ensembl Yeast
Match: MET31 (Zinc-finger DNA-binding transcription factor; targets strong transcriptional activator Met4p to promoters of sulfur metabolic genes; involved in transcriptional regulation of the methionine biosynthetic genes; feedforward loop controlling expression of MET32 and the lack of such a loop for MET31 may account for the differential actions of Met31p and Met32p; MET31 has a paralog, MET32, that arose from the whole genome duplication [Source:SGD;Acc:S000005959])

HSP 1 Score: 48.521 bits (114), Expect = 4.712e-7
Identity = 28/81 (34.57%), Postives = 42/81 (51.85%), Query Frame = 2
Query: 1025 STKFNQTYKCTVCDRQFKRKFCLTRHKRVHQNYKTYLCNICGLGFDLLNQLKRHLRNTHACSRENLRRSCRNNSKSEQVIK 1267
            S +  Q Y C  C  +F R   L RH++VH     ++C+ CG GF   + LKRH  NT  C R   + S  ++   +++IK
Sbjct:   88 SKEGAQLYSCAKCQLKFSRSSDLRRHEKVHSLVLPHICSNCGKGFARKDALKRH-SNTLTCQRNRKKLSEGSDVDVDELIK 167          
BLAST of SMED30028183 vs. Ensembl Yeast
Match: CRZ1 (Transcription factor, activates transcription of stress response genes; nuclear localization is positively regulated by calcineurin-mediated dephosphorylation; rapidly localizes to the nucleus under blue light stress; can be activated in stochastic pulses of nuclear localization in response to calcium [Source:SGD;Acc:S000004972])

HSP 1 Score: 48.521 bits (114), Expect = 2.978e-6
Identity = 21/62 (33.87%), Postives = 34/62 (54.84%), Query Frame = 2
Query: 1001 KKHDIIFSSTKFNQTYKCTVCDRQFKRKFCLTRHKRVHQNYKTYLCNICGLGFDLLNQLKRH 1186
            +K D + ++ K    + C VC ++F R + L  H R H N + ++C+ICG  F   +  KRH
Sbjct:  554 EKLDSVTNNRKNPANFACDVCGKKFTRPYNLKSHLRTHTNERPFICSICGKAFARQHDRKRH 615          
BLAST of SMED30028183 vs. Ensembl Yeast
Match: MIG2 (Zinc finger transcriptional repressor; cooperates with Mig1p in glucose-induced gene repression; under low glucose conditions relocalizes to mitochondrion, where it interacts with Ups1p, antagonizes mitochondrial fission factor Dnm1p, indicative of a role in mitochondrial fusion or regulating morphology; regulates filamentous growth in response to glucose depletion; activated in stochastic pulses of nuclear localization in response to low glucose [Source:SGD;Acc:S000003177])

HSP 1 Score: 46.9802 bits (110), Expect = 5.685e-6
Identity = 22/67 (32.84%), Postives = 33/67 (49.25%), Query Frame = 2
Query: 1037 NQTYKCTVCDRQFKRKFCLTRHKRVHQNYKTYLCNI--CGLGFDLLNQLKRHLRNTHACSRENLRRS 1231
            N+ ++C  C R F R     RH R H   K + C    CG  F   ++LKRH+R     S+  L+++
Sbjct:   14 NRPFRCDTCHRGFHRLEHKKRHLRTHTGEKPHHCAFPGCGKSFSRSDELKRHMRTHTGQSQRRLKKA 80          
BLAST of SMED30028183 vs. Ensembl Yeast
Match: TDA9 (Transcription factor that regulates acetate production; green fluorescent protein (GFP)-fusion protein localizes to the nucleus; null mutant is sensitive to expression of the top1-T722A allele; not an essential gene; TDA9 has a paralog, RSF2, that arose from the whole genome duplication [Source:SGD;Acc:S000004546])

HSP 1 Score: 47.3654 bits (111), Expect = 7.742e-6
Identity = 20/54 (37.04%), Postives = 28/54 (51.85%), Query Frame = 2
Query: 1046 YKCTVCDRQFKRKFCLTRHKRVHQNYKTYLCNICGLGFDLLNQLKRHLRNTHAC 1207
            + C +C R F R+  L RH+R H N K +LC  CG  F   + + RH    H+ 
Sbjct:   61 FLCHICTRGFVRQEHLKRHQRAHTNEKPFLCVFCGRCFARRDLVLRHQHKLHSA 114          
BLAST of SMED30028183 vs. Ensembl Nematostella
Match: EDO45199 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTE9])

HSP 1 Score: 51.6026 bits (122), Expect = 4.601e-8
Identity = 24/52 (46.15%), Postives = 30/52 (57.69%), Query Frame = 2
Query: 1046 YKCTVCDRQFKRKFCLTRHKRVHQNYKTYLCNICGLGFDLLNQLKRHLRNTH 1201
            YKC +C+  F  +  L RH + H  YK Y C  CG GF+    LKRH+R TH
Sbjct:    1 YKCGLCNASFSLQRLLNRHMKTHSFYKRYHCQFCGKGFNDTFDLKRHIR-TH 51          
BLAST of SMED30028183 vs. Ensembl Nematostella
Match: EDO45255 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTE8])

HSP 1 Score: 51.2174 bits (121), Expect = 6.934e-8
Identity = 24/52 (46.15%), Postives = 29/52 (55.77%), Query Frame = 2
Query: 1046 YKCTVCDRQFKRKFCLTRHKRVHQNYKTYLCNICGLGFDLLNQLKRHLRNTH 1201
            YKC +C   F  +  L RH + H  YK Y C  CG GF+    LKRH+R TH
Sbjct:    8 YKCEICQSSFSLQRLLNRHMKTHSFYKRYHCQFCGKGFNDTFDLKRHIR-TH 58          
BLAST of SMED30028183 vs. Ensembl Nematostella
Match: EDO41141 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S550])

HSP 1 Score: 47.7506 bits (112), Expect = 5.471e-7
Identity = 18/48 (37.50%), Postives = 27/48 (56.25%), Query Frame = 2
Query: 1046 YKCTVCDRQFKRKFCLTRHKRVHQNYKTYLCNICGLGFDLLNQLKRHL 1189
            ++C  C ++F     L RH+R H   + Y C ICG GF+L   L +H+
Sbjct:    1 FRCEQCQKEFDTSAALERHRRSHSGERPYKCKICGWGFNLSGNLNQHM 48          
BLAST of SMED30028183 vs. Ensembl Nematostella
Match: EDO37517 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFL3])

HSP 1 Score: 48.521 bits (114), Expect = 2.519e-6
Identity = 20/49 (40.82%), Postives = 29/49 (59.18%), Query Frame = 2
Query: 1046 YKCTVCDRQFKRKFCLTRHKRVHQNYKTYLCNICGLGFDLLNQLKRHLR 1192
            ++CT C+++FK  + L RH RVH   K Y C  C   F L + L +H+R
Sbjct:  168 FQCTHCEKEFKNSYELGRHVRVHTGEKPYKCTYCSKAFSLTSNLYKHVR 216          
BLAST of SMED30028183 vs. Ensembl Nematostella
Match: EDO46533 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPM1])

HSP 1 Score: 49.6766 bits (117), Expect = 2.838e-6
Identity = 23/50 (46.00%), Postives = 30/50 (60.00%), Query Frame = 2
Query: 1052 CTVCDRQFKRKFCLTRHKRVHQNYKTYLCNICGLGFDLLNQLKRHLRNTH 1201
            C  C + + RK  LTRH RVH   + Y C  CGL F + + LKRH+R+ H
Sbjct:  392 CKYCGKSWLRKADLTRHLRVHTGERPYPCPECGLAFKVSDGLKRHMRSLH 441          
BLAST of SMED30028183 vs. Ensembl Medaka
Match: ENSORLT00000029102.1 (uncharacterized LOC105354939 [Source:NCBI gene;Acc:105354939])

HSP 1 Score: 55.4546 bits (132), Expect = 1.793e-7
Identity = 20/57 (35.09%), Postives = 33/57 (57.89%), Query Frame = 2
Query: 1031 KFNQTYKCTVCDRQFKRKFCLTRHKRVHQNYKTYLCNICGLGFDLLNQLKRHLRNTH 1201
            + N+ + C++C + F     L RH RVH+N + ++C++CG GF     L +HL   H
Sbjct: 1506 ELNKPFSCSLCGKSFLDSAGLKRHGRVHRNGRIHVCHLCGKGFVYKFGLSKHLEMVH 1562          
BLAST of SMED30028183 vs. Ensembl Medaka
Match: ENSORLT00000042764.1 (zinc finger protein 865 [Source:NCBI gene;Acc:101163436])

HSP 1 Score: 55.0694 bits (131), Expect = 2.429e-7
Identity = 23/62 (37.10%), Postives = 34/62 (54.84%), Query Frame = 2
Query: 1001 KKHDIIFSSTKFNQTYKCTVCDRQFKRKFCLTRHKRVHQNYKTYLCNICGLGFDLLNQLKRH 1186
            ++HD I +  K    + CT+C + F+  F L++H+ VH   K Y C ICG  F     L+RH
Sbjct:  969 RRHDRIHTGEK---PHHCTICGKYFREAFHLSKHQTVHSGAKNYKCTICGKEFGYSQSLRRH 1027          
BLAST of SMED30028183 vs. Ensembl Medaka
Match: vezf1a (vascular endothelial zinc finger 1 [Source:NCBI gene;Acc:101164494])

HSP 1 Score: 53.1434 bits (126), Expect = 6.552e-7
Identity = 21/58 (36.21%), Postives = 36/58 (62.07%), Query Frame = 2
Query: 1046 YKCTVCDRQFKRKFCLTRHKRVHQN--YKTYLCNICGLGFDLLNQLKRHLRNTHACSR 1213
            ++C +C ++FKRK  +T H R H    +K Y+C++CG GF   + L  H+++ H+  R
Sbjct:  221 FECPICQQRFKRKDRMTYHVRSHDGGVHKPYVCSVCGKGFSRPDHLSCHVKHVHSSER 278          
BLAST of SMED30028183 vs. Ensembl Medaka
Match: ENSORLT00000015757.2 (pep primary_assembly:ASM223467v1:16:20455675:20456313:-1 gene:ENSORLG00000012581.2 transcript:ENSORLT00000015757.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 51.2174 bits (121), Expect = 7.783e-7
Identity = 18/52 (34.62%), Postives = 29/52 (55.77%), Query Frame = 2
Query: 1046 YKCTVCDRQFKRKFCLTRHKRVHQNYKTYLCNICGLGFDLLNQLKRHLRNTH 1201
            Y+C +C ++F     L RH+ +H   K ++C  CG  F  +  L RH+R+ H
Sbjct:  149 YRCEICRKRFITTSALNRHQTIHTEGKQFICTYCGKSFKWMESLGRHIRSAH 200          
BLAST of SMED30028183 vs. Ensembl Medaka
Match: ENSORLT00000043648.1 (pep primary_assembly:ASM223467v1:9:4901872:4908070:1 gene:ENSORLG00000027054.1 transcript:ENSORLT00000043648.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.1434 bits (126), Expect = 9.571e-7
Identity = 24/64 (37.50%), Postives = 33/64 (51.56%), Query Frame = 2
Query: 1001 KKHDIIFSSTKFNQTYKCTVCDRQFKRKFCLTRHKRVHQNYKTYLCNICGLGFDLLNQLKRHLR 1192
            K H  + +  K    +KCT+C R+F  +  L RH R H   K Y C++C   F   + LK HLR
Sbjct:  740 KNHQRVHTGEK---PFKCTLCKRKFATRTTLKRHNRTHTGEKPYECHVCNKKFGHKSDLKGHLR 800          

HSP 2 Score: 52.7582 bits (125), Expect = 1.061e-6
Identity = 24/63 (38.10%), Postives = 33/63 (52.38%), Query Frame = 2
Query: 1004 KHDIIFSSTKFNQTYKCTVCDRQFKRKFCLTRHKRVHQNYKTYLCNICGLGFDLLNQLKRHLR 1192
            KH +I ++ K    YKC +C   F R++ L  H+RVH   K Y C +C   F     LK+H R
Sbjct:  657 KHLVIHATEK---PYKCEICGNGFNRRYNLDLHQRVHTGEKPYKCTVCAKSFSSCVNLKKHQR 716          
BLAST of SMED30028183 vs. Planmine SMEST
Match: SMESG000071581.1 (SMESG000071581.1)

HSP 1 Score: 942.184 bits (2434), Expect = 0.000e+0
Identity = 466/466 (100.00%), Postives = 466/466 (100.00%), Query Frame = 2
Query:  518 MNYSRLIESIQKNDLTKSLATTNNEVELDNNANIEMDIDNKENEVPSLVNDSEKLLKQKRRPRKAQLTFRHFVEEDIPNSKEVNKSKCNTPVTDNELKIDTQFECQSNCKARKTDNSAVQSDLISKSNETDESEEKLQPKSSESVKKYSPTTSVVNIESSEKKHDIIFSSTKFNQTYKCTVCDRQFKRKFCLTRHKRVHQNYKTYLCNICGLGFDLLNQLKRHLRNTHACSRENLRRSCRNNSKSEQVIKAPTEQYCPIDCTWSMPKASSQLSLLPAKQIAASTAPSDISTSKTVCFNQFPFPPGLIIANSGKKPSPSAFSQTFTTPTSVSTQYQVRQMFNSIMSATEASIPYNNALYYMQNYAHILPTTSNALYHTLSNGNAAKTMPNLCSAPXXXXXXXXXQRLPIYRFPPGLFTSPSLKSVPLPLGSNWNNPTRTPDSNQPDKVKQSASPIPTPSNQLAKLAD 1915
            MNYSRLIESIQKNDLTKSLATTNNEVELDNNANIEMDIDNKENEVPSLVNDSEKLLKQKRRPRKAQLTFRHFVEEDIPNSKEVNKSKCNTPVTDNELKIDTQFECQSNCKARKTDNSAVQSDLISKSNETDESEEKLQPKSSESVKKYSPTTSVVNIESSEKKHDIIFSSTKFNQTYKCTVCDRQFKRKFCLTRHKRVHQNYKTYLCNICGLGFDLLNQLKRHLRNTHACSRENLRRSCRNNSKSEQVIKAPTEQYCPIDCTWSMPKASSQLSLLPAKQIAASTAPSDISTSKTVCFNQFPFPPGLIIANSGKKPSPSAFSQTFTTPTSVSTQYQVRQMFNSIMSATEASIPYNNALYYMQNYAHILPTTSNALYHTLSNGNAAKTMPNLCSAPSTTTTNSSSQRLPIYRFPPGLFTSPSLKSVPLPLGSNWNNPTRTPDSNQPDKVKQSASPIPTPSNQLAKLAD
Sbjct:    1 MNYSRLIESIQKNDLTKSLATTNNEVELDNNANIEMDIDNKENEVPSLVNDSEKLLKQKRRPRKAQLTFRHFVEEDIPNSKEVNKSKCNTPVTDNELKIDTQFECQSNCKARKTDNSAVQSDLISKSNETDESEEKLQPKSSESVKKYSPTTSVVNIESSEKKHDIIFSSTKFNQTYKCTVCDRQFKRKFCLTRHKRVHQNYKTYLCNICGLGFDLLNQLKRHLRNTHACSRENLRRSCRNNSKSEQVIKAPTEQYCPIDCTWSMPKASSQLSLLPAKQIAASTAPSDISTSKTVCFNQFPFPPGLIIANSGKKPSPSAFSQTFTTPTSVSTQYQVRQMFNSIMSATEASIPYNNALYYMQNYAHILPTTSNALYHTLSNGNAAKTMPNLCSAPSTTTTNSSSQRLPIYRFPPGLFTSPSLKSVPLPLGSNWNNPTRTPDSNQPDKVKQSASPIPTPSNQLAKLAD 466          
BLAST of SMED30028183 vs. Planmine SMEST
Match: SMESG000080376.1 (SMESG000080376.1)

HSP 1 Score: 62.3882 bits (150), Expect = 6.760e-10
Identity = 26/53 (49.06%), Postives = 32/53 (60.38%), Query Frame = 2
Query: 1046 YKCTVCDRQFKRKFCLTRHKRVHQNYKTYLCNICGLGFDLLNQLKRHLRNTHA 1204
            YKC  C + F RKFC  RH+R+H   K Y C IC   F  L   KRH+R+TH+
Sbjct:  399 YKCRYCCKTFNRKFCRERHERLHTGIKPYTCEICNDKFIRLEDKKRHVRSTHS 451          
BLAST of SMED30028183 vs. Planmine SMEST
Match: SMESG000023142.1 (SMESG000023142.1)

HSP 1 Score: 52.373 bits (124), Expect = 1.141e-6
Identity = 21/52 (40.38%), Postives = 33/52 (63.46%), Query Frame = 2
Query: 1046 YKCTVCDRQFKRKFCLTRHKRVHQNYKTYLCNICGLGFDLLNQLKRHLRNTH 1201
            Y+C+ C + FK K  LTRH ++H N++ Y+C  CG  F  +  L+RH+ + H
Sbjct:  367 YECSDCGKMFKTKRILTRHCKIHSNFRPYVC-ACGSSFLRMTNLRRHIVSVH 417          
BLAST of SMED30028183 vs. Planmine SMEST
Match: SMESG000022366.1 (SMESG000022366.1)

HSP 1 Score: 51.6026 bits (122), Expect = 1.858e-6
Identity = 31/81 (38.27%), Postives = 39/81 (48.15%), Query Frame = 2
Query:  947 SVKKYSPTTSVVNIESSEKKH-DIIFSSTKFNQTYKCTVCDRQFKRKFCLTRHKRVHQNYKTYLCNICGLGFDLLNQLKRH 1186
            SV + SPT+S    +SS  K  DI FS    ++  KC  CD+QF  +  L  H R H   + Y C  C   F     LKRH
Sbjct:  524 SVPRSSPTSSGHTTQSSSNKTTDIFFSRKGGSERRKCPDCDKQFTCESALRIHYRKHSGERPYACEFCSKTFSQNGTLKRH 604          

HSP 2 Score: 51.6026 bits (122), Expect = 1.990e-6
Identity = 23/51 (45.10%), Postives = 28/51 (54.90%), Query Frame = 2
Query: 1049 KCTVCDRQFKRKFCLTRHKRVHQNYKTYLCNICGLGFDLLNQLKRHLRNTH 1201
            KC  CD+ F     L  H+R+H   K Y+C ICG  F+    L RH RNTH
Sbjct:   88 KCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRH-RNTH 137          
BLAST of SMED30028183 vs. Planmine SMEST
Match: SMESG000022366.1 (SMESG000022366.1)

HSP 1 Score: 50.8322 bits (120), Expect = 3.693e-6
Identity = 23/51 (45.10%), Postives = 28/51 (54.90%), Query Frame = 2
Query: 1049 KCTVCDRQFKRKFCLTRHKRVHQNYKTYLCNICGLGFDLLNQLKRHLRNTH 1201
            KC  CD+ F     L  H+R+H   K Y+C ICG  F+    L RH RNTH
Sbjct:   88 KCDYCDKTFTLANVLKVHQRIHTGEKPYVCEICGKAFNQSGSLNRH-RNTH 137          

HSP 2 Score: 50.8322 bits (120), Expect = 3.821e-6
Identity = 31/81 (38.27%), Postives = 39/81 (48.15%), Query Frame = 2
Query:  947 SVKKYSPTTSVVNIESSEKKH-DIIFSSTKFNQTYKCTVCDRQFKRKFCLTRHKRVHQNYKTYLCNICGLGFDLLNQLKRH 1186
            SV + SPT+S    +SS  K  DI FS    ++  KC  CD+QF  +  L  H R H   + Y C  C   F     LKRH
Sbjct:  524 SVPRSSPTSSGHTTQSSSNKTTDIFFSRKGGSERRKCPDCDKQFTCESALRIHYRKHSGERPYACEFCSKTFSQNGTLKRH 604          
The following BLAST results are available for this feature:
BLAST of SMED30028183 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ZNF5251.227e-728.50zinc finger protein 525 [Source:HGNC Symbol;Acc:HG... [more]
ZNF5251.436e-728.50zinc finger protein 525 [Source:HGNC Symbol;Acc:HG... [more]
ZNF8085.060e-737.65zinc finger protein 808 [Source:HGNC Symbol;Acc:HG... [more]
ZNF5575.596e-729.94zinc finger protein 557 [Source:HGNC Symbol;Acc:HG... [more]
ZNF8087.007e-737.65zinc finger protein 808 [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of SMED30028183 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lsl-14.715e-936.26LSY-2-Like [Source:UniProtKB/TrEMBL;Acc:O02273][more]
lsl-14.715e-936.26LSY-2-Like [Source:UniProtKB/TrEMBL;Acc:O02273][more]
Y37E11B.11.595e-729.82pep chromosome:WBcel235:IV:3578937:3580992:1 gene:... [more]
lin-481.127e-639.34Putative zinc finger transcription factor [Source... [more]
egl-431.818e-640.38pep chromosome:WBcel235:II:9960333:9962344:1 gene:... [more]
back to top
BLAST of SMED30028183 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
klu9.484e-834.52gene:FBgn0013469 transcript:FBtr0076247[more]
klu9.484e-834.52gene:FBgn0013469 transcript:FBtr0333361[more]
klu9.484e-834.52gene:FBgn0013469 transcript:FBtr0345346[more]
klu1.224e-734.52gene:FBgn0013469 transcript:FBtr0330080[more]
erm1.084e-637.70gene:FBgn0031375 transcript:FBtr0330200[more]
back to top
BLAST of SMED30028183 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch1073-224n8.12.701e-742.86si:ch1073-224n8.1 [Source:ZFIN;Acc:ZDB-GENE-030131... [more]
vezf1b1.042e-636.21vascular endothelial zinc finger 1b [Source:ZFIN;A... [more]
vezf1a1.339e-636.21vascular endothelial zinc finger 1a [Source:ZFIN;A... [more]
ovol1a1.524e-642.37ovo-like zinc finger 1a [Source:ZFIN;Acc:ZDB-GENE-... [more]
znf740a1.635e-638.78zinc finger protein 740a [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of SMED30028183 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000035414.13.913e-739.29zinc finger protein 91 [Source:NCBI gene;Acc:10048... [more]
ZBTB401.033e-643.64zinc finger and BTB domain containing 40 [Source:N... [more]
egr11.338e-629.11early growth response 1 [Source:NCBI gene;Acc:1000... [more]
nln1.396e-633.77neurolysin (metallopeptidase M3 family) [Source:Xe... [more]
egr11.532e-629.11early growth response 1 [Source:NCBI gene;Acc:1000... [more]
back to top
BLAST of SMED30028183 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Zfp7402.676e-739.13zinc finger protein 740 [Source:MGI Symbol;Acc:MGI... [more]
Zkscan162.980e-740.30zinc finger with KRAB and SCAN domains 16 [Source:... [more]
Zfp4936.301e-737.50zinc finger protein 493 [Source:MGI Symbol;Acc:MGI... [more]
Zfp7408.479e-739.13zinc finger protein 740 [Source:MGI Symbol;Acc:MGI... [more]
Zfp7409.116e-739.13zinc finger protein 740 [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of SMED30028183 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6NTY6|EGR1B_XENLA5.398e-830.38Early growth response protein 1-B OS=Xenopus laevi... [more]
sp|Q3B7N9|MYNN_BOVIN1.628e-635.80Myoneurin OS=Bos taurus OX=9913 GN=MYNN PE=2 SV=1[more]
sp|P0C6Y7|PRDM9_RAT1.787e-644.44Histone-lysine N-methyltransferase PRDM9 OS=Rattus... [more]
sp|Q8N4W9|ZN808_HUMAN2.409e-637.65Zinc finger protein 808 OS=Homo sapiens OX=9606 GN... [more]
sp|Q8N988|ZN557_HUMAN2.687e-629.94Zinc finger protein 557 OS=Homo sapiens OX=9606 GN... [more]
back to top
BLAST of SMED30028183 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0R3UHI02.623e-940.45Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A5K3ERV34.503e-940.45Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A1A9VB912.397e-834.23Uncharacterized protein OS=Glossina austeni OX=739... [more]
A0A1B0G7Y64.243e-832.22Signal recognition particle subunit srp72 OS=Gloss... [more]
A0A0L0S3P36.324e-842.37Uncharacterized protein OS=Allomyces macrogynus (s... [more]
back to top
BLAST of SMED30028183 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
e4f19.785e-840.28E4F transcription factor 1 [Source:NCBI gene;Acc:1... [more]
ENSAMXT00000036331.12.734e-725.81pep primary_assembly:Astyanax_mexicanus-2.0:16:602... [more]
ENSAMXT00000052917.19.373e-731.25pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
vezf1a1.006e-636.21vascular endothelial zinc finger 1 [Source:NCBI ge... [more]
vezf1a1.033e-636.21vascular endothelial zinc finger 1 [Source:NCBI ge... [more]
back to top
BLAST of SMED30028183 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PRDM151.049e-732.97PR/SET domain 15 [Source:HGNC Symbol;Acc:HGNC:1399... [more]
PRDM151.129e-732.97PR/SET domain 15 [Source:HGNC Symbol;Acc:HGNC:1399... [more]
ENSPMAT00000000923.16.115e-731.08pep scaffold:Pmarinus_7.0:GL480775:18221:19434:-1 ... [more]
ENSPMAT00000004838.18.962e-735.21pep scaffold:Pmarinus_7.0:GL495265:3215:3667:-1 ge... [more]
ENSPMAT00000009831.11.424e-638.46pep scaffold:Pmarinus_7.0:GL485667:2222:3316:-1 ge... [more]
back to top
BLAST of SMED30028183 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
MET314.712e-734.57Zinc-finger DNA-binding transcription factor; targ... [more]
CRZ12.978e-633.87Transcription factor, activates transcription of s... [more]
MIG25.685e-632.84Zinc finger transcriptional repressor; cooperates ... [more]
TDA97.742e-637.04Transcription factor that regulates acetate produc... [more]
back to top
BLAST of SMED30028183 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO451994.601e-846.15Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO452556.934e-846.15Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO411415.471e-737.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO375172.519e-640.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO465332.838e-646.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30028183 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000029102.11.793e-735.09uncharacterized LOC105354939 [Source:NCBI gene;Acc... [more]
ENSORLT00000042764.12.429e-737.10zinc finger protein 865 [Source:NCBI gene;Acc:1011... [more]
vezf1a6.552e-736.21vascular endothelial zinc finger 1 [Source:NCBI ge... [more]
ENSORLT00000015757.27.783e-734.62pep primary_assembly:ASM223467v1:16:20455675:20456... [more]
ENSORLT00000043648.19.571e-737.50pep primary_assembly:ASM223467v1:9:4901872:4908070... [more]
back to top
BLAST of SMED30028183 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000071581.10.000e+0100.00SMESG000071581.1[more]
SMESG000080376.16.760e-1049.06SMESG000080376.1[more]
SMESG000023142.11.141e-640.38SMESG000023142.1[more]
SMESG000022366.11.858e-638.27SMESG000022366.1[more]
SMESG000022366.13.693e-645.10SMESG000022366.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028183 ID=SMED30028183|Name=SMED30028183|organism=Schmidtea mediterranea sexual|type=transcript|length=2018bp
TCAAATTTAATAACAATAATCAAACTGAAATTTCATCATGTAAATTTTCG
TTGAAACGCCGCAGTTACAATTTTCCCAGTTATATTATTAAAATGAAACC
ATAATTTCGAATGGAAATGTCATAAATCTGTCATCTGGTAAAGATATAGC
AGGTAAGCCTGAGATTAACTACTATACAATATAAAAGATCAATTGATCAA
TACAAAATGACTATTTATTTGTTTGTGCTGATAAATTTAAAATTTCAAAT
CAGTATATAATTGATTTTTCGTTTCTTTTATTAAAAATGAATAAATCTTA
TAAATCGGAAAAAGATAAGGTAAATGTCAAGTTGCAAAAAACGATATCGA
ATTTAATTTCTAGTGTCATTTCATCACTTTGTCAGCAAGTAGTTCAATAT
GAAAATTCAATTGATATTTTCGGGTTGCTCTGCATTAATATCGATAATGA
TGTGGATATCAGTGTGAAATTGAATGAGAAATTTATTAAAAAAGAAGTTA
TCGGTTCAGCACCAAGCATGAATTATTCGCGATTGATTGAATCTATTCAG
AAGAATGATTTAACTAAATCATTGGCAACTACTAATAATGAAGTAGAGTT
AGACAACAATGCTAATATCGAAATGGATATTGATAATAAAGAAAATGAGG
TTCCATCATTAGTAAATGATTCGGAAAAGTTGTTAAAGCAGAAAAGACGT
CCTAGAAAGGCACAACTTACATTTCGACACTTTGTCGAAGAAGATATCCC
CAATTCAAAAGAAGTAAATAAAAGCAAATGTAACACTCCTGTTACTGATA
ATGAGTTGAAAATTGACACCCAATTCGAATGCCAATCCAATTGCAAAGCT
CGCAAAACCGATAACAGTGCTGTTCAAAGTGATTTAATTAGTAAGTCTAA
TGAAACCGATGAAAGCGAAGAAAAATTGCAGCCGAAATCTTCAGAATCGG
TAAAAAAATATTCTCCAACTACTTCCGTAGTAAACATTGAAAGTTCTGAG
AAAAAACATGATATAATATTTTCATCGACAAAATTTAATCAAACGTACAA
GTGCACAGTTTGCGATCGGCAATTTAAGCGGAAATTTTGTTTAACTCGAC
ACAAAAGAGTTCATCAAAATTACAAAACTTATTTATGCAATATCTGTGGA
TTGGGATTCGATTTATTAAATCAACTGAAACGCCATTTGCGCAACACACA
CGCATGCAGCCGTGAAAACCTACGAAGATCATGTAGAAATAACTCCAAAT
CCGAACAGGTCATTAAAGCTCCAACTGAACAGTACTGTCCAATAGATTGT
ACATGGTCAATGCCAAAAGCATCCTCGCAGTTGTCTTTATTACCAGCGAA
ACAAATTGCGGCTTCAACAGCTCCTTCGGATATTTCAACGAGTAAAACTG
TTTGCTTCAATCAATTTCCATTTCCTCCTGGATTAATAATAGCAAATTCC
GGAAAGAAACCAAGTCCTTCTGCTTTCAGTCAAACCTTTACAACTCCGAC
ATCGGTTTCGACGCAATATCAAGTGCGACAAATGTTCAACTCGATAATGT
CTGCAACAGAAGCATCAATTCCATACAACAATGCTTTGTATTACATGCAA
AATTACGCACATATTCTACCGACAACAAGCAACGCATTATATCATACATT
GTCCAATGGAAATGCAGCAAAAACCATGCCAAATCTCTGCAGCGCTCCGT
CTACAACTACCACAAATAGCAGCTCACAAAGATTGCCAATTTACAGATTT
CCGCCCGGATTGTTCACGTCACCGTCATTGAAAAGTGTTCCTTTGCCGTT
GGGTAGCAACTGGAATAATCCAACGCGTACTCCAGATTCCAATCAACCAG
ACAAAGTCAAACAGTCGGCCTCACCAATCCCGACACCATCTAACCAATTA
GCAAAGCTTGCGGATTAAAATTGCTAATATTGGCATTAAAATCAATTTTG
TGTAAATTTTATGGAAATTCTAATAGTATTTGTTTAGTGTTTTTTTTTTC
TACTGTTTTAAATTTGGC
back to top

protein sequence of SMED30028183-orf-1

>SMED30028183-orf-1 ID=SMED30028183-orf-1|Name=SMED30028183-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=544bp
MNKSYKSEKDKVNVKLQKTISNLISSVISSLCQQVVQYENSIDIFGLLCI
NIDNDVDISVKLNEKFIKKEVIGSAPSMNYSRLIESIQKNDLTKSLATTN
NEVELDNNANIEMDIDNKENEVPSLVNDSEKLLKQKRRPRKAQLTFRHFV
EEDIPNSKEVNKSKCNTPVTDNELKIDTQFECQSNCKARKTDNSAVQSDL
ISKSNETDESEEKLQPKSSESVKKYSPTTSVVNIESSEKKHDIIFSSTKF
NQTYKCTVCDRQFKRKFCLTRHKRVHQNYKTYLCNICGLGFDLLNQLKRH
LRNTHACSRENLRRSCRNNSKSEQVIKAPTEQYCPIDCTWSMPKASSQLS
LLPAKQIAASTAPSDISTSKTVCFNQFPFPPGLIIANSGKKPSPSAFSQT
FTTPTSVSTQYQVRQMFNSIMSATEASIPYNNALYYMQNYAHILPTTSNA
LYHTLSNGNAAKTMPNLCSAPSTTTTNSSSQRLPIYRFPPGLFTSPSLKS
VPLPLGSNWNNPTRTPDSNQPDKVKQSASPIPTPSNQLAKLAD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003304testis primordium
Vocabulary: INTERPRO
TermDefinition
IPR036236Znf_C2H2_sf
IPR015880Znf_C2H2-like
IPR013087Znf_C2H2_type
IPR007087Znf_C2H2
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0046872metal ion binding
GO:0003677DNA binding
GO:0003700transcription factor activity, sequence-specific DNA binding
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
GO:0005634nucleus
Vocabulary: biological process
TermDefinition
GO:0006351transcription, DNA-templated
GO:0006355regulation of transcription, DNA-templated
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 101..135
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 230..307
e-value: 1.2E-12
score: 49.7
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 204..219
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 195..229
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 504..543
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 504..536
NoneNo IPR availablePANTHERPTHR24388FAMILY NOT NAMEDcoord: 170..347
IPR013087Zinc finger C2H2-typeSMARTSM00355c2h2final6coord: 282..305
e-value: 0.015
score: 24.4
coord: 254..276
e-value: 0.0024
score: 27.1
IPR013087Zinc finger C2H2-typePFAMPF00096zf-C2H2coord: 254..276
e-value: 0.0019
score: 18.5
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 256..276
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 284..305
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 254..281
score: 12.923
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 282..310
score: 11.385
IPR036236Zinc finger C2H2 superfamilySUPERFAMILYSSF57667beta-beta-alpha zinc fingerscoord: 253..302