TTF-type domain-containing protein

Overview
NameTTF-type domain-containing protein
Smed IDSMED30028174
Length (bp)4268
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of TTF-type domain-containing protein (SMED30028174) t-SNE clustered cells

Violin plots show distribution of expression levels for TTF-type domain-containing protein (SMED30028174) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of TTF-type domain-containing protein (SMED30028174) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for TTF-type domain-containing protein (SMED30028174) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of TTF-type domain-containing protein vs. Ensembl Human
Match: THAP12 (THAP domain containing 12 [Source:HGNC Symbol;Acc:HGNC:9440])

HSP 1 Score: 165.236 bits (417), Expect = 5.123e-41
Identity = 133/515 (25.83%), Postives = 245/515 (47.57%), Query Frame = 2
Query: 2429 NANYLSWKIQNEMINAGNQIILKRIIERANQSECFSVLADETTDMSTQEQFSICIRFIDKDKKLNESFLQFVPVVSTSSKSLANTLVQFLSSIGLNPSYLKGQGYDGAEAMSGRFNGVQAKIMDLYPSALYVHCVSHSLNLALSDVCQIQDIRNCMGVVEK-CYSFMNTPKRDAVLQKKISDICPDAKR--TKLKK*CPTRWVERHDSIMIMVELLNPLILALEEIET-----WKDKESSSS--KNRAIKSTNIFLSILTVEKIFSYTLPLSKIMQTESLDLVTAIKICEDVVGQFEKFRKSAVTVFNEIYKRAEVLLRKMVDTNYAISIPRINKLQIHRCNISSQ-SPEEYYRISLFIPFLDATVTQLKERFL-KHKAILKAFNILIPS-------NTNTSHHEYSTNLEILLQKYNTDLNCTINMLIAEYELWQRKFSL--NPIQKNASVLQYLCEYSGEIFPNIFKLLKILATIPVTTSTVERSFSTLKYLKNYLRSTTAEDRLNGLALLYI 3910
            N  + S   Q +M+      I +  +     S  FS++ D+  D++ +E   + +RF+D+   L E F+ F+P  + +               GLN  Y +GQ Y  +   S +   V +++++ YP A+Y  C S +LN+ L+    +  +   +G +E+ C  F  +P+    L   IS +  ++K    +LK+ C ++W  RHD+  I+VELL  L+L L+ I +     W +  +  +     A+   +  ++I+ ++ + S+T    K +Q ++ D+  A      V+    +  ++ + V++E +      L   +D    + +P   + + H+ N+ SQ + E YY+ +L +P ++  + +LK+ F  +H   LK  + L+PS       NT+  HH            Y +DL    + L AE   W+ K+      I+  +++ + L     + FPN++ LLK+L  +PV     ER  +  K LK YLR+T  + R + LALL I
Sbjct:  226 NTLFCSKTQQRQMLEICESCIREETLREVRDSHFFSIITDDVVDIAGEEHLPVLVRFVDESHNLREEFIGFLPYEADAEILAVKFHTMITEKWGLNMEYCRGQAYIVSSGFSSKMKVVASRLLEKYPQAIYTLCSSCALNMWLAKSVPVMGVSVALGTIEEVCSFFHRSPQLLLELDNVISVLFQNSKERGKELKEICHSQWTGRHDAFEILVELLQALVLCLDGINSDTNIRWNNYIAGRAFVLCSAVSDFDFIVTIVVLKNVLSFTRAFGKNLQGQTSDVFFAAGSLTAVLHSLNEVMEN-IEVYHEFWFEEATNLATKLDIQ--MKLPGKFR-RAHQGNLESQLTSESYYKETLSVPTVEHIIQELKDIFSEQHLKALKCLS-LVPSVMGQLKFNTSEEHH---------ADMYRSDLP-NPDTLSAELHCWRIKWKHRGKDIELPSTIYEALHLPDIKFFPNVYALLKVLCILPVMKVENERYENGRKRLKAYLRNTLTDQRSSNLALLNI 725          
BLAST of TTF-type domain-containing protein vs. Ensembl Human
Match: ZMYM1 (zinc finger MYM-type containing 1 [Source:HGNC Symbol;Acc:HGNC:26253])

HSP 1 Score: 123.635 bits (309), Expect = 1.161e-27
Identity = 135/540 (25.00%), Postives = 243/540 (45.00%), Query Frame = 2
Query: 2420 TFRNAN-----YLSWKIQNEMINAGNQIILKRIIERANQSECFSVLADETTDMSTQEQFSICIRFIDKDKK---LNESFLQFVPVVSTSSKSLANTLVQFLSSIGLNPSYLKGQGYDGAEAMSGRFNGVQAKIMDLYPSALYVHCVSHSLNLALSDVC-QIQDIRNCMGVVEKCYSFMNTPKRDAVLQKKISDICPDAKRTKLKK*CPTRWVERHD-SIMIMVELLNPLILALEEIETWKDKESSSSKNRAIKSTNIFLSILTVEKIF---------SYTLPLSKIMQTESLDLVTAIKICEDVVGQFEKFRKSAVTVFNEIYKRAEVLLRKMVDTNYAISIPRINKLQIHRCNIS---------SQSPEEYYRISLFIPFLDATVTQLKERF--LKHKAILKAFNILI----PSNTNTSHHEYSTNLEILLQKYNTDLNCTINMLIAEYELWQRKFSLNPIQKNASV----LQYLCEYSG--EIFPNIFKLLKILATIPVTTSTVERSFSTLKYLKNYLRSTTAEDRLNGLALLYIYIE 3919
            TFR  N     Y S +IQ+++I      +L+ I+   N S  FS++ DET + + +EQ SIC+R+  K  K   + E FL FV     +   L  T+  +L  IG++   + GQ YD    +  +FN + A+     P ALY+HC +H L+L++   C +++++R+ +  +    S  NT      +     +I   ++    KK         HD +++ +++ L  +I  LE I +      SS+ + A + +++   +   E +F         S T  LSK +Q +++D+ +     E ++      R      F  I+   E + +K+    + +  P + K +  + ++            S EE Y+I+++   LD  +  LK  F    +  I +   +L     P N  T+ H        + + Y  D +     +I E   ++    LN +  ++ +    L  L    G     P + KLL I  + P+T+++ E SFSTL  LK YL +T  +++L G AL+ +  E
Sbjct:  601 TFRLMNSQVDFYNSTQIQSDIIEIIKTEMLQDIVNEINDSSAFSIICDETINSAMKEQLSICVRYPQKSSKAILIKERFLGFVDTEEMTGTHLHRTIKTYLQQIGVDMDKIHGQAYDSTTNLKIKFNKIAAEFKKEEPRALYIHCYAHFLDLSIIRFCKEVKELRSALKTLS---SLFNTICMSGEMLANFRNIYRLSQNKTCKKHISQSCWTVHDRTLLSVIDSLPEIIETLEVIAS-----HSSNTSFADELSHLLTLVSKFEFVFCLKFLYRVLSVTGILSKELQNKTIDIFSLSSKIEAILECLSSERNDV--YFKTIWDGTEEICQKITCKGFKVEKPSLQKRRKIQKSVDLGNSDNMFFPTSTEEQYKINIYYQGLDTILQNLKLCFSEFDYCKIKQISELLFKWNEPLNETTAKH--------VQEFYKLDED-----IIPELRFYRHYAKLNFVIDDSCINFVSLGCLFIQHGLHSNIPCLSKLLYIALSWPITSASTENSFSTLPRLKTYLCNTMGQEKLTGPALMAVEQE 1117          
BLAST of TTF-type domain-containing protein vs. Ensembl Human
Match: ZMYM1 (zinc finger MYM-type containing 1 [Source:HGNC Symbol;Acc:HGNC:26253])

HSP 1 Score: 123.635 bits (309), Expect = 1.161e-27
Identity = 135/540 (25.00%), Postives = 243/540 (45.00%), Query Frame = 2
Query: 2420 TFRNAN-----YLSWKIQNEMINAGNQIILKRIIERANQSECFSVLADETTDMSTQEQFSICIRFIDKDKK---LNESFLQFVPVVSTSSKSLANTLVQFLSSIGLNPSYLKGQGYDGAEAMSGRFNGVQAKIMDLYPSALYVHCVSHSLNLALSDVC-QIQDIRNCMGVVEKCYSFMNTPKRDAVLQKKISDICPDAKRTKLKK*CPTRWVERHD-SIMIMVELLNPLILALEEIETWKDKESSSSKNRAIKSTNIFLSILTVEKIF---------SYTLPLSKIMQTESLDLVTAIKICEDVVGQFEKFRKSAVTVFNEIYKRAEVLLRKMVDTNYAISIPRINKLQIHRCNIS---------SQSPEEYYRISLFIPFLDATVTQLKERF--LKHKAILKAFNILI----PSNTNTSHHEYSTNLEILLQKYNTDLNCTINMLIAEYELWQRKFSLNPIQKNASV----LQYLCEYSG--EIFPNIFKLLKILATIPVTTSTVERSFSTLKYLKNYLRSTTAEDRLNGLALLYIYIE 3919
            TFR  N     Y S +IQ+++I      +L+ I+   N S  FS++ DET + + +EQ SIC+R+  K  K   + E FL FV     +   L  T+  +L  IG++   + GQ YD    +  +FN + A+     P ALY+HC +H L+L++   C +++++R+ +  +    S  NT      +     +I   ++    KK         HD +++ +++ L  +I  LE I +      SS+ + A + +++   +   E +F         S T  LSK +Q +++D+ +     E ++      R      F  I+   E + +K+    + +  P + K +  + ++            S EE Y+I+++   LD  +  LK  F    +  I +   +L     P N  T+ H        + + Y  D +     +I E   ++    LN +  ++ +    L  L    G     P + KLL I  + P+T+++ E SFSTL  LK YL +T  +++L G AL+ +  E
Sbjct:  601 TFRLMNSQVDFYNSTQIQSDIIEIIKTEMLQDIVNEINDSSAFSIICDETINSAMKEQLSICVRYPQKSSKAILIKERFLGFVDTEEMTGTHLHRTIKTYLQQIGVDMDKIHGQAYDSTTNLKIKFNKIAAEFKKEEPRALYIHCYAHFLDLSIIRFCKEVKELRSALKTLS---SLFNTICMSGEMLANFRNIYRLSQNKTCKKHISQSCWTVHDRTLLSVIDSLPEIIETLEVIAS-----HSSNTSFADELSHLLTLVSKFEFVFCLKFLYRVLSVTGILSKELQNKTIDIFSLSSKIEAILECLSSERNDV--YFKTIWDGTEEICQKITCKGFKVEKPSLQKRRKIQKSVDLGNSDNMFFPTSTEEQYKINIYYQGLDTILQNLKLCFSEFDYCKIKQISELLFKWNEPLNETTAKH--------VQEFYKLDED-----IIPELRFYRHYAKLNFVIDDSCINFVSLGCLFIQHGLHSNIPCLSKLLYIALSWPITSASTENSFSTLPRLKTYLCNTMGQEKLTGPALMAVEQE 1117          
BLAST of TTF-type domain-containing protein vs. Ensembl Human
Match: ZMYM1 (zinc finger MYM-type containing 1 [Source:HGNC Symbol;Acc:HGNC:26253])

HSP 1 Score: 123.635 bits (309), Expect = 1.161e-27
Identity = 135/540 (25.00%), Postives = 243/540 (45.00%), Query Frame = 2
Query: 2420 TFRNAN-----YLSWKIQNEMINAGNQIILKRIIERANQSECFSVLADETTDMSTQEQFSICIRFIDKDKK---LNESFLQFVPVVSTSSKSLANTLVQFLSSIGLNPSYLKGQGYDGAEAMSGRFNGVQAKIMDLYPSALYVHCVSHSLNLALSDVC-QIQDIRNCMGVVEKCYSFMNTPKRDAVLQKKISDICPDAKRTKLKK*CPTRWVERHD-SIMIMVELLNPLILALEEIETWKDKESSSSKNRAIKSTNIFLSILTVEKIF---------SYTLPLSKIMQTESLDLVTAIKICEDVVGQFEKFRKSAVTVFNEIYKRAEVLLRKMVDTNYAISIPRINKLQIHRCNIS---------SQSPEEYYRISLFIPFLDATVTQLKERF--LKHKAILKAFNILI----PSNTNTSHHEYSTNLEILLQKYNTDLNCTINMLIAEYELWQRKFSLNPIQKNASV----LQYLCEYSG--EIFPNIFKLLKILATIPVTTSTVERSFSTLKYLKNYLRSTTAEDRLNGLALLYIYIE 3919
            TFR  N     Y S +IQ+++I      +L+ I+   N S  FS++ DET + + +EQ SIC+R+  K  K   + E FL FV     +   L  T+  +L  IG++   + GQ YD    +  +FN + A+     P ALY+HC +H L+L++   C +++++R+ +  +    S  NT      +     +I   ++    KK         HD +++ +++ L  +I  LE I +      SS+ + A + +++   +   E +F         S T  LSK +Q +++D+ +     E ++      R      F  I+   E + +K+    + +  P + K +  + ++            S EE Y+I+++   LD  +  LK  F    +  I +   +L     P N  T+ H        + + Y  D +     +I E   ++    LN +  ++ +    L  L    G     P + KLL I  + P+T+++ E SFSTL  LK YL +T  +++L G AL+ +  E
Sbjct:  601 TFRLMNSQVDFYNSTQIQSDIIEIIKTEMLQDIVNEINDSSAFSIICDETINSAMKEQLSICVRYPQKSSKAILIKERFLGFVDTEEMTGTHLHRTIKTYLQQIGVDMDKIHGQAYDSTTNLKIKFNKIAAEFKKEEPRALYIHCYAHFLDLSIIRFCKEVKELRSALKTLS---SLFNTICMSGEMLANFRNIYRLSQNKTCKKHISQSCWTVHDRTLLSVIDSLPEIIETLEVIAS-----HSSNTSFADELSHLLTLVSKFEFVFCLKFLYRVLSVTGILSKELQNKTIDIFSLSSKIEAILECLSSERNDV--YFKTIWDGTEEICQKITCKGFKVEKPSLQKRRKIQKSVDLGNSDNMFFPTSTEEQYKINIYYQGLDTILQNLKLCFSEFDYCKIKQISELLFKWNEPLNETTAKH--------VQEFYKLDED-----IIPELRFYRHYAKLNFVIDDSCINFVSLGCLFIQHGLHSNIPCLSKLLYIALSWPITSASTENSFSTLPRLKTYLCNTMGQEKLTGPALMAVEQE 1117          
BLAST of TTF-type domain-containing protein vs. Ensembl Human
Match: ZMYM1 (zinc finger MYM-type containing 1 [Source:HGNC Symbol;Acc:HGNC:26253])

HSP 1 Score: 123.635 bits (309), Expect = 1.161e-27
Identity = 135/540 (25.00%), Postives = 243/540 (45.00%), Query Frame = 2
Query: 2420 TFRNAN-----YLSWKIQNEMINAGNQIILKRIIERANQSECFSVLADETTDMSTQEQFSICIRFIDKDKK---LNESFLQFVPVVSTSSKSLANTLVQFLSSIGLNPSYLKGQGYDGAEAMSGRFNGVQAKIMDLYPSALYVHCVSHSLNLALSDVC-QIQDIRNCMGVVEKCYSFMNTPKRDAVLQKKISDICPDAKRTKLKK*CPTRWVERHD-SIMIMVELLNPLILALEEIETWKDKESSSSKNRAIKSTNIFLSILTVEKIF---------SYTLPLSKIMQTESLDLVTAIKICEDVVGQFEKFRKSAVTVFNEIYKRAEVLLRKMVDTNYAISIPRINKLQIHRCNIS---------SQSPEEYYRISLFIPFLDATVTQLKERF--LKHKAILKAFNILI----PSNTNTSHHEYSTNLEILLQKYNTDLNCTINMLIAEYELWQRKFSLNPIQKNASV----LQYLCEYSG--EIFPNIFKLLKILATIPVTTSTVERSFSTLKYLKNYLRSTTAEDRLNGLALLYIYIE 3919
            TFR  N     Y S +IQ+++I      +L+ I+   N S  FS++ DET + + +EQ SIC+R+  K  K   + E FL FV     +   L  T+  +L  IG++   + GQ YD    +  +FN + A+     P ALY+HC +H L+L++   C +++++R+ +  +    S  NT      +     +I   ++    KK         HD +++ +++ L  +I  LE I +      SS+ + A + +++   +   E +F         S T  LSK +Q +++D+ +     E ++      R      F  I+   E + +K+    + +  P + K +  + ++            S EE Y+I+++   LD  +  LK  F    +  I +   +L     P N  T+ H        + + Y  D +     +I E   ++    LN +  ++ +    L  L    G     P + KLL I  + P+T+++ E SFSTL  LK YL +T  +++L G AL+ +  E
Sbjct:  601 TFRLMNSQVDFYNSTQIQSDIIEIIKTEMLQDIVNEINDSSAFSIICDETINSAMKEQLSICVRYPQKSSKAILIKERFLGFVDTEEMTGTHLHRTIKTYLQQIGVDMDKIHGQAYDSTTNLKIKFNKIAAEFKKEEPRALYIHCYAHFLDLSIIRFCKEVKELRSALKTLS---SLFNTICMSGEMLANFRNIYRLSQNKTCKKHISQSCWTVHDRTLLSVIDSLPEIIETLEVIAS-----HSSNTSFADELSHLLTLVSKFEFVFCLKFLYRVLSVTGILSKELQNKTIDIFSLSSKIEAILECLSSERNDV--YFKTIWDGTEEICQKITCKGFKVEKPSLQKRRKIQKSVDLGNSDNMFFPTSTEEQYKINIYYQGLDTILQNLKLCFSEFDYCKIKQISELLFKWNEPLNETTAKH--------VQEFYKLDED-----IIPELRFYRHYAKLNFVIDDSCINFVSLGCLFIQHGLHSNIPCLSKLLYIALSWPITSASTENSFSTLPRLKTYLCNTMGQEKLTGPALMAVEQE 1117          
BLAST of TTF-type domain-containing protein vs. Ensembl Zebrafish
Match: CR762475.1 (pep chromosome:GRCz11:4:55494751:55498830:1 gene:ENSDARG00000098243.2 transcript:ENSDART00000172605.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR762475.1)

HSP 1 Score: 202.601 bits (514), Expect = 9.650e-53
Identity = 158/521 (30.33%), Postives = 258/521 (49.52%), Query Frame = 2
Query: 2441 LSWKIQNEMINAGNQIILKRIIERANQSECFSVLADETTDMSTQEQFSICIRFIDKDKKLNESFLQFVPVVSTSSKSLANTLVQFLSSIGLNPSYLKGQGYDGAEAMSGRFNGVQAKIMDLYPSALYVHCVSHSLNLALSDVCQIQ-DIRNCMGVVEKCYSF-MNTPKRDAVLQKKISDICPDAKRTKLKK*CPTRWVERHDSIMIMVELLNPLILALEEIETWKDKESSSSKN----RAIKSTNIFLSILTVEKIFSYTLPLSKIMQTESLDLVTAIKICEDVVGQFEKFRKSA--VTVFNEIYKRAEVLLRKMVDTNYAISIP----------RINKLQIHRCNISS-----QSPEEYYRISLFIPFLDATVTQLKERF-----LKHKAILKAFNILIPSN--TNTSHHEYSTNLEILLQKYNTDLNCTINMLIAEYELWQRKFSLNPIQKNASVLQYLCEYSGE-IFPNIFKLLKILATIPVTTSTVERSFSTLKYLKNYLRSTTAEDRLNGLALLYI 3910
            LS + QN++I +    I  +I     +++ FS+L DETTD+S +EQ S  +R++ +D ++ E FLQ   + ST+ K L N ++  L   GL+   ++GQGYDGA  MSG + G+Q++I      ALYVHC +H LNL L +  +          +VEK Y F   + KR     K    + P  +  +L+K   TRW  R  S+  + ++L  LI  L ++      E+++       RAI    +  S +T   +F  T   S  +Q + LDL TA  I + V+   +  R      T+F +  ++AE         +  I IP          ++    +H    +      Q+ EE+YR  ++  FLD    +L  RF     +    IL++F  L   +    T + E    ++ L   Y+ +       L  E +++   F  + ++   S+L  L E SG+ +FP + ++LK+ AT+PV+T+TVERSFS ++ +KN LRS  +E+RL+ L L+ I
Sbjct:  375 LSNRSQNDIIMSLGTFIRSKIQNEIKEAQIFSILLDETTDVSHKEQVSFVVRYV-RDMEVKERFLQVCTLESTTGKELENVVISLLQDNGLDLKNIRGQGYDGAANMSGMYKGLQSRIRAHNEKALYVHCQAHCLNLVLVESAKSSIHFVTFFSLVEKLYVFCTGSTKRHTAFLKCQQSLYPGQRVVELQKLSDTRWACRERSLKALNKVLKALIKLLTDLCESDPPETAAGDAKMYLRAIDFEFLLCSEITT-TVFQITGVASDALQKKDLDLSTAYTITDGVLDTVKNLRSEEEFKTIFQKAVEKAE---------DVGIDIPTVPPGHGRKRKVPTRYLHSATAAQDSHTFQTVEEFYRAKVYFTFLDTITEELGRRFKVDGTMPTGKILQSFQSLTVHDNWVGTPNTEAVQAIQTLCNFYSVEEE---QQLKTELKVFHTTFKSSGMK---SMLSILKETSGQHVFPALVEMLKVYATLPVSTATVERSFSKMRLIKNQLRSLCSEERLSDLLLIAI 878          
BLAST of TTF-type domain-containing protein vs. Ensembl Zebrafish
Match: thap12a (THAP domain containing 12a [Source:ZFIN;Acc:ZDB-GENE-040426-2045])

HSP 1 Score: 125.561 bits (314), Expect = 1.142e-29
Identity = 117/498 (23.49%), Postives = 228/498 (45.78%), Query Frame = 2
Query: 2483 QIILKRIIERANQSECFSVLADETTDMSTQEQFSICIRFIDKDKKLNESFLQFVPVVSTSSKSLANTLVQFLSS-IGLNPSYLKGQGY--DGAEAMSGRFNGVQAKIMDLYPSALYVHCVSHSLNLALSDVCQIQDIRNCMGVVEKCYSFMNTPKRDAVLQKKISDICP------DAKRTKLKK*CPTRWVERHDSIMIMVELLNPLILALE-----EIETWKDKESSSS--KNRAIKSTNIFLSILTVEKIFSYTLPLSKIMQTESLDLVTAIKICEDVVGQFEKFRKSAVTVFNEIYKRAEVLLRKMVDTNYAISIP-RINKLQIHRCNISSQS--PEEYYRISLFIPFLDATVTQLKERFLK-HKAILKAFNILIPSNTNTSHHEYSTNLEILLQKYNTDLNCTINMLIAEYELWQRKF--SLNPIQKNASVLQYLCEYSGEIFPNIFKLLKILATIPVTTSTVERSFSTLKYLKNYLRSTTAEDRLNGLALLYI 3910
            + I + ++  A +  CFS++ D   ++  +    + +RF+DK   L E F+ F+ +     +++   LV  L+   GL+  Y +GQ Y   G  AM  +   + AKI +L+P A+   C S SLN+ L++      +   M  ++K  +F +   +  +LQ ++           + K   LK+ C ++W E+HD+  + V+LL  L+L ++     E   W D+ + ++   + A+      ++++ ++   S+T    K +Q E+ ++  A        G       S   V+  I    E    + V+   ++ IP ++ +L   +   S +   PE YY+  + IP +   + +L + F + H   LK+ + L+P+       +++T  E  +  Y  DL    +   AE   W+ K+      +   +++ + L     + FPN+  LLK+L  +P+   T ++  +  + L  YL+ T    R   +AL YI
Sbjct:  231 KCIREELLAEAKEGRCFSLVVDNLVEIEGENYVPLFVRFVDKANCLREEFVDFL-LFEGDVEAITERLVTELTEKCGLDMKYCRGQAYLCSGVSAM--KVKAMVAKIAELHPLAVLTPCSSCSLNICLANTMTFTGVHLVMSTLKKLDAFFS---KSPLLQNQLESAISIYYQGNEEKANVLKEACGSKWTEQHDTFELAVDLLESLLLCMDSVHDNEDHKWSDEVAHNAFVISEALADFEYVMTLVVLKNTLSFTRAFGKNLQGETNEVFFA-------SGSLTAVLHSLNEVYENIEVYHEFWFEEAVNLAASLEIPVKVPRLYFRKRPTSGEEIQPETYYKDQVTIPVVSHVIKELSDLFSENHLKALKSLS-LVPA--IMGQLKFNTTEETSVDIYKDDL-LNPDTFPAELHCWKIKWKHGTKDVILPSTIYETLQLSDVKFFPNVCALLKVLYNLPLFALTNDKCSTAKQRLMAYLQDTPVNHRNKSMALFYI 711          

HSP 2 Score: 26.5646 bits (57), Expect = 1.142e-29
Identity = 14/54 (25.93%), Postives = 25/54 (46.30%), Query Frame = 3
Query: 2268 GRNSFRLRGHRDTDIFNMNIDEIDKSTIRQKGNFRQLIRFRLESGDQALKEHLE 2429
            G  +  L GH D +          +S      NF+ L+ +R+ +GD+ L++  E
Sbjct:  164 GTQNIPLHGHSDKE---------PRSKSFTPSNFQALLEYRINAGDEFLRKKFE 208          
BLAST of TTF-type domain-containing protein vs. Ensembl Zebrafish
Match: thap12b (THAP domain containing 12b [Source:ZFIN;Acc:ZDB-GENE-040718-429])

HSP 1 Score: 128.257 bits (321), Expect = 1.401e-29
Identity = 120/536 (22.39%), Postives = 240/536 (44.78%), Query Frame = 2
Query: 2429 NANYLSWKIQNEMINAGNQIILKRIIERANQSECFSVLADETTDMSTQEQFSICIRFIDKDKKLNESFLQFVPVVSTSSKSLANTLVQFLSSIGLNPSYLKGQGYDGAEAMSGRFNGVQAKIMDLYPSALYVHCVSHSLNLALSDVCQIQDIRNCMGVVEKCYSFMN-TPKRDAVLQKKISDICPD--AKRTKLKK*CPTRWVERHDSIMIMVELLNPLILALEEIET-----WKDKESSSSK--NRAIKSTNIFLSILTVEKIFSYTLPLSKIMQTESLDLVTAIKICEDVVGQFEKFRKSAVTVFNEIYKRAEVLLRKMVDTNYAISIP-RINKLQIHRCNISSQSP-------EEYYRISLFIPFLDATVTQLKERFLKHKAILKAFNILIPSNTNTSHHEYSTNLEILLQKYNTDLNCTINMLIAEYELWQRKFSL--NPIQKNASVLQYLCEYSGEIFPNIFKLLKILATIPVTTSTVERSFSTLKYLKNYLRSTTAEDRLNGLALLYI--YIETCL*RKKKYLIYCRKKR 3970
            N  Y     Q ++++   + + + I+++  +   FS++  E  D    E   I +RF+D+D  L E F++F+               + +   GL+  + +GQ Y G+  +  +   + A++ + YP A+     + +LN+ L++   +  ++  M V++K  +F   +P     L   IS +C     K + LK+   + W + H+   + V+LL PL+L ++ I       W D+ +S +   + A+      ++++ ++   S+T    K +Q E++D+  A      V+    +   + + V++E +        + V+   A+ +P R+ +L + +     Q+P       E +++  L  P ++    ++K+ F ++   LKA   L           ++T+ E     Y TDL    + L AE   W+ K+      +   +++ + L     + FPN+   LKILAT+PV         +  + L+ YL  T    R   LA+L I  +I+T L    + ++ C  KR
Sbjct:  221 NEEYCPAVQQRQLLDVCEKCVREEILQQVRECRFFSIVTGELVDFPEGEHLPIFLRFVDQDNTLREEFIEFLSFEGEEVTVAERLESRLMKGWGLSMEHCRGQAYAGSGILGTKMKVITAQLKEKYPMAVITPTSTCALNVHLANGMSLTGVQVVMSVLKKSNAFFRASPLLQTELDNAISILCQGNLEKESILKEGSRSTWTDLHNLFEMAVDLLEPLLLCMDSIHDNEDLKWSDQVTSDAYAISEALADFEFIVTLVILKNALSFTRAFGKNLQGETIDVFFAANSLTAVLHSLHEVSDN-LEVYHEFW------FEEAVNMATAMEVPVRVPRLFLRK----QQTPDTIEIQAESFFKEYLTQPVMEYITQEVKDIFSENH--LKALKCLSLVPAVMGQMRFNTSEESHADIYRTDLPHP-DTLPAELHCWRIKWKHRGKEVSLPSTIYETLQHSDVKFFPNVNAFLKILATLPVLKLDGSHGETAQRRLQAYLTDTAVSQRCKNLAVLNINYHIKTDL----EEMVQCYLKR 738          
BLAST of TTF-type domain-containing protein vs. Ensembl Zebrafish
Match: AL928808.1 (pep chromosome:GRCz11:20:17257101:17259573:-1 gene:ENSDARG00000101333.2 transcript:ENSDART00000166397.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:AL928808.1)

HSP 1 Score: 68.1662 bits (165), Expect = 5.739e-11
Identity = 55/191 (28.80%), Postives = 86/191 (45.03%), Query Frame = 2
Query: 2531 FSVLADETTDMSTQEQFSICIRFIDKDKKLNESFLQFVPVVS-TSSKSLANTLVQFLSSIGLNPSYLKGQGYDGAEAMSGRFNGVQA--KIMDLYPSALYVHCVSHSLNLALSDVCQIQDIRNCMGVVEKCYSFMNTPKRDAVLQKKISDICPDAKRTKLKK*CPTRWVERHDSIMIMVELLNPLILALEE 3094
            FS+  DE+ D+  + QF+I +RF+ +D  + E  L  VP+   T    L  TL+  +    L  S L     DGA AM G   G+    K  D +P+    HC+ H  +     V +  ++ + M  V +  +F+ T   +    K + D   +   + L   C  RW+ R   +    ELLNP+ L L E
Sbjct:  185 FSIALDESCDVQDKPQFAIFVRFVSEDCTIREELLDIVPLKDRTRGIDLKETLMTVVEKANLQLSKLTAIVTDGAPAMLGSERGLVGLCKADDRFPAFWTFHCIIHQEHW----VSKKLNLDHIMKPVLEIVNFVRTHALNHRQFKNLIDELDEDLPSDLLFHCAVRWLSRGHVLSRFFELLNPVKLFLAE 371          
BLAST of TTF-type domain-containing protein vs. Ensembl Zebrafish
Match: si:ch211-240b21.2 (si:ch211-240b21.2 [Source:ZFIN;Acc:ZDB-GENE-060526-125])

HSP 1 Score: 58.5362 bits (140), Expect = 8.152e-9
Identity = 27/54 (50.00%), Postives = 38/54 (70.37%), Query Frame = 2
Query: 3749 EIFPNIFKLLKILATIPVTTSTVERSFSTLKYLKNYLRSTTAEDRLNGLALLYI 3910
            E+F     L+KIL T P+TT+  ER FSTLK +K +LR++  ++RLN LA+L I
Sbjct:  148 EVFSETVTLVKILVTTPMTTAEAERCFSTLKRIKTFLRNSMTQERLNALAMLSI 201          
BLAST of TTF-type domain-containing protein vs. Ensembl Xenopus
Match: tbx18 (T-box 18 [Source:Xenbase;Acc:XB-GENE-489907])

HSP 1 Score: 237.269 bits (604), Expect = 7.598e-66
Identity = 180/623 (28.89%), Postives = 303/623 (48.64%), Query Frame = 2
Query: 2093 KHQITNYHKYSVLRADDLQTVVDGKRQSVIDLIDTCRVKHAKKNRLKLTPIIKTLLFLW*K*FSTSG-TSRYGHL*YEY**N*QKYNTPXXXXXXXXXXXXXXXXXXXXXTFR---NANYLSWKIQNEMINA--GNQIILKRIIERANQSECFSVLADETTDMSTQEQFSICIRFID---KDKKLNESFLQFVPVVSTSSKSLANTLVQFLSSIGLNPSYLKGQGYDGAEAMSGRFNGVQAKIMDLYPSALYVHCVSHSLNLALSDVCQIQDIRNCMGVVEKCYSFM-NTPKRDAVLQKKISDICPDAKRTKLKK*CPTRWVERHDSIMIMVELLNPLILALEEIETWKDKESSSSKNRAI--KSTNIFLSILTVEKIFSYTL-PLSKIMQTESLDLVTAIKICEDVVGQFEKFRKSAVTVFNEIYKRAEVLLRKMVDTNYAISIPRINKLQIHRCNISSQSPEEYYRISLFIPFLDATVTQLKERFLKHKAILKAFNI--LIPSN-TNTSHHEYSTNLEILLQKYNTDLNCTINMLIAEYELWQRKFSLNPIQKNASVLQYLCEYSGEIFPNIFKLLKILATIPVTTSTVERSFSTLKYLKNYLRSTTAEDRLNGLALLYIY 3913
            KH +T +HK +   A +   V     QS++  +++      ++NR KL  ++ T++F      +  G TS  G++   Y                                FR       L   ++N  +NA     I+ +RII  AN S  FSV+ADE+ D+S  EQ S+ +RF+D      K+ E FL F  + +  + S+AN +++     GLN   L GQGYDG   M+G+  GVQAKI + YP A++VHC SH LNL ++++  + +IRN +G V+    F   +PKR +++        P+         C TRW  ++ SI +  E  + +   L ++ +    + S   ++ +   ST+ FL  L +   +S  L PL++ +Q   +D+  A    ++++  F   R+ A   F +I    + +  +   T+  +S+PR    Q H  N+   + EEYYR ++++P+LD+ +  LK RF  H   +  FN+  L P         E+   ++ +   YN      I+ L AE   W   +S    Q   + L  L  Y+ ++ P + + + I  T+PVTT TVERSFS+++ +K +LRST   +RL+GL ++ ++
Sbjct:   29 KHSLTMWHKQAYADATNFINVRSHPEQSIVCQVNSAVKHQVEENRKKLYSVLSTIVFCGTHDIALRGKTSTSGNVQALY-------------------------------DFRIESGDEILKNHLKNAPVNALLCEDILRERIISAANNSVGFSVIADESADISGHEQLSLGVRFVDLTITPVKIREEFLGFATLKAFDATSIANVIMEQCIKFGLNIDKLYGQGYDGCSTMAGKEGGVQAKIKEKYPRAIFVHCASHKLNLVVNNLNAVPEIRNAIGSVKAIIKFFRESPKRRSLI--------PNVPLL-----CETRWTAKYKSIRVFSENFDRIFQQLRDLVSTASGKISQEAHQLLCCSSTSTFLFCLVIMATYSARLEPLTQALQAVEMDIAKAHSHVQELIQMFLNHRQQAEEHFKDILVNVQNIAER---TDIELSLPRRCGRQKHHSNVPGSTVEEYYRRAIYVPYLDSVIASLKTRFDCHN--ITNFNLFSLHPHQMAKIKQQEFKEKIKQITSIYN------IDNLDAEALTWFDLWSGKEKQDFQNGLLDLLPYT-DLIPAVRQAILIALTLPVTTCTVERSFSSMRRVKTWLRSTMTVNRLSGLCMMSLH 595          
BLAST of TTF-type domain-containing protein vs. Ensembl Xenopus
Match: slc10a6 (solute carrier family 10 (sodium/bile acid cotransporter), member 6 [Source:Xenbase;Acc:XB-GENE-988401])

HSP 1 Score: 175.637 bits (444), Expect = 1.825e-45
Identity = 130/481 (27.03%), Postives = 221/481 (45.95%), Query Frame = 2
Query: 1904 RKFNYSWLLNYPWLVYSKSIDAVYCKYCCFFATNNSADRATQALGQLVKDPFKTWRRATRTFNKHQITNYHKYSVLRADDLQTVVDGKRQSVIDLIDTCRVKHAKKNRLKLTPIIKTLLFLW*K*FSTSG-TSRYGHL*YEY**N*QKYNTPXXXXXXXXXXXXXXXXXXXXXTFRNANYLSWKIQNEMINAGNQIILKRIIERANQSECFSVLADETTDMSTQEQFSICIRFID---KDKKLNESFLQFVPVVSTSSKSLANTLVQFLSSIGLNPSYLKGQGYDGAEAMSGRFNGVQAKIMDLYPSALYVHCVSHSLNLALSDVCQIQDIRNCMGVVEKCYSFM-NTPKRDAVLQKKISDICPDAKRTKLKK*CPTRWVERHDSIMIMVELLNPLILALEEIETWKDKESSSSKNRAI--KSTNIFLSILTVEKIFSYTL-PLSKIMQTESLDLVTAIKICEDVVGQFEKFRKSAVTVFN 3322
            R F + WL  Y W+ YS  +    CKYC  F       R  Q  G  +  PF  +R    +  KH +T  HK +   A +   V     QS++  +++      ++NR KL  ++ T++F      +  G TS  G++              +       +    I ++       NA Y S +++NE+I                    FSV+ADE+ D+S  EQ S+ +RF+D      K+ E FL F  + +  + S+AN +++     GLN   L GQGYDG   M+G+  GVQAKI + YP A++V+C SH LNL ++D+  + DIRN +G  +    F   +PKR +++        P+         C TRW  ++ SI +  E  + +   L ++ +    + S   ++ +   ST+ FL  L +   +S  L PL++ +Q   +D+  A    ++++   ++  K   +++N
Sbjct:   24 RCFRHVWLKQYRWICYSPHLKGALCKYCVIFP--QPVHRGFQ--GAFITAPFLKYRDFHNSARKHSLTTCHKQAYDDATNFINVRSHPEQSIVCQVNSAVKHQVEENRKKLYSVLSTIVFCGTHDIALRGKTSTSGNV--------------QALFDFCIESGDEILKNHLKNAPVNARYTSVRVENELIVLSG----------------FSVIADESADISGHEQLSLGVRFVDLTITPVKIREEFLGFATLKAVDATSIANVIMEQCIKFGLNMDKLYGQGYDGCSTMAGKEGGVQAKIKEKYPRAIFVYCASHKLNLVVNDLKAVPDIRNAIGSGKAIIKFFRESPKRRSLI--------PNVPLL-----CETRWTAKYKSIRVFSENFDRIFQQLRDLVSTASGKISQEAHQLLCCSSTSTFLFCLVIMATYSARLEPLTQALQAVEMDIAKAHSHVQELIQIIQRKIKQITSIYN 457          

HSP 2 Score: 51.9878 bits (123), Expect = 8.298e-6
Identity = 32/90 (35.56%), Postives = 53/90 (58.89%), Query Frame = 2
Query: 3644 INMLIAEYELWQRKFSLNPIQKNASVLQYLCEYSGEIFPNIFKLLKILATIPVTTSTVERSFSTLKYLKNYLRSTTAEDRLNGLALLYIY 3913
            I+ L AE   W   +S    Q   + L  L  Y+ ++ P + + + I  T+PVTT TVERSFS+++ +K +LRST   + L+GL ++ ++
Sbjct:  458 IDNLAAEALTWFDVWSGKEKQDFQNGLLDLLPYT-DLIPAVRQAILIALTLPVTTCTVERSFSSMRRVKTWLRSTMTVNCLSGLCMMSLH 546          
BLAST of TTF-type domain-containing protein vs. Ensembl Xenopus
Match: thap12 (THAP domain containing 12 [Source:NCBI gene;Acc:394650])

HSP 1 Score: 133.265 bits (334), Expect = 5.813e-31
Identity = 126/514 (24.51%), Postives = 236/514 (45.91%), Query Frame = 2
Query: 2429 NANYLSWKIQNEMINAGNQIILKRIIERANQSECFSVLADETTDMSTQEQFSICIRFIDKDKKLNESFLQFVPVVSTSSKSLANTLVQFLSSIGLNPSYLKGQGYDGAEAMSGRFNGVQAKIMDLYPSALYVHCVSHSLNLALSDVCQIQDIRNCMGVVEKCYSFMN-TPKRDAVLQKKISDI--CPDAKRTKLKK*CPTRWVERHDSIMIMVELLNPLILALEEI---ETWKDKESSSSK----NRAIKSTNIFLSILTVEKIFSYTLPLSKIMQTESLDLVTAIKICEDVVGQFEKFRKSAVTVFNEI-YKRAEVLLRKMVDTNYAISIP-RINKLQIHRCNISSQ-SPEEYYRISLFIPFLDATVTQLKERFL-KHKAILKAFNILIPSNTNTSHHEYSTNLEILLQKYNTDL-NCTI---NMLIAEYELWQRKFSL--NPIQKNASVLQYLCEYSGEIFPNIFKLLKILATIPVTTSTVERSFSTLKYLKNYLRSTTAEDRLNGLALLYI 3910
            N  Y S   Q  M+      I   I+     +  FSV+ ++   +  +E   + +RFID+   L E FL F+P    +     N         GLN  + +GQ Y  +  +S     V ++++++YP  ++    + +LN+ L+    +  +   +G ++  YSF    P+    L++ I  +    + K    K    T W+ RHD+  I+V LL   IL L++I    ++K     +S+    + A+   +  ++ + ++   S+T    K +Q  + D+ +A      V+    +  K  + V++E  ++ A  L  K+   +  + +P R + LQ+   N+    + E +Y+ +L +P +   +  LK+ F  +H   LK  + L+PS       ++ST+     +++NTD+  C +   + L AE   W+ K+      ++  +++ + L     + FPN+F LLK+L  +PV     E+     K LK YL +T  E R   LA+L I
Sbjct:  220 NLEYCSRTQQRHMLEICESCIRDEILREVRDANFFSVVMEDAVSLGGEEHMPVFVRFIDETNNLREEFLGFLPCEGDAKALALNFHTTMTEKWGLNMEFCRGQAYVTSSGLSANMKFVASQLLEMYPQVVHTLSSTCALNIWLAKAIPVAGVSIVLGAMKDLYSFFQKQPQLKVELERTIKVLFQGNEEKADDYKNVIQTEWISRHDTFEIIVGLLQAFILCLDKITSDNSFKCNTKVTSRAFILSSALSDFDFIVTNVILKNALSFTRAFGKNLQGLTSDIFSAANSLTAVLHSLNEV-KDNIEVYHEFWFEEATNLAEKL---SVQVKLPSRFHTLQL--TNLQPDLTVESFYKDALSVPTIHHIIQGLKDIFSEQHLKALKCLS-LVPS--VMGQLKFSTS-----EEHNTDMYKCDLPNPDTLSAELHCWRVKWKHRGKDVELPSNIYESLHLSDIKFFPNVFALLKVLCILPVIKVDNEKFEVGRKRLKAYLGNTAVEHRSCQLAMLNI 719          
BLAST of TTF-type domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000043220.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:7:36411169:36451375:1 gene:ENSXETG00000018966.1 transcript:ENSXETT00000043220.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 132.109 bits (331), Expect = 1.139e-30
Identity = 134/518 (25.87%), Postives = 248/518 (47.88%), Query Frame = 2
Query: 2429 NANYLSWKIQNEMINAGNQIILKRIIERANQSECFSVLADETTDMSTQEQFSICIRFIDKDKKLNESFLQFVPVVSTSSKSLANTLVQFLSSIGLNPSYLKGQGYDGAEAMSGRFNGVQAKIMDLYPSALYVHCVSHSLNLALSDVCQ-IQDIRNCMGVVEKCYSFMNTPKRDAVLQKKISDICPDAKRTKLKK*CPTRWVERHDSIMIMVELLNPLILALEEIETWKDKESSSSKNRAIKSTNIFL--------SILTVEKIFSYTLPLSKIMQTESLDLVTAIKICEDVVGQFEKFRKSAVTVFNEIYKRAEVLLRKMVDTNYAISIPRINKLQIHRCNISSQSPEEY--------YRISLFIPFLDATVTQL--KERFLKHKAILKAFNILIPSNTNTSHHEYSTNLEILLQKYNTDLNCTINMLIAEYELWQRKF-SLNPIQKNASVL---QYLCEYS-GEIFPNIFKLLKILATIPVTTSTVERSFSTLKYLKNYLRSTTAEDRLNGLALLYI 3910
            + +YLS  +  E I+     +L+ II  A Q++ +S+  D T D+S  +Q +  I ++  D    E F++F+P V   +++L + ++  L    ++    +GQ YD A  MSG ++G+QA+I  + P A+Y+ C +HSLNL  +   +  ++  +   ++++ Y F +        +  IS +    K T +K    TRW  R D+ +                     +E+SS+ +    + ++ L        ++    KI S     ++ +Q +S+ ++ A KI   +   F++ R   V   +EIY  A  +  K+       + P+  K ++ +   S +S +E         +RISL   F D  ++ L  K + L   ++   F +  P+       +       L  KY+ DL+ +   L +E E ++ +  ++ P  K+A+ L   Q + +YS  + +PNI    +I  T PVT ++ +RSFS LK +KNYLRS+  ++RL+ L++L I
Sbjct:  214 STSYLSKTVCFEFIDIVASSVLEVIINEAKQAKYYSISVDSTPDVSHTDQLAFIICYVKNDGIPKERFIKFIPNVGHKAENLFSAVMDTLKEYHIDILDCRGQSYDNASNMSGPYSGLQARIKQVNPLAVYIPCSAHSLNLVGTSAAESCREAVSFFCILQQLYHFFSA--SSTRWEMLISHL--KRKATVVKNLSTTRWSARSDAYI---------------------RENSSNSDSVSTAQSLLLQVDFHFLCTLFVWNKILSQVDRDNQALQAKSISILDASKIVNGLRSTFQEMR---VISVDEIYFYARDVCEKL---EIPATFPQKRKRKV-KARASYESADEGASLSAGDNFRISLNQIF-DVLISDLTWKSKTLMDTSVDFEF-LSCPALVTFELSQLQKAASDLALKYSKDLDAS--ELCSEIESFRHQVEAILPDAKSATPLDLCQMIQDYSLADCYPNIDTAFRIFLTSPVTVASCKRSFSKLKLIKNYLRSSMEQERLSNLSILSI 695          
BLAST of TTF-type domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000005329.1 (uncharacterized LOC100494784 [Source:NCBI gene;Acc:100494784])

HSP 1 Score: 56.9954 bits (136), Expect = 2.527e-7
Identity = 93/460 (20.22%), Postives = 201/460 (43.70%), Query Frame = 2
Query: 2573 EQFSICIRFIDKDKKLNESFLQFVPVVSTSSKSLANTLVQFLSSIGLNPSYLKGQGYDGAEAMSGRFNGVQAKIMDLYPSALYVHCVSHSLNLALSDVCQIQDI-RNCMGVVEKCYSFMNTPKRDAVLQKKISDICPDAKRTKLKK*CPTRWVERHDSIMIMVELLNPLILALEEIETWKDKESSSSKNRAIK---------STNIFLSILTVEKIFSYTLPLSKIMQTESLDLVTAIKICEDVVGQFEKFRKSAVTVFNEIYKRAEVLLRKMVDTNYAISIPR--INKLQIHRCNISSQSPEEYYRISLFIPFLDATVTQLKERFLKHKAI--LKAFNILIPSNTNTSHHEYSTNLEILLQKYNTDLNCTINMLIAEYELWQRKFSLNPIQKNASVLQYLCEYSGEIFPNIFKLLKILATIPVTTSTVERSFSTLKYLKNYLRSTTAEDRLNGLALLYI 3910
            +Q S+C+R++D + +  E F+ F+  V  +  S AN ++  L    L    L+G  ++ + +     + ++ K       A++VHC +   +L   D  Q   + ++ +  V   +   +   +   L  +++     + R        ++W      +  +++    +I  L E++       SS+    +K           N + S+L +  I      L+  +  ++L + + +K  + V     + R+ A  V  ++ ++AE  + K      AI  P    ++LQ     +S ++  ++++ + ++  LDA ++ L+ RF++   I      ++L+ +                L KY  + N  + ML  + E++  K S + + +  S+ + +     E F  + KLLK+L  IPV T+  E+    ++ L+  L+ TTAE R + +A+ Y+
Sbjct:  387 QQLSLCLRYLDSEMQAQEEFIGFLDPVEETGTSAANLILDILDRNSLPIDLLRGIAFEASTSYKESCSLLKQK----QSLAMFVHCGTPCGSLLAKDSSQASPLLQHTLYSVNDLFDLFSKSIKHKFLFAEVTQNFNSSTRNLGS----SKWCVNLPVVNAVIQHYGLIIDGLREMK-------SSTGEGGVKVHFVLEKVMEGNTYASLLIIRSIMESLNILNIKLDDQNLLMSSTLKKVKLVKEILARLRQEATVV--DLLRQAEEAVTKFNLMPIAIPQPHQLSSQLQQSADQLSFENKGDFFK-NEYLKMLDAAISHLENRFMQQGFIEYCNLEDVLLCAGKGGESDRIIEEKLAFLSKY-PEFN--VRMLKVQLEMFAHKKSFSSLAEAVSLYKSVSPEVKEFFSELGKLLKLLLIIPVCTNDSEQVCCPVQRLRTVLQFTTAETRSSDVAVCYV 825          
BLAST of TTF-type domain-containing protein vs. Ensembl Mouse
Match: Thap12 (THAP domain containing 12 [Source:MGI Symbol;Acc:MGI:1920231])

HSP 1 Score: 154.066 bits (388), Expect = 1.032e-37
Identity = 136/521 (26.10%), Postives = 249/521 (47.79%), Query Frame = 2
Query: 2429 NANYLSWKIQNEMINAGNQIILKRIIERANQSECFSVLADETTDMSTQEQFSICIRFIDKDKKLNESFLQFVPVVSTSSKSLANTLVQFLSSI----GLNPSYLKGQGYDGAEAMSGRFNGVQAKIMDLYPSALYVHCVSHSLNLALSDVCQIQDIRNCMGVVEK-CYSFMNTPKRDAVLQKKISDICPDA--KRTKLKK*CPTRWVERHDSIMIMVELLNPLILALEEI------ETWKDKESSSS--KNRAIKSTNIFLSILTVEKIFSYTLPLSKIMQTESLDLVTAIKICEDVVGQFEKFRKSAVTVFNEIYKRAEVLLRKMVDTNYAISIP-RINKLQIHRCNISSQ-SPEEYYRISLFIPFLDATVTQLKERFL-KHKAILKAFNILIPS-------NTNTSHHEYSTNLEILLQKYNTDLNCTINMLIAEYELWQRKFSL--NPIQKNASVLQYLCEYSGEIFPNIFKLLKILATIPVTTSTVERSFSTLKYLKNYLRSTTAEDRLNGLALLYI 3910
            N  + S   Q  M+      I +  +     S  FS++ D+  D++ +E   + +RF+D    L E F+ F+P     ++ LA   V+F ++I    GLN  Y +GQ Y  +   S +   V +++++ YP A+Y  C S +LN  L+    +  +   +G +E+ C  F  +P+    L   IS +  ++  +  +LK+ C ++W  RHD+  I+V+LL  L+L L+ I        W +  +  +     A+   +  ++I+ ++ + S+T    K +Q ++ D+  A      V+    +  ++ + V++E +      L   +D    + +P +  + Q  + N+ SQ + E YY+ +L +P ++  + +LK+ F  +H   LK  + L+PS       NT+  HH            Y +DL    + L AE   W+ K+      I+  +++ + L     + FPN++ LLK+L  +PV     ER  +  K LK YLR+T  + R + LALL I
Sbjct:  222 NTLFCSKTQQRHMLEICESCIREETLREVRDSHFFSIITDDVVDIAGEEHLPVLVRFVDDAHNLREEFVGFLPY-EADAEILA---VKFHTTITEKWGLNMEYCRGQAYIVSSGFSSKMKVVASRLLEKYPQAVYTLCSSCALNAWLAKSVPVIGVSVALGTIEEVCSFFHRSPQLLLELDSVISVLFQNSEERAKELKEICHSQWTGRHDAFEILVDLLQALVLCLDGIINSDTNVRWNNYIAGRAFVLCSAVTDFDFIVTIVVLKNVLSFTRAFGKNLQGQTSDVFFAASSLTAVLHSLNEVMEN-IEVYHEFWFEEATNLATKLDIQ--MKLPGKFRRAQ--QGNLESQLTSESYYKDTLSVPTVEHIIQELKDIFSEQHLKALKCLS-LVPSVMGQLKFNTSEEHHA---------DMYRSDLP-NPDTLSAELHCWRIKWKHRGKDIELPSTIYEALHLPDIKFFPNVYALLKVLCILPVMKVENERYENGRKRLKAYLRNTLTDQRSSNLALLNI 722          
BLAST of TTF-type domain-containing protein vs. Ensembl Mouse
Match: Zmym1 (zinc finger, MYM domain containing 1 [Source:MGI Symbol;Acc:MGI:1915560])

HSP 1 Score: 119.783 bits (299), Expect = 1.126e-26
Identity = 122/529 (23.06%), Postives = 225/529 (42.53%), Query Frame = 2
Query: 2438 YLSWKIQNEMINAGNQIILKRIIERANQSECFSVLADETTDMSTQEQFSICIRFIDKDKK---LNESFLQFVPVVSTSSKSLANTLVQFLSSIGLNPSYLKGQGYDGAEAMSGRFNGVQAKIMDLYPSALYVHCVSHSLNLALSDVC-QIQDIRNCMGVVEKCYSFMNTPKRDAVLQKKISDICPDAKRTKLKK*CPTRWVERHDSIMIMVELLNPLILALEEIETWKDKESSSSKNRAIKSTNIFLSILT----------VEKIFSYTLPLSKIMQTESLDLVTAIKICEDVVGQFEKFRKSAVTVFNEIYKRAEVLLRKMVDTNYAISIPRINKLQIHRCNISSQ---------SPEEYYRISLFIPFLDATVTQLKERFLKHKAI-LKAFNILI-----PSNTNTSHHEYSTNLEILLQKYNTDLNCTINMLIAEYELWQRKFSLNPIQKNASVLQYLCEYSGEIF---------PNIFKLLKILATIPVTTSTVERSFSTLKYLKNYLRSTTAEDRLNGLALLYI 3910
            Y S  +Q E+I      +L+ I+   N S  FS++ +E    + + Q S+C+R+  K      + E FL FV     +   +   +  +L  +G++ + + GQ YD A   + + N V A+     P ALYVHC +H L LA+   C +++++R  +  +    S  NT      +   +  +C  +     KK         HD +++ V    P     E +E         +           L+++T          + ++ S T  LS+  Q+E++D+ +     E ++      R    T F  I+  A+ + +K+    + +  P   K +  +  +            S +E Y+ +++   LD  +  LK  F +     +K  + L+     P N  T+ H        + + Y  D +     +I E   +++    N I ++ S L ++    G +F         P I KLL I  + P+T++  E+SFSTL +LK YL  T  +++L+ LAL+ +
Sbjct:  355 YSSTLVQEEIIEMIKDEMLQDIVSEINASSAFSIICEEIAGSAAERQLSVCVRYPQKTPSAVLVKERFLGFVTAEEVTGVHVHGRIKAYLQQVGVDFNKICGQAYDSATNFTVKLNEVVAEFKKEEPRALYVHCHAHFLELAVISFCKEVKELREALHTL---CSLFNTVHVSEEMLASLQTMCKLSLNKTCKKHTSQSCWPAHDHLLLAVTDCLP-----EVVEVLASVSRRCAGTAVAAELEDLLAMVTKFEFIFCLKFLYRVLSITGILSREFQSETVDIFSLFSKIEAILECLSSERND--TYFKNIWDGADEICKKITSKGFDVEKPSFQKRRKVQRTVDPGNSEHMFFPTSADEQYKFNIYYQGLDTVLKHLKLYFSEFDYCKMKQISELLLKWNEPLNEATAKH--------IQEFYKLDAD-----IIPELRFYRQYAGFNFIAEDGS-LSFI--DLGSLFIQHALHNNIPCITKLLHIALSWPITSANNEKSFSTLSHLKTYLLRTMGQEKLSSLALIAV 857          
BLAST of TTF-type domain-containing protein vs. Ensembl Mouse
Match: Zmym1 (zinc finger, MYM domain containing 1 [Source:MGI Symbol;Acc:MGI:1915560])

HSP 1 Score: 119.398 bits (298), Expect = 1.712e-26
Identity = 123/532 (23.12%), Postives = 226/532 (42.48%), Query Frame = 2
Query: 2438 YLSWKIQNEMINAGNQIILKRIIERANQSECFSVLADETTDMSTQEQFSICIRFIDKDKK---LNESFLQFVPVVSTSSKSLANTLVQFLSSIGLNPSYLKGQGYDGAEAMSGRFNGVQAKIMDLYPSALYVHCVSHSLNLALSDVC-QIQDIRNCMGVVEKCYSFMNTPKRDAVLQKKISDICPDAKRTKLKK*CPTRWVERHDSIMIMVELLNPLILALEEIETWKDKESSSSKNRAIKSTNIFLSILT----------VEKIFSYTLPLSKIMQTESLDLVTAIKICEDVVGQFEKFRKSAVTVFNEIYKRAEVLLRKMVDTNYAISIPRINKLQIHRCNISSQ---------SPEEYYRISLFIPFLDATVTQLKERFLKHKAI-LKAFNILI-----PSNTNTSHHEYSTNLEILLQKYNTDLNCTINMLIAEYELWQRKFSLNPIQKNASVLQYLCEYSGEIF---------PNIFKLLKILATIPVTTSTVERSFSTLKYLKNYLRSTTAEDRLNGLALLYIYIE 3919
            Y S  +Q E+I      +L+ I+   N S  FS++ +E    + + Q S+C+R+  K      + E FL FV     +   +   +  +L  +G++ + + GQ YD A   + + N V A+     P ALYVHC +H L LA+   C +++++R  +  +    S  NT      +   +  +C  +     KK         HD +++ V    P     E +E         +           L+++T          + ++ S T  LS+  Q+E++D+ +     E ++      R    T F  I+  A+ + +K+    + +  P   K +  +  +            S +E Y+ +++   LD  +  LK  F +     +K  + L+     P N  T+ H        + + Y  D +     +I E   +++    N I ++ S L ++    G +F         P I KLL I  + P+T++  E+SFSTL +LK YL  T  +++L+ LAL+ +  E
Sbjct:  453 YSSTLVQEEIIEMIKDEMLQDIVSEINASSAFSIICEEIAGSAAERQLSVCVRYPQKTPSAVLVKERFLGFVTAEEVTGVHVHGRIKAYLQQVGVDFNKICGQAYDSATNFTVKLNEVVAEFKKEEPRALYVHCHAHFLELAVISFCKEVKELREALHTL---CSLFNTVHVSEEMLASLQTMCKLSLNKTCKKHTSQSCWPAHDHLLLAVTDCLP-----EVVEVLASVSRRCAGTAVAAELEDLLAMVTKFEFIFCLKFLYRVLSITGILSREFQSETVDIFSLFSKIEAILECLSSERND--TYFKNIWDGADEICKKITSKGFDVEKPSFQKRRKVQRTVDPGNSEHMFFPTSADEQYKFNIYYQGLDTVLKHLKLYFSEFDYCKMKQISELLLKWNEPLNEATAKH--------IQEFYKLDAD-----IIPELRFYRQYAGFNFIAEDGS-LSFI--DLGSLFIQHALHNNIPCITKLLHIALSWPITSANNEKSFSTLSHLKTYLLRTMGQEKLSSLALIAVEQE 958          
BLAST of TTF-type domain-containing protein vs. Ensembl Mouse
Match: Zmym1 (zinc finger, MYM domain containing 1 [Source:MGI Symbol;Acc:MGI:1915560])

HSP 1 Score: 119.398 bits (298), Expect = 1.712e-26
Identity = 123/532 (23.12%), Postives = 226/532 (42.48%), Query Frame = 2
Query: 2438 YLSWKIQNEMINAGNQIILKRIIERANQSECFSVLADETTDMSTQEQFSICIRFIDKDKK---LNESFLQFVPVVSTSSKSLANTLVQFLSSIGLNPSYLKGQGYDGAEAMSGRFNGVQAKIMDLYPSALYVHCVSHSLNLALSDVC-QIQDIRNCMGVVEKCYSFMNTPKRDAVLQKKISDICPDAKRTKLKK*CPTRWVERHDSIMIMVELLNPLILALEEIETWKDKESSSSKNRAIKSTNIFLSILT----------VEKIFSYTLPLSKIMQTESLDLVTAIKICEDVVGQFEKFRKSAVTVFNEIYKRAEVLLRKMVDTNYAISIPRINKLQIHRCNISSQ---------SPEEYYRISLFIPFLDATVTQLKERFLKHKAI-LKAFNILI-----PSNTNTSHHEYSTNLEILLQKYNTDLNCTINMLIAEYELWQRKFSLNPIQKNASVLQYLCEYSGEIF---------PNIFKLLKILATIPVTTSTVERSFSTLKYLKNYLRSTTAEDRLNGLALLYIYIE 3919
            Y S  +Q E+I      +L+ I+   N S  FS++ +E    + + Q S+C+R+  K      + E FL FV     +   +   +  +L  +G++ + + GQ YD A   + + N V A+     P ALYVHC +H L LA+   C +++++R  +  +    S  NT      +   +  +C  +     KK         HD +++ V    P     E +E         +           L+++T          + ++ S T  LS+  Q+E++D+ +     E ++      R    T F  I+  A+ + +K+    + +  P   K +  +  +            S +E Y+ +++   LD  +  LK  F +     +K  + L+     P N  T+ H        + + Y  D +     +I E   +++    N I ++ S L ++    G +F         P I KLL I  + P+T++  E+SFSTL +LK YL  T  +++L+ LAL+ +  E
Sbjct:  453 YSSTLVQEEIIEMIKDEMLQDIVSEINASSAFSIICEEIAGSAAERQLSVCVRYPQKTPSAVLVKERFLGFVTAEEVTGVHVHGRIKAYLQQVGVDFNKICGQAYDSATNFTVKLNEVVAEFKKEEPRALYVHCHAHFLELAVISFCKEVKELREALHTL---CSLFNTVHVSEEMLASLQTMCKLSLNKTCKKHTSQSCWPAHDHLLLAVTDCLP-----EVVEVLASVSRRCAGTAVAAELEDLLAMVTKFEFIFCLKFLYRVLSITGILSREFQSETVDIFSLFSKIEAILECLSSERND--TYFKNIWDGADEICKKITSKGFDVEKPSFQKRRKVQRTVDPGNSEHMFFPTSADEQYKFNIYYQGLDTVLKHLKLYFSEFDYCKMKQISELLLKWNEPLNEATAKH--------IQEFYKLDAD-----IIPELRFYRQYAGFNFIAEDGS-LSFI--DLGSLFIQHALHNNIPCITKLLHIALSWPITSANNEKSFSTLSHLKTYLLRTMGQEKLSSLALIAVEQE 958          
BLAST of TTF-type domain-containing protein vs. UniProt/SwissProt
Match: sp|O43422|P52K_HUMAN (52 kDa repressor of the inhibitor of the protein kinase OS=Homo sapiens OX=9606 GN=THAP12 PE=1 SV=2)

HSP 1 Score: 165.236 bits (417), Expect = 2.460e-40
Identity = 133/515 (25.83%), Postives = 245/515 (47.57%), Query Frame = 2
Query: 2429 NANYLSWKIQNEMINAGNQIILKRIIERANQSECFSVLADETTDMSTQEQFSICIRFIDKDKKLNESFLQFVPVVSTSSKSLANTLVQFLSSIGLNPSYLKGQGYDGAEAMSGRFNGVQAKIMDLYPSALYVHCVSHSLNLALSDVCQIQDIRNCMGVVEK-CYSFMNTPKRDAVLQKKISDICPDAKR--TKLKK*CPTRWVERHDSIMIMVELLNPLILALEEIET-----WKDKESSSS--KNRAIKSTNIFLSILTVEKIFSYTLPLSKIMQTESLDLVTAIKICEDVVGQFEKFRKSAVTVFNEIYKRAEVLLRKMVDTNYAISIPRINKLQIHRCNISSQ-SPEEYYRISLFIPFLDATVTQLKERFL-KHKAILKAFNILIPS-------NTNTSHHEYSTNLEILLQKYNTDLNCTINMLIAEYELWQRKFSL--NPIQKNASVLQYLCEYSGEIFPNIFKLLKILATIPVTTSTVERSFSTLKYLKNYLRSTTAEDRLNGLALLYI 3910
            N  + S   Q +M+      I +  +     S  FS++ D+  D++ +E   + +RF+D+   L E F+ F+P  + +               GLN  Y +GQ Y  +   S +   V +++++ YP A+Y  C S +LN+ L+    +  +   +G +E+ C  F  +P+    L   IS +  ++K    +LK+ C ++W  RHD+  I+VELL  L+L L+ I +     W +  +  +     A+   +  ++I+ ++ + S+T    K +Q ++ D+  A      V+    +  ++ + V++E +      L   +D    + +P   + + H+ N+ SQ + E YY+ +L +P ++  + +LK+ F  +H   LK  + L+PS       NT+  HH            Y +DL    + L AE   W+ K+      I+  +++ + L     + FPN++ LLK+L  +PV     ER  +  K LK YLR+T  + R + LALL I
Sbjct:  226 NTLFCSKTQQRQMLEICESCIREETLREVRDSHFFSIITDDVVDIAGEEHLPVLVRFVDESHNLREEFIGFLPYEADAEILAVKFHTMITEKWGLNMEYCRGQAYIVSSGFSSKMKVVASRLLEKYPQAIYTLCSSCALNMWLAKSVPVMGVSVALGTIEEVCSFFHRSPQLLLELDNVISVLFQNSKERGKELKEICHSQWTGRHDAFEILVELLQALVLCLDGINSDTNIRWNNYIAGRAFVLCSAVSDFDFIVTIVVLKNVLSFTRAFGKNLQGQTSDVFFAAGSLTAVLHSLNEVMEN-IEVYHEFWFEEATNLATKLDIQ--MKLPGKFR-RAHQGNLESQLTSESYYKETLSVPTVEHIIQELKDIFSEQHLKALKCLS-LVPSVMGQLKFNTSEEHH---------ADMYRSDLP-NPDTLSAELHCWRIKWKHRGKDIELPSTIYEALHLPDIKFFPNVYALLKVLCILPVMKVENERYENGRKRLKAYLRNTLTDQRSSNLALLNI 725          
BLAST of TTF-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9CUX1|P52K_MOUSE (52 kDa repressor of the inhibitor of the protein kinase OS=Mus musculus OX=10090 GN=Thap12 PE=2 SV=2)

HSP 1 Score: 154.066 bits (388), Expect = 7.216e-37
Identity = 136/521 (26.10%), Postives = 249/521 (47.79%), Query Frame = 2
Query: 2429 NANYLSWKIQNEMINAGNQIILKRIIERANQSECFSVLADETTDMSTQEQFSICIRFIDKDKKLNESFLQFVPVVSTSSKSLANTLVQFLSSI----GLNPSYLKGQGYDGAEAMSGRFNGVQAKIMDLYPSALYVHCVSHSLNLALSDVCQIQDIRNCMGVVEK-CYSFMNTPKRDAVLQKKISDICPDA--KRTKLKK*CPTRWVERHDSIMIMVELLNPLILALEEI------ETWKDKESSSS--KNRAIKSTNIFLSILTVEKIFSYTLPLSKIMQTESLDLVTAIKICEDVVGQFEKFRKSAVTVFNEIYKRAEVLLRKMVDTNYAISIP-RINKLQIHRCNISSQ-SPEEYYRISLFIPFLDATVTQLKERFL-KHKAILKAFNILIPS-------NTNTSHHEYSTNLEILLQKYNTDLNCTINMLIAEYELWQRKFSL--NPIQKNASVLQYLCEYSGEIFPNIFKLLKILATIPVTTSTVERSFSTLKYLKNYLRSTTAEDRLNGLALLYI 3910
            N  + S   Q  M+      I +  +     S  FS++ D+  D++ +E   + +RF+D    L E F+ F+P     ++ LA   V+F ++I    GLN  Y +GQ Y  +   S +   V +++++ YP A+Y  C S +LN  L+    +  +   +G +E+ C  F  +P+    L   IS +  ++  +  +LK+ C ++W  RHD+  I+V+LL  L+L L+ I        W +  +  +     A+   +  ++I+ ++ + S+T    K +Q ++ D+  A      V+    +  ++ + V++E +      L   +D    + +P +  + Q  + N+ SQ + E YY+ +L +P ++  + +LK+ F  +H   LK  + L+PS       NT+  HH            Y +DL    + L AE   W+ K+      I+  +++ + L     + FPN++ LLK+L  +PV     ER  +  K LK YLR+T  + R + LALL I
Sbjct:  222 NTLFCSKTQQRHMLEICESCIREETLREVRDSHFFSIITDDVVDIAGEEHLPVLVRFVDDAHNLREEFVGFLPY-EADAEILA---VKFHTTITEKWGLNMEYCRGQAYIVSSGFSSKMKVVASRLLEKYPQAVYTLCSSCALNAWLAKSVPVIGVSVALGTIEEVCSFFHRSPQLLLELDSVISVLFQNSEERAKELKEICHSQWTGRHDAFEILVDLLQALVLCLDGIINSDTNVRWNNYIAGRAFVLCSAVTDFDFIVTIVVLKNVLSFTRAFGKNLQGQTSDVFFAASSLTAVLHSLNEVMEN-IEVYHEFWFEEATNLATKLDIQ--MKLPGKFRRAQ--QGNLESQLTSESYYKDTLSVPTVEHIIQELKDIFSEQHLKALKCLS-LVPSVMGQLKFNTSEEHHA---------DMYRSDLP-NPDTLSAELHCWRIKWKHRGKDIELPSTIYEALHLPDIKFFPNVYALLKVLCILPVMKVENERYENGRKRLKAYLRNTLTDQRSSNLALLNI 722          
BLAST of TTF-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q5SVZ6|ZMYM1_HUMAN (Zinc finger MYM-type protein 1 OS=Homo sapiens OX=9606 GN=ZMYM1 PE=1 SV=1)

HSP 1 Score: 123.635 bits (309), Expect = 5.576e-27
Identity = 135/540 (25.00%), Postives = 243/540 (45.00%), Query Frame = 2
Query: 2420 TFRNAN-----YLSWKIQNEMINAGNQIILKRIIERANQSECFSVLADETTDMSTQEQFSICIRFIDKDKK---LNESFLQFVPVVSTSSKSLANTLVQFLSSIGLNPSYLKGQGYDGAEAMSGRFNGVQAKIMDLYPSALYVHCVSHSLNLALSDVC-QIQDIRNCMGVVEKCYSFMNTPKRDAVLQKKISDICPDAKRTKLKK*CPTRWVERHD-SIMIMVELLNPLILALEEIETWKDKESSSSKNRAIKSTNIFLSILTVEKIF---------SYTLPLSKIMQTESLDLVTAIKICEDVVGQFEKFRKSAVTVFNEIYKRAEVLLRKMVDTNYAISIPRINKLQIHRCNIS---------SQSPEEYYRISLFIPFLDATVTQLKERF--LKHKAILKAFNILI----PSNTNTSHHEYSTNLEILLQKYNTDLNCTINMLIAEYELWQRKFSLNPIQKNASV----LQYLCEYSG--EIFPNIFKLLKILATIPVTTSTVERSFSTLKYLKNYLRSTTAEDRLNGLALLYIYIE 3919
            TFR  N     Y S +IQ+++I      +L+ I+   N S  FS++ DET + + +EQ SIC+R+  K  K   + E FL FV     +   L  T+  +L  IG++   + GQ YD    +  +FN + A+     P ALY+HC +H L+L++   C +++++R+ +  +    S  NT      +     +I   ++    KK         HD +++ +++ L  +I  LE I +      SS+ + A + +++   +   E +F         S T  LSK +Q +++D+ +     E ++      R      F  I+   E + +K+    + +  P + K +  + ++            S EE Y+I+++   LD  +  LK  F    +  I +   +L     P N  T+ H        + + Y  D +     +I E   ++    LN +  ++ +    L  L    G     P + KLL I  + P+T+++ E SFSTL  LK YL +T  +++L G AL+ +  E
Sbjct:  601 TFRLMNSQVDFYNSTQIQSDIIEIIKTEMLQDIVNEINDSSAFSIICDETINSAMKEQLSICVRYPQKSSKAILIKERFLGFVDTEEMTGTHLHRTIKTYLQQIGVDMDKIHGQAYDSTTNLKIKFNKIAAEFKKEEPRALYIHCYAHFLDLSIIRFCKEVKELRSALKTLS---SLFNTICMSGEMLANFRNIYRLSQNKTCKKHISQSCWTVHDRTLLSVIDSLPEIIETLEVIAS-----HSSNTSFADELSHLLTLVSKFEFVFCLKFLYRVLSVTGILSKELQNKTIDIFSLSSKIEAILECLSSERNDV--YFKTIWDGTEEICQKITCKGFKVEKPSLQKRRKIQKSVDLGNSDNMFFPTSTEEQYKINIYYQGLDTILQNLKLCFSEFDYCKIKQISELLFKWNEPLNETTAKH--------VQEFYKLDED-----IIPELRFYRHYAKLNFVIDDSCINFVSLGCLFIQHGLHSNIPCLSKLLYIALSWPITSASTENSFSTLPRLKTYLCNTMGQEKLTGPALMAVEQE 1117          
BLAST of TTF-type domain-containing protein vs. UniProt/SwissProt
Match: sp|O60290|ZN862_HUMAN (Zinc finger protein 862 OS=Homo sapiens OX=9606 GN=ZNF862 PE=2 SV=2)

HSP 1 Score: 80.1073 bits (196), Expect = 1.448e-13
Identity = 56/188 (29.79%), Postives = 94/188 (50.00%), Query Frame = 2
Query: 2480 NQIILKRIIERANQSECFSVLADETTDMSTQEQFSICIRFIDKDKKLNESFLQFVPVVSTSSKSLANTLVQFLSSIGL---NPSYLKGQGYDGAEAMSGRFNGVQAKIMDLYPSALYVHCVSHSLNLALSDVCQIQD-IRNCMGVVEKCYSFMNTP-KRDAVLQKKISDICPDAKRTKLKK*CPTRWV 3028
            ++ + + I+E    S C SVL D +TD S Q    I IR+  K  ++ ES++   P+ S ++     T+V  L  + +    P ++ G G DG+  +S R  G+  K  ++ P  L VHCV+H L+LA+ D C   D ++ C   +   + F  +  KR   LQ+  + +  + +  +LK     RWV
Sbjct:  607 SETLKREILEDVRNSPCVSVLLDSSTDASEQACVGIYIRYF-KQMEVKESYITLAPLYSETADGYFETIVSALDELDIPFRKPGWVVGLGTDGSAMLSCR-GGLVEKFQEVIPQLLPVHCVAHRLHLAVVDACGSIDLVKKCDRHIRTVFKFYQSSNKRLNELQEGAAPL--EQEIIRLKDLNAVRWV 790          
BLAST of TTF-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9HCI6|K1586_HUMAN (E3 SUMO-protein ligase KIAA1586 OS=Homo sapiens OX=9606 GN=KIAA1586 PE=1 SV=2)

HSP 1 Score: 61.2326 bits (147), Expect = 6.156e-8
Identity = 48/178 (26.97%), Postives = 85/178 (47.75%), Query Frame = 2
Query: 2429 NANYLSWKIQNEMINAGNQIILKRIIERANQSECFSVLADETTDMSTQEQFSICIR-FIDKDKKLNESFLQFVPVVSTSSKSLANTLVQFLSSIGLNPSYLKGQGY----DGAEAMSGRFNGVQAKIMDLYPSALYVHCVSHSLNLALSD-VCQIQDIRNCMGVVEKCYSFMNTPKRD 2944
            N  Y + +I   +       I K IIE  N   C  ++ DE + +S +    I ++  I         F+    +VST ++ + NTL+  L+  G    YLK        DGA  + GR +GV  K+++ +P  +  +C++H L L+L D + +I+ I +    ++K YS  + P ++
Sbjct:  283 NTRYSATRIAEHIAKEMKMKIFKNIIEE-NAKIC--IIIDEASTVSKKTTLVIYLQCTIQSAPAPVMLFVALKELVSTIAECIVNTLLTTLNDCGFTNEYLKANLIAFCSDGANTILGRKSGVATKLLENFPEIIIWNCLNHRLQLSLDDSISEIKQINHLKIFIDKIYSIYHQPNKN 457          
BLAST of TTF-type domain-containing protein vs. TrEMBL
Match: A0A2S2Q502 (Repressor of the inhibitor of the protein kinase OS=Sipha flava OX=143950 GN=PRKRIR_14 PE=4 SV=1)

HSP 1 Score: 534.643 bits (1376), Expect = 2.192e-168
Identity = 295/718 (41.09%), Postives = 448/718 (62.40%), Query Frame = 2
Query: 1805 LKDEEKIYYLNNFWKPPPNFCFPGTKIQNENFKRKFNYSWLLNYPWLVYSKSIDAVYCKYCCFFATNNSADRATQALGQLVKDPFKTWRRATRTFNKHQITNYHKYSVLRADDLQTVVDGKRQSVIDLIDTCRVKHAKKNRLKLTPIIKTLLFLW*K*FSTSGTSRYGHL*YEY**N*QKYNTPXXXXXXXXXXXXXXXXXXXXXTFRNANYLSWKIQNEMINAGNQIILKRIIERANQSECFSVLADETTDMSTQEQFSICIRFID----KDKKLNESFLQFVPVVSTSSKSLANTLVQFLSSIGLNPSYLKGQGYDGAEAMSGRFNGVQAKIMDLYPSALYVHCVSHSLNLALSDVCQIQDIRNCMGVVEKCYSFMNTPKRDAVLQKKISDICPDAKRTKLKK*CPTRWVERHDSIMIMVELLNPLILALEEIETWKDKESSSSKNR---AIKSTNIFLSILTVEKIFSYTLPLSKIMQTESLDLVTAIKICEDVVGQFEKFRKSAVTVFNEIYKRAEVLLRKMVDTNYAISIPRINKLQIHRCNISSQSPEEYYRISLFIPFLDATVTQLKERFLKHKAILKAFNILIPSN---TNTSHHEYSTNLEILLQKYNTDL-NCTINMLIAEYELWQRKFSL--NPIQKNASVLQYLCEYSGEIFPNIFKLLKILATIPVTTSTVERSFSTLKYLKNYLRSTTAEDRLNGLALLYIYIE 3919
            L D EKI  + N W P  ++ F   +I ++N  RKFN  WL  Y WL YSK  ++VYCK C  FA + + + ++QAL QLVK  +  W+ A   F KH   NYHK ++L+ D    ++ GK  S+   ID    K A  N+ KL PIIKT++    +  S      YG    +      + N      + I      +++     + +NA Y+SW IQN++I   ++II+K+++ + N+++ FSVLADETTD+ST EQFS+C+RF++     + K+ E FL+FVPV ST+ + LA+ +++ L++IG++ ++L+GQGYDGA +MS +F GVQA I + YP+A+YVHCVSHSLNLALS+  ++  IRN  G++EK Y+F NTPKR  +LQ  I     ++ +TKLK+ CPTRWVERHDS++I+ ++L P++ ALEEI++W  K+SSS+       I+ ++  +S+L  EK+ SYTLP+SKI+Q+  LD+  A+   + V+   +  R +    F  I+  A  +   +  T   I +PR+ K Q  RCN+ S++ EEYY+ ++FIP+LD+ +  + ERFLKHK ++K+F  L+P+      T   +YS     LL+ Y  D+    +N   AE++LW +KF+   + +  NA     LC  +  +F  IF LLKI +T+PV+TST ERSFS+L+ +K YLR+T +++RLNGLA+L I+ E
Sbjct:   80 LSDHEKINIIQNMWVPDNSYIFKTQQIGSQN--RKFNRFWLTKYKWLAYSKLENSVYCKTCVLFAPSYAGNCSSQALNQLVKTGYNNWKNALERFEKHSFLNYHKDAILKYDTFIDIMSGKLLSIDKKIDKDSQKQALDNQEKLKPIIKTVILCGRQNLSLRSHRDYGVFSTKKEPAENEGNFRALLRARIESGDESLKKHFETCS-KNATYISWNIQNQIIEVCDEIIIKKLVTKINKAKFFSVLADETTDVSTVEQFSLCVRFVELMSNNEYKIVEQFLKFVPVQSTTGQRLADVILETLNNIGIDLNFLRGQGYDGASSMSDQFKGVQALITNKYPTAIYVHCVSHSLNLALSNAAEVVPIRNAFGILEKIYTFFNTPKRQDILQHNIETSTYNSNKTKLKQLCPTRWVERHDSVIILKQMLLPVVAALEEIQSWSCKDSSSNAFLLLCGIRQSSFIISLLCAEKLLSYTLPISKILQSTDLDISDALNNVDSVISVLQNIRTNVENEFKIIFNEACEIADALEIT---IVMPRLTKNQTKRCNVPSENEEEYYKRAIFIPWLDSFINSISERFLKHKDVIKSFKCLLPTGHIPNQTEKSQYSK----LLEFYKNDIPQNGVNAAAAEFDLWYQKFAHQNHSLPHNAIDALNLC--NDTLFQTIFILLKIFSTLPVSTSTTERSFSSLRRIKTYLRNTMSQNRLNGLAMLRIHRE 785          
BLAST of TTF-type domain-containing protein vs. TrEMBL
Match: A0A5N4AYX7 (Uncharacterized protein OS=Photinus pyralis OX=7054 GN=PPYR_04748 PE=4 SV=1)

HSP 1 Score: 522.702 bits (1345), Expect = 6.856e-164
Identity = 299/756 (39.55%), Postives = 438/756 (57.94%), Query Frame = 2
Query: 1724 PSNSQNLENRNDNDVLNVLSRHSNLNILKDEEKIYYLNNFWKPPPNFCFPGTKIQNENFKRKFNYSWLLNYPWLVYSKSIDAVYCKYCCFFATNNSADRATQALGQLVKDPFKTWRRATRTFNKHQITNYHKYSVLRADDLQTVVDGKR--QSVIDLIDTCRVKHAKKNRLKLTPIIKTLLFLW*K*FSTSGTSRYGHL*YEY**N*---QKYNTPXXXXXXXXXXXXXXXXXXXXXTFRNANYLSWKIQNEMINAGNQIILKRIIERANQSECFSVLADETTDMSTQEQFSICIRFIDKDKK----LNESFLQFVPVVSTSSKSLANTLVQFLSSIGLNPSYLKGQGYDGAEAMSGRFNGVQAKIMDLYPSALYVHCVSHSLNLALSDVCQIQDIRNCMGVVEKCYSFMNTPKRDAVLQKKISDICPDAKRTKLKK*CPTRWVERHDSIMIMVELLNPLILALEEIETWKDKESSSSKN---RAIKSTNIFLSILTVEKIFSYTLPLSKIMQTESLDLVTAIKICEDVVGQFEKFRKSAVTVFNEIYKRAEVLLRKMVDTNYAISIPRINKLQIHRCNISSQSPEEYYRISLFIPFLDATVTQLKERFLKHKAILKAFNILIPS------NTNTSHHEYSTNLEILLQK----YNTDLNCT-INMLIAEYELWQRKFSLNP-IQKNASVLQYLCEYSGEIFPNIFKLLKILATIPVTTSTVERSFSTLKYLKNYLRSTTAEDRLNGLALLYIYIE 3919
            P+   N + +N  D+ +++SR      L D EKI +L N W P  NF FP         +RKF YSWL  +PWL YS+  D VYC YC  FA  +    ++Q+ G  VK  F  W++A   F +H    YH++SV+ A + + V+ G    + +  +ID      AK+N  K+ PI++++LF   +  +  G   +G    E+  N    +     +  L    + +            +NA Y+SWKIQNE++ A +++I ++II     ++ FS+LADET+D+ST EQFS+C+R++ +D +    + E FL+FVPV ST+ ++LANT+   L    L+   L+GQGYDGA +MSG F G QA+I   +P ALYVHC SHSLNLALS+   I+ I+NC G++EK   F NTPKR+AVL+K+I+   P++ R KL K C TRWVERHDS+M+  +LL P   ALEEI  W D++SSS  N    AI+     +++ T EK+ SYTL LSK +QT   DLV+ I   E+ + Q +  R++A   F+EI++ A     K       I IPR    Q+HR N  +   EEY+R ++FIPF ++    +++R +KH+ ILK+F  L+P         + +  E    LEI ++K    Y +D+  + I++L +E +LW   F  +  + + A      C+ S  ++PN+  LLKI AT+PVTT T ERSFSTL+ L  YLR+T  E RLNGLA L I+ E
Sbjct:   45 PNADHNFQEKNSMDISSLISRR-----LTDAEKINFLRNRWIPDDNFVFPYRTCGER--RRKFCYSWLKKFPWLSYSRKEDTVYCVYCALFAPESVGINSSQSAGSFVKKGFCNWKKALEKFQQHCGLTYHEHSVVAALNFEKVMSGSSSMKGIDKVIDVASENQAKRNAEKIKPIVESVLFCGRQGIALRGHRDHG----EFDLNCAPVENEGNLRALLRLRVQANDKNIIEHFQNCGKNATYISWKIQNEILAASHRVIKEKIIAEVKDAKFFSILADETSDVSTMEQFSLCLRYLKRDAESKYTICEKFLEFVPVTSTTGEALANTIETVLRENNLDIENLRGQGYDGAASMSGSFKGTQARIAAKFPKALYVHCASHSLNLALSNSSGIRQIKNCFGIIEKLAVFFNTPKREAVLKKQINAHAPESTRQKLMKLCVTRWVERHDSVMVTGDLLIPAAAALEEIGEWDDRDSSSQANILLNAIRQPEFLIALSTSEKLLSYTLILSKQLQTIDSDLVSVIDHAENALAQIQSLRQNAEEDFHEIFEAAS---EKAAFLGTEIKIPRRVGKQVHRDNTPAGDVEEYFRRTVFIPFAESLSGSIEQRLMKHQEILKSFVCLLPKYYQQEVAKSKTKREIEKELEIGIKKLATTYESDVGASNIHVLTSELKLWHSSFKGSENLPRTAVDCLNQCKES--VYPNVCTLLKIFATLPVTTCTAERSFSTLRRLNTYLRNTMTEIRLNGLASLNIHRE 784          
BLAST of TTF-type domain-containing protein vs. TrEMBL
Match: A0A1B6JRW0 (TTF-type domain-containing protein OS=Homalodisca liturata OX=320908 GN=g.13176 PE=4 SV=1)

HSP 1 Score: 505.753 bits (1301), Expect = 1.868e-157
Identity = 286/727 (39.34%), Postives = 427/727 (58.73%), Query Frame = 2
Query: 1805 LKDEEKIYYLNNFWKPPPNFCFP----GTKIQNENFKRKFNYSWLLNYPWLVYSKSIDAVYCKYCCFFATNNSADRATQALGQLVKDPFKTWRRATRTFNKHQITNYHKYSVLRADDLQTVVDGKRQSVIDLIDTCRVKHAKKNRLKLTPIIKTLLFLW*K*FSTSGTSRYGHL*YEY**N*QKYNTPX---XXXXXXXXXXXXXXXXXXXXTFRNANYLSWKIQNEMINAGNQIILKRIIERANQSECFSVLADETTDMSTQEQFSICIRFIDKDKKLN----ESFLQFVPVVSTSSKSLANTLVQFLSSIGLNPSYLKGQGYDGAEAMSGRFNGVQAKIMDLYPSALYVHCVSHSLNLALSDVCQIQDIRNCMGVVEKCYSFMNTPKRDAVLQKKI-SDICPDAKRTKLKK*CPTRWVERHDSIMIMVELLNPLILALEEIETWKDKESSSSK---NRAIKSTNIFLSILTVEKIFSYTLPLSKIMQTESLDLVTAIKICEDVVGQFEKFRKSAVTVFNEIYKRAEVLLRKMVDTNYAISIPRINKLQIHRCNISSQSPEEYYRISLFIPFLDATVTQLKERFLKHKAILKAFNILIPSNTNTSHHEYSTNLEI--LLQKYNTDL----NCTINMLIAEYELWQRKFSLNP-IQKNASVLQYLCEYSGEIFPNIFKLLKILATIPVTTSTVERSFSTLKYLKNYLRSTTAEDRLNGLALLYIYIE 3919
            L D EK+  LN+ W P  +F FP    GT+      +RKF +SWL  Y WL YS   D+ YC +C  F+         Q  GQLV++ F  W++A   F KH  + YHK S + A + + V+D + +S+   +D  +   A+ N  ++ PII T++    +  +  G   YG    E+  N +           L +  +      +       +NA Y+SW  QN++I+A NQII ++I  +  +++ FS+LADET+D+ST EQFS+C+R++D D   N    E FL+F+P+ ST+ + LA T+++ L    ++ + L+GQGYDGA AMSG+FNG QA I + +P+A++VHC SHSLNLALS+  ++  IRNC G+VE+ Y+F NTPKR AVLQ+ I S+I  +  R KL + CPTRWV+RHD++ +M ELL P+ +ALEEI+ W D++SSS       +++     +S+L  +K+  YT+ LSK +Q   L+L +AI   E V+   +  R +A   F+ +++ A  +          IS+PR    Q +R N  + +PE YYR S+FIP++++ ++ L+ RF+KHK ILK F  L+P+   +   E ++ L    L   Y  D+        ++L AE+ELW   F  +    +N   L  LC+   ++FPNI  LLKIL TIPVTTST ERSFSTL+ LK YLR+T   +RL+GLA L I+ E
Sbjct:   69 LTDSEKLKVLNDRWVPQSSFNFPYRTYGTQ------QRKFLFSWLNKYTWLSYSGIEDSAYCVHCMLFSKKEVGKSNAQHTGQLVEEGFSNWKKALEKFEKHAASQYHKDSCVSAANFKRVMDSEIKSIDKSLDKGKDLQAQNNVKRILPIIDTIILCGRQNIALRGHRDYG----EFDINRRPAENEGNFRALLRARIEAGDQDLKKHFESCGKNATYISWNFQNQIIDACNQIITEKIATKVKEAKFFSILADETSDVSTIEQFSLCLRYVDSDASNNYQICEQFLKFMPLTSTTGRELAKTVIKGLEDSNIDVNNLRGQGYDGAAAMSGKFNGTQACIQEAHPTAIFVHCASHSLNLALSNASEVAPIRNCFGIVERVYNFFNTPKRQAVLQQCIASEINVETNRKKLLQLCPTRWVQRHDAVFVMKELLQPVEVALEEIKNWSDRDSSSGTLILLSSLRQGEFIISLLASDKLLGYTVNLSKKLQGSDLELSSAITHAETVLESLKSIRTNADEEFHSLFEEATHMANNF---GCKISMPRTVGRQQNRNNTPADTPEVYYRRSIFIPWIESLISSLESRFMKHKDILKGFECLMPTADGSRGKEETSKLNYLQLCCFYKNDIIESGGNNESLLKAEFELWHNSFKTHTNTPRNVIDLLNLCD--KDMFPNIHILLKILCTIPVTTSTAERSFSTLRRLKTYLRNTMGANRLSGLAALNIHRE 780          
BLAST of TTF-type domain-containing protein vs. TrEMBL
Match: J9LUK6 (TTF-type domain-containing protein OS=Acyrthosiphon pisum OX=7029 PE=4 SV=2)

HSP 1 Score: 497.278 bits (1279), Expect = 2.466e-154
Identity = 297/748 (39.71%), Postives = 426/748 (56.95%), Query Frame = 2
Query: 1730 NSQNLENRNDNDVLNVLS-----------RHSNLNILKDEEKIYYLNNFWKPPPNFCFPGTKIQNENFKRKFNYSWLLNYPWLVYSKSIDAVYCKYCCFFATNNSADRATQALGQLVKDPFKTWRRATRTFNKHQITNYHKYSVLRADDLQTVVDGKRQSVIDLIDTCRVKHAKKNRLKLTPIIKTLLFLW*K*-FSTSGTSRYGHL*YEY**N*QKYNTPXXXXXXXXXXXXXXXXXXXXXTFRNANYLSWKIQNEMINAGNQIILKRIIERANQSECFSVLADETTDMSTQEQFSICIRFIDKD---KKLNESFLQFVPVVSTSSKSLANTLVQFLSSIGLNPSYLKGQGYDGAEAMSGRFNGVQAKIMDLYPSALYVHCVSHSLNLALSDVCQIQDIRNCMGVVEKCYSFMNTPKRDAVLQKKISDICPDAKRTKLKK*CPTRWVERHDSIMIMVELLNPLILALEEIETWKDKESSSSKNR---AIKSTNIFLSILTVEKIFSYTLPLSKIMQTESLDLVTAIKICEDVVGQFEKFRKSAVTVFNEIYKRAEVLLRKMVDTNYAISIPRINKLQIHRCNISSQSPEEYYRISLFIPFLDATVTQLKERFLKHKAILKAFNILIPSNTNTSHHEYSTNLEILLQKYNTDLNCTINMLIAEYELWQRKFSLNPIQKNA--SVLQYLCEYSGEIFPNIFKLLKILATIPVTTSTVERSFSTLKYLKNYLRSTTAEDRLNGLALLYIY 3913
            N+ N+ + ++ DVL  ++           RH     + D EK  +L N  +P P++ +P +  +N  F+ K    W  N+ WL YSKS+D  +C YC  F T+   +   Q LG+LV + + +W  A   FNKHQ                        SV   +DT      ++NRL + PII+T+L    +   +  G   YG + +E     +     +  L         I R       RNA Y S  IQN++I+    II+K+++ + NQ++CF+VLADET D+S  EQFS+C+R+ + D    K+ E FL+FVPV+  +   LA  L+  L +IGL+ ++L+GQGYDGA AM G FNGVQA +   YP ALY HC SHSLNLA+SD C I+ IRN  G ++  Y F  TPKR  VL+K I +I P+ K+ KLK  CPTRWVERH+S+M+ +EL + ++ ALEEI  W D+E+SS  N    +IK+    L++  + K  S +LPLS+ +QTE+LDLV A+ + EDV     + RK A   F EIY       RK      AI+IPR+ K Q H+ N ++ S EEY+R+S++IPFLD+   QL+ERFL HK+++K F+ L+     +   +   N   L++ Y  D+         E+ +W+++     I+K+    V+  L  Y+  IFP I +LL ILAT PVTTST ERSFSTL+ LK YLR+T  E+RLNGLAL+ I+
Sbjct:   78 NTSNITSTSEGDVLVTMTGSDIGLIIGRPRHQ----INDTEKFEFLCNLSRPSPDYKYPASGSRNLKFQNK----WFYNWKWLSYSKSLDGAFCVYCVLFGTD---EVKYQKLGKLVCEKYNSWNCAVEKFNKHQ-----------------------NSVAVQLDTKFKLEIEENRLFIQPIIETILVCGRQQGLALRGHKDYGPIQFETPFPTENDGNFRALLRYRVNGGDQIFRQRLQNCPRNATYTSSGIQNQIIDIIGSIIIKKLVNKINQAKCFTVLADETCDISGIEQFSLCVRYYESDTGTNKMREDFLKFVPVIDVTGNGLAEVLIDSLKNIGLDLNFLRGQGYDGASAMRGHFNGVQAVVRRSYPLALYSHCSSHSLNLAISDACNIKSIRNATGTLQAIYVFFKTPKRQNVLRKIIDEIAPENKKKKLKDLCPTRWVERHESVMVFLELFDSVVEALEEISNWVDRETSSKSNNLLCSIKNGEFLLTVHILAKALSISLPLSRQLQTENLDLVKAMDLAEDVSQAVMELRKKAEAEFKEIYTEVN---RKCETLGVAITIPRLTKNQKHKSNFTTNSSEEYFRLSIYIPFLDSFSNQLRERFLAHKSLVKNFSCLL-----SVQDDDEENFVELIKIYAEDIVVDEKSAKGEFLVWKQQ-----IKKSTPKHVIDALHNYNSIIFPTIHRLLVILATFPVTTSTSERSFSTLRRLKTYLRNTVGENRLNGLALMNIH 778          
BLAST of TTF-type domain-containing protein vs. TrEMBL
Match: J9M5M7 (Uncharacterized protein OS=Acyrthosiphon pisum OX=7029 PE=4 SV=2)

HSP 1 Score: 484.182 bits (1245), Expect = 2.230e-150
Identity = 271/714 (37.96%), Postives = 402/714 (56.30%), Query Frame = 2
Query: 1817 EKIYYLNNFWKPPPNFCFPGTKIQNENFKRKFNYSWLLNYPWLVYSKSIDAVYCKYCCFFATNNSADRATQALGQLVKDPFKTWRRATRTFNKHQITNYHKYSVLRADDLQTVVDGKRQSVIDLIDTCRVKHAKKNRLKLTPIIKTLLFLW*K*FSTSGTSRYGHL*YEY**N*QKYNTPXXXXXX-------XXXXXXXXXXXXXXXTFRNANYLSWKIQNEMINAGNQIILKRIIERANQSECFSVLADETTDMSTQEQFSICIRFIDKDKKLNESFLQFVPVVSTSSKSLANTLVQFLSSIGLNPSYLKGQGYDGAEAMSGRFNGVQAKIMDLYPSALYVHCVSHSLNLALSDVCQIQDIRNCMGVVEKCYSFMNTPKRDAVLQKKISDICPDAKRTKLKK*CPTRWVERHDSIMIMVELLNPLILALEEIETWKDKESSSSKNR---AIKSTNIFLSILTVEKIFSYTLPLSKIMQTESLDLVTAIKICEDVVGQFEKFRKSAVTVFNEIYKRAEVLLRKMVDTNYAISIPRINKLQIHRCNISSQSPEEYYRISLFIPFLDATVTQLKERFLKHKAILKAFNILIPSNTNTSHHEYSTNLEILLQKYNTDLNCTINMLIAEYELWQRKFSLNPIQKNASVLQYLCEYSGEIFPNIFKLLKILATIPVTTSTVERSFSTLKYLKNYLRSTTAEDRLNGLALLYIYIETCL 3928
            ++I  L + W P  N+ +P    +N     KF + WL  + W+ YSK  D   CKYC  F   +     +Q LG+ V   F  W+ A   FNKH    YHK ++L+ D L +V +    S++  +D       ++NR KL PII+T++F         G    G +  +        N P     +                         NA+Y+S  IQN+++ + + + LK+II + N ++CF+VLADET D+S  EQFS+C+ F           L FVPV   +   LANTL+  L  +G++  YL+G+G+DGA  MSG FNGVQ+ +   Y  A Y+HC SH LNLA+SD C IQ IRNC G ++K   F   PKR  V+   I  +CP+++ TKLK  CPTRWV+RHDSI+  +EL + +I  L  I TW D+ESSS   +   AIK     L+   + K+FS +LPLSK++Q +++DL+ A+ + ++V    +  R +A   F +++ + +    K +  +  I++PR+  +Q +R N+ +  P EYY+ISLFIPFLD  ++QL +RF+ HK+++  F  L+P+N   +  E   N++ L +KY+ DL C+ + +I E   W +KF      KNA  L+ L   +  IFP+ +KLL+I+AT+ VTT+  ERSFSTLK LK YLR+T  E+RLN LALL I+ E  L
Sbjct:   27 KRIEILQSLWIPEQNYKYPTNNKRN----LKFQHHWLYKWTWIAYSKMFDGALCKYCVIF-NEHEGGSGSQKLGKFVLTTFSNWKNAIEEFNKHDNNKYHKMTLLKFDCLMSVPNKTTDSILIQLDKKFKSEIEQNRAKLKPIIETVMFCGRLGLPLRGHRDSGPIDCD--------NPPVENDGNFRSLLRFKVMSGDINLAEHLKTAQGNASYISADIQNQILTSCSNLKLKQIISKVNAAKCFTVLADETADISGIEQFSLCVHF-----------LTFVPVTDVTGMGLANTLLNTLDKLGIDLKYLRGKGFDGAATMSGCFNGVQSHVTKKYSLAHYIHCTSHCLNLAISDTCNIQSIRNCTGAIQKVCVFFKYPKRQNVMLDSIKRVCPESQITKLKLLCPTRWVDRHDSIITFMELFDAVIDGLSIISTWPDRESSSGSYQLLCAIKQPEFILATHLLAKVFSISLPLSKLLQMQNIDLIEAMSLADNVSDVLKNIRNNADEDFKKLFLKVK---EKCMSLDIEITLPRLTNIQKNRFNVKTTCPNEYYKISLFIPFLDNFISQLHDRFIAHKSLITNFCCLLPNNNLPNREE---NIKSLAEKYSEDLQCSSDSVIGEVLTWTQKFVGTEKPKNA--LEALIACNPLIFPSTYKLLQIIATLSVTTANSERSFSTLKRLKTYLRNTIGENRLNSLALLNIHREIIL 708          
BLAST of TTF-type domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000035789.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000101.1:2843018:2852765:1 gene:ENSAMXG00000037827.1 transcript:ENSAMXT00000035789.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 213.001 bits (541), Expect = 1.201e-57
Identity = 154/526 (29.28%), Postives = 268/526 (50.95%), Query Frame = 2
Query: 2429 NANYLSWKIQNEMINAGNQIILKRIIERANQSECFSVLADETTDMSTQEQFSICIRFID--KDK-------KLNESFLQFVPVVSTSSKSLANTLVQFLSSIGLNPSYLKGQGYDGAEAMSGRFNGVQAKIMDLYPSALYVHCVSHSLNLALSDVCQ-IQDIRNCMGVVEKCYSFMNTP-KRDAVLQKKISDICPDAKRTKLKK*CPTRWVERHDSIMIMVELLNPLILALEEIETWKDKESSSSKN-----RAIKSTNIFLSILTVEKIFSYTLPLSKIMQTESLDLVTAIKICEDVVGQFEKFRKSAVTVFNEIYKRAEVLLRKMVDTNYAISI----PRINKLQIHRCNISSQ----SPEEYYRISLFIPFLDATVTQLKERFLKHKAILKAFNILIPSN-TNTSHHEYSTNLEILLQKYNTDLNCTINMLIAEYELWQRKFSLNPIQKNASVLQYLCEY----SGEIFPNIFKL---LKILATIPVTTSTVERSFSTLKYLKNYLRSTTAEDRLNGLALLYI 3910
            N NYLS  IQNE+I   +Q +   I+    ++E +SV+ D T D+S  +Q S   R++   KD+        +NESFL F  +   +++ L   + + + S GL     +GQGYDGA  MSG ++GVQ +I+D  P+A+YVHC +H+LNL L+D CQ I +I+    ++++ Y F +   KR  +L+  +        +  LK+ CPTRW  R D++  +      ++ AL +I T + K+S          +A+++    +  +  EKI      +S+++Q + +DL+ A  +  +      + R      F+ +   A+ L      +++ I       R  +++ H   ++      +PEE +++++F   +D  V+Q++ RF    ++ + F  L P+     S    + + + L   YN DL+   +  +  +     + +L    K  S ++ L E        I  ++  +   LK+  TIPVT ++ ERSFS LK +KNYLRST ++DRL+GLA+L I
Sbjct:   89 NVNYLSPSIQNELIALLSQRVHDEIVSEIKEAEFYSVIMDTTQDLSKVDQLSQVFRYVTVRKDEADNAIAVDINESFLGFQNISDQTAQGLETKITELIQSKGLPLHKCRGQGYDGASTMSGIYSGVQKRILDKEPNAVYVHCAAHNLNLVLNDACQHITEIKEYYDILQRLYVFFSQSIKRWELLENHLK------SKPTLKRLCPTRWASRRDALYALRFRYADILQALTKI-TLRSKKSDERTEAMGLLKAMEAFEFVMMTVIQEKILETINIVSQVLQKKDVDLLQAASLLGNATCTLAQLRDQ----FDNLKCTAQGLA-----SSWGIRCNFRHKRTRRIKRHFDELTEDQRLTNPEEIFKVNVFYMCIDTVVSQVRTRFHGMDSVTRKFQFLCPTELLRASDEALNESAQTLAAIYNEDLSSEFSSQLLSF-----RNALGSEIKTVSTVKGLFELLLLRHSSILSSVTDVATALKLFLTIPVTVASAERSFSKLKMIKNYLRSTMSQDRLSGLAMLSI 593          
BLAST of TTF-type domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000042930.1 (pep primary_assembly:Astyanax_mexicanus-2.0:12:25471427:25473738:-1 gene:ENSAMXG00000037442.1 transcript:ENSAMXT00000042930.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 209.149 bits (531), Expect = 2.177e-56
Identity = 150/519 (28.90%), Postives = 261/519 (50.29%), Query Frame = 2
Query: 2429 NANYLSWKIQNEMINAGNQIILKRIIERANQSECFSVLADETTDMSTQEQFSICIRFID--KDK-------KLNESFLQFVPVVSTSSKSLANTLVQFLSSIGLNPSYLKGQGYDGAEAMSGRFNGVQAKIMDLYPSALYVHCVSHSLNLALSDVCQ-IQDIRNCMGVVEKCYSFMNTP-KRDAVLQKKISDICPDAKRTKLKK*CPTRWVERHDSIMIMVELLNPLILALEEIETWKDKESSSSKN-----RAIKSTNIFLSILTVEKIFSYTLPLSKIMQTESLDLVTAIKICEDVVGQFEKFRKSAVTVFNEIYKRAEVLLRKMVDTNYAISI----PRINKLQIHRCNISSQ----SPEEYYRISLFIPFLDATVTQLKERFLKHKAILKAFNILIPSNT-NTSHHEYSTNLEILLQKYNTDLNCTINMLIAEYELWQRKFSLNPIQKNASVLQYLCEYSGEIFPNIFKLLKILATIPVTTSTVERSFSTLKYLKNYLRSTTAEDRLNGLALLYI 3910
            N NYLS  IQNE+I   +Q +   I+    ++E +SV+ D T D+S  +Q S   R++   KD+        +NESFL F  +   +++ L   + + + S GL     +GQGYDGA  MSG ++GVQ +I+D  P+A+YVHC +H+LNL L+D CQ I +I+    ++++ Y F +   KR  +L+  +        +  LK+ CPTRW  R D++  +      ++ AL +I T + K+S          +A+++    +  +  EKI      +S+++Q + +DL+ A  +  +      + R      F+ +   A+ L      +++ I       R  +++ H   ++      +PEE +++++F   +D  V+Q++ RF    ++ + F  L P+     S    + + + L   YN DL+   +  +  +             +NA  +            ++   LK+  TIPVT ++ ERSFS LK +KNYLRST ++DRL+GLA+L I
Sbjct:  131 NVNYLSPSIQNELIALLSQRVHDEIVSEIKEAEFYSVIMDTTQDLSKVDQLSQVFRYVTVRKDEADNAIAVDINESFLGFQNISDQTAQGLETKITELIQSNGLLLHKCRGQGYDGASTMSGIYSGVQKRILDKEPNAVYVHCAAHNLNLVLNDACQHITEIKEYYDILQRLYVFFSQSIKRWELLENHLK------SKPTLKRLCPTRWASRRDALYALRFRYADILQALTKI-TLRSKKSDERTEAMGLLKAMEAFEFVMMTVIQEKILETINIVSQVLQKKDVDLLQAASLLGNATCTLAQLRDQ----FDNLKCTAQGLA-----SSWGIRCNFRHKRTRRIKRHFDELTEDQCLTNPEEIFKVNVFYMCIDTVVSQVRTRFHGMDSVTRKFQFLCPTELLRASDEALNESAQTLAAIYNEDLSSEFSSQLLSF-------------RNALGV-----------TDVATALKLFLTIPVTVASAERSFSKLKMIKNYLRSTMSQDRLSGLAMLSI 609          
BLAST of TTF-type domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000032220.1 (pep primary_assembly:Astyanax_mexicanus-2.0:24:13450075:13452201:1 gene:ENSAMXG00000029800.1 transcript:ENSAMXT00000032220.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 195.282 bits (495), Expect = 9.041e-52
Identity = 154/518 (29.73%), Postives = 250/518 (48.26%), Query Frame = 2
Query: 2420 TFRNANYLSWKIQNEMINAGNQIILKRIIERANQSECFSVLADETTDMSTQEQFSICIRFIDKDKKLNESFLQFVPVVSTSSKSLANTLVQFLSSIGLN-PSYLKGQGYDGAEAMSGRFNGVQAKIMDLYPSALYVHCVSHSLNLALSDVCQ-IQDIRNCMGVVEKCYSFMNTP---KRDAVLQKKISDICPDAKRTKLKK*CPTRWVERHDSIMIMVELLNPLILALEEI--ETWKDKESSSSKNRAIKSTNIFLSILTVEKIFSYTLPLSKIMQTESLDLVTAIKICEDVVGQFEKFRKSAV--TVFNEIYKRAEVLLRKMVDTNYAISIPRINKLQIH---RCNIS--------SQSPEEYYRISLFIPFLDATVTQLKERFLKHKAILKAFNILIPSNTNTSHHEYSTNLEILLQKYNTDLNCTINMLIAEYELWQRKFSLN-PIQKNASVLQYLCEYSGEIFPNIFKLLKILATIPVTTSTVERSFSTLKYLKNYLRSTTAEDRLNGLALLYI 3910
            +  NA Y S  IQNE+++    ++  +IIE    SE FS++ DET D+  +EQ S+ +R+      ++ESFL F       +  L + ++  L S GL     L GQ YDGA  MSG++ GVQA+I +    A YVHC +H LNL L D  + + +      ++E+ Y F +     ++   +QK++ +  P     +L++   TRW  R+ S+  +++ L  +   L+EI  E   D+   +    A       + ++T  K+F  T  LS ++Q+ SLDL  A+ + E ++     +R  +   +++NE+   AE       DT    +  R  KL       C +S        S+  +E +R   F P LD  +T+L  RF      L   N +   N  +        L    + Y +++    + L     + +RK     P   +   L    E   E+F  ++KL K+  +IPVTT++ ERSFSTLK +K YLRST  ++RL+ L +L I
Sbjct:  119 SIHNAKYTSKVIQNEVLSCLADMVRTKIIEEVKDSEVFSIMVDETKDVKKKEQISLVVRYY-FSGAVHESFLHFESADRLDAAGLTDKIIHILQSHGLEYRDNLVGQAYDGASVMSGKYTGVQARIKEQAKHAFYVHCSAHCLNLVLVDTVKTVPEADQFFSLLERLYVFTSGSYVHQKWLSVQKEMYEGAP----RELQRLSDTRWACRYMSLRNIIDRLPAIKRVLQEIAHEHHGDRSVEARGLLAQIDLQFIVYLVTFCKVFGETKLLSDMLQSPSLDLSKAVDLVEALIQTLNDYRNESFFDSLWNEVLTTAE-----QCDTAVQPTAKRQKKLSSKLGGHCVLSTVGQKRSDSELEKESFRTGFFYPVLDHILTELNRRFSSRNCDL--MNGIQALNPKSDGFLKEDTLFSFAKMYESNIEDLGHELHQFRRILERKIQTGTPRPFSVVELASFMEPYKEVFFELYKLCKVAVSIPVTTASCERSFSTLKLVKTYLRSTMTDERLSNLGVLSI 624          
BLAST of TTF-type domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000057644.1 (pep primary_assembly:Astyanax_mexicanus-2.0:10:17620682:17622807:-1 gene:ENSAMXG00000043641.1 transcript:ENSAMXT00000057644.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 183.726 bits (465), Expect = 5.559e-48
Identity = 146/496 (29.44%), Postives = 238/496 (47.98%), Query Frame = 2
Query: 2486 IILKRIIERANQSECFSVLADETTDMSTQEQFSICIRFIDKDKKLNESFLQFVPVVSTSSKSLANTLVQFLSSIGLN-PSYLKGQGYDGAEAMSGRFNGVQAKIMDLYPSALYVHCVSHSLNLALSDVCQ-IQDIRNCMGVVEKCYSFMNTP---KRDAVLQKKISDICPDAKRTKLKK*CPTRWVERHDSIMIMVELLNPLILALEEI--ETWKDKESSSSKNRAIKSTNIFLSILTVEKIFSYTLPLSKIMQTESLDLVTAIKICEDVVGQFEKFRKSAV--TVFNEIYKRAEVLLRKMVDTNYAISIPRINKLQIH---RCNIS--------SQSPEEYYRISLFIPFLDATVTQLKERFLKHKAILKAFNILIPSNTNTSHHEYSTNLEILLQKYNTDLNCTINMLIAEYELWQRKFSLN-PIQKNASVLQYLCEYSGEIFPNIFKLLKILATIPVTTSTVERSFSTLKYLKNYLRSTTAEDRLNGLALLYI 3910
            ++  +IIE    SE FS++ DET D+  +EQ S+ +R+      ++ESFL F       +  L + ++  L S GL     L GQ YDGA  MSG++ GVQA+I +    A YVHC +H LNL L D  + + +      ++E+ Y F +     ++   +QK++ +  P     +L++   TRW  R+ S+  +++ L  +   L+EI  E   D+   +    A       + ++T  K+F  T  LS ++Q+ SLDL  A+ + E ++     +R  +   +++NE+   AE       DT    +  R  KL       C +S        S+  +E +R   F P LD  +T+L  RF      L   N +   N  +        L    + Y +++    + L     + +RK     P   +   L    E   E+F  ++KL K+  +IPVTT++ ERSFSTLK +K YLRST  ++RL+ L +L I
Sbjct:  120 MVRTKIIEEVKDSEVFSIMVDETKDVKKKEQISLVVRYY-FSGAVHESFLHFESADRLDAAGLTDKIIHILQSHGLEYRDNLVGQAYDGASVMSGKYTGVQARIKEQAKHAFYVHCSAHCLNLVLVDTVKTVPEADQFFSLLERLYVFTSGSYVHQKWLSVQKEMYEGAP----RELQRLSDTRWACRYMSLRNIIDRLPAIKRVLQEIAHEHHGDRSVEARGLLAQIDLQFIVYLVTFCKVFGETKLLSDMLQSPSLDLSKAVDLVEALIQTLNDYRNESFFDSLWNEVLTTAE-----QCDTAVQPTAKRQKKLSSKLGGHCVLSTVGQKRSDSELEKESFRTGFFYPVLDHILTELNRRFSSRNCDL--MNGIQALNPKSDGFLKEDTLFSFAKMYESNIEDLGHELHQFRRILERKIQTGTPRPFSVVELASFMEPYKEVFFELYKLCKVAVSIPVTTASCERSFSTLKLVKTYLRSTMTDERLSNLGVLSI 603          
BLAST of TTF-type domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000046011.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000097.1:188623:193799:-1 gene:ENSAMXG00000043114.1 transcript:ENSAMXT00000046011.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 176.407 bits (446), Expect = 1.148e-45
Identity = 165/641 (25.74%), Postives = 276/641 (43.06%), Query Frame = 2
Query: 1961 IDAVYCKYCCFFATNNSADRATQALGQLVKDPFKTWRRATRTFNKHQITNYHKYSVLRADDLQTVVDGKRQSVIDLIDTCRVKHAKKNRLK--LTPIIKTLLFLW*K*FSTSGTSRYGHL*YEY**N*QKYNTPX---XXXXXXXXXXXXXXXXXXXXTFRNANYLSWKIQNEMINA-GNQIILKRIIERANQSECFSVLADETTDMSTQEQFSICIRFIDKDKKLNESFLQFVPVVSTSSKSLANTLVQFLSSIGLNPSYLKGQGYDGAEAMSGRFNGVQAKIMDLYPSALYVHCVSHSLNLALSDVCQIQDIRNCMGVVEKCYS---FMNTPKRDAVLQKKIS-DICPDAKRTKLKK*CPTRWVERHDSIMIMVELLNPLILALEEIETWKDKESSSSKNRAIKSTNIFLSILTVEKIFSYTLPLSKIMQTESLDLVTAIKICEDVVGQFEKFRKSAVTVFNEIYKRAEVLLRKMVDTNYAISIPRINKLQIHRCNISSQSPEEYYRISLFIPFLDATVTQLKERFLKHKAILKAFNILIPSNTNTSHHEYSTNLEILLQKYNTDLNC--TINMLIAEYEL-WQRKFSLNPIQKNASVLQYLCEYSGEIFPNIFKLLKILATIPVTTSTVERSFSTLKY 3844
            +D  +C  C  F       ++T     ++  PF  W + T+    HQ    H  +  RA       +     +   +D+ +  + +K R +  L  + + +L+   +  +  G++   H              P      L  ++  +  +++       +NA YLS + QNEMI+  G  +I  +I+E    ++ ++VLADE T  +  E   +C+RF+DKD  + E  L+      + SK +       LS + +  +  +GQGYDGA  MS    GVQA I    P ALY+HC  H LNL ++  C +  +RN +  ++  YS   F ++PKR+ +L++ +  +     KR  L     TRW  RHD+          +I ALE                           + V+ ++                     ++CE ++             FN+IY++A   +R     N   + PR    Q HR N+ ++  +EYY  ++ IPFLD  +++ + RF            LIPS    S  + + ++   +  Y  DL     I+  +  ++L WQ K S    Q+ +S    + E    ++PNIFKLLKI  T+PVT+   ERS STL +
Sbjct:   42 LDGAFCICCALFLNATERKQSTS----MINAPFSKWHKKTKIIGSHQSKANHLVAFERAKLFLQSHENPNTRISVRMDSAKEANIEKVRHRHILKCVAEAVLYCGRQCIALRGSAEQQHC----------SGNPGNFLALLKLLSNHNEKLKQHLEKPKLKNATYLSPQTQNEMIDVLGKHMIQAKIVEEVRHAQMYTVLADEVTSHNV-ELMPMCVRFVDKDLNIREELLEI-----SRSKDV-------LSHLSIEIADCRGQGYDGASNMSSENVGVQALIKKDAPKALYMHCNGHCLNLVIARSCALPVVRNMIDKMK--YSVMFFTSSPKRELLLKEVVDKEAYSTEKRKPLIDLSRTRWAARHDAYSHFYSAFVCIIKALE---------------------------VMVKSVYK--------------------ELCETIIDD-----------FNQIYEQA---VRMAAQVNVEPTQPRAAGRQKHRENVPAEGVKEYYLRNMAIPFLDHVISEFESRFSPLSVSASRLMGLIPSVQCNS--DVTVDISEAVALYQDDLPSPEVIHQELKRWKLKWQAKSSH---QRPSSCASAIKECDEMMYPNIFKLLKIACTLPVTSCECERSASTLTH 587          
BLAST of TTF-type domain-containing protein vs. Ensembl Nematostella
Match: EDO40662 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6J7])

HSP 1 Score: 107.071 bits (266), Expect = 1.835e-23
Identity = 89/286 (31.12%), Postives = 147/286 (51.40%), Query Frame = 2
Query: 3086 LEEIETWK-DKESSSSKNRAIKSTNIF---LSILTVEKIFSYTLPLSKIMQTESLDLVTAIKICEDVVGQFEKFRKSAVTVFNEIYKRAEVLLRKMVDTNYAISIPRINKLQIHRCNISSQSPEEYYRISLFIPFLDATVTQLKERFLKHKAILKAFNILIPS---NTNTSHHEYSTNLEILLQKYNTDLNCTINMLIAEYELWQRKFSL---NPIQKNASVLQYLCEYSGEIFPNIFKLLKILATIPVTTSTVERSFSTLKYLKNYLRSTTAEDRLNGLALLYIY 3913
            L++  +W  D+ES +  N  + + + F   ++++TV K  S   PLS  +Q  + D+  A      V    +  R+    +F + Y+ + V L K  D +   S+PRI ++Q HR N  S SP EYY+ S  IP +D   T++ + F   +  +     L+P     TN        +LE  ++ Y  DL  + ++L  E   W+ K++      I ++A      C+   E +PN+  LL+IL T+PVT++  ERSFST+K LK YLR+T + +R   LAL+ ++
Sbjct:    8 LDKYGSWSWDQESRTRANGLLSTMSKFEFTITMITVMKCLSVVKPLSIQLQKRASDIYRAYSQVSSVKKDLQAPRRDIDVLFVKWYE-SSVDLGK--DFDIVPSMPRIARIQQHRQNTPSSSPCEYYKRSQGIPLVDHLSTEMDKFFSADQMNVSKLISLVPEVLVATN------GCDLEEAVKFYTDDLE-SPDVLDVELVRWRSKWTRVEEESIPRSAVDALKNCD--AEFYPNVHVLLRILCTLPVTSAESERSFSTMKRLKTYLRNTMSTEREPSLALISVH 281          
BLAST of TTF-type domain-containing protein vs. Ensembl Nematostella
Match: EDO42389 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1N0])

HSP 1 Score: 97.4413 bits (241), Expect = 1.736e-20
Identity = 66/227 (29.07%), Postives = 120/227 (52.86%), Query Frame = 2
Query: 2867 CQIQDIRNCMGVVEKCYS-FMNTPKRDAVLQKKISDICPDAKRTKLKK*CPTRWVERHDSIMIMVELLNPLI-----LALEEIETWKDKESSSSKNRA-IKSTNIFLSILTVEKIFSYTLPLSKIMQTESLDLVTAIKICEDVVGQFEKFRKSAVTVFNEIYKRAEVLLRKMVDTNYAI----SIPRINKLQIHRCNISSQSPEEYYRISLFIPFLDATVTQLKERF 3514
            C +  +RN + VV K ++ F N+PKR    ++K++++  +A + KL   C TRW++R + +  ++ELL P+      +AL + + W       ++      S +  ++++ V  I   T P++  +Q + +DL+ A         +    + S   + N I +R  V+ R+ V+    I    S+PRI + Q+HR N  +Q+PE+YY+I+L   FLD  + QL +RF
Sbjct:  423 CFMPLVRNAIEVVGKLHAVFDNSPKRFQYFKEKVNELEKEATKVKLINVCRTRWIDRIEGMHRVIELLQPVAETFKDIALNQGKDWNPNSRIDAQALVNALSFSFIITVVVVSYILDLTKPITVKLQAKEIDLLKA-------KDELRILKSSLRDMQNNIDERYNVVHRQAVEPGRKIGVEPSMPRIVQRQVHRDNSPAQNPEQYYKINLTTKFLDHALQQLDKRF 642          
BLAST of TTF-type domain-containing protein vs. Ensembl Nematostella
Match: EDO36427 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIQ1])

HSP 1 Score: 80.4925 bits (197), Expect = 3.177e-16
Identity = 56/226 (24.78%), Postives = 106/226 (46.90%), Query Frame = 2
Query: 2645 PVVSTSSKSLANTLVQFLSSIGLNPSYLKGQGYDGAEAMSGRFNGVQAKIMDLYPSALYVHCVSHSLNLALSDVCQIQDIRNCMGVVEKCYSFMNTPKRDAV---LQKKISDICPDAKRTKLKK*CPTRWVERHDSIMIMVELLNPLILALEEI---------------ETW--KDKESSSSKNRAIKSTNIFLSILTVEKIFSYTLPLSKIMQTESLDLVTAIKI 3262
            P    + + +AN +++ L S+GL+P  ++GQGYD A  MS    G  A+  +  P A+YVH   H LNL ++  C  Q I + +  +++C  F    + + V    +K + D     +R  L   C TRW  RH++     +    +I +LE I                +W  + K++++S   ++ S    +S L + +  S+   ++  +Q  ++D+   + +
Sbjct:   19 PTEKKTGQEIANVILEKLQSLGLDPKNIRGQGYDEAANMSSDNVGSPAQNQEA-PKAVYVHYSGHCLNLFIAHSCHQQSITSAIDKLKQCSLFFLEVQNEKVFLTFEKAVDDA---DRRKALVYMCRTRWAARHNAYTHFYQSFTFIITSLENIIYGANSELMGGEHQDASWDRRSKDNAASLLASLTSFYFIVSFLVLYEFLSHLAGITVKLQGRAVDIFKGLSV 240          
BLAST of TTF-type domain-containing protein vs. Ensembl Nematostella
Match: EDO26151 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TCR4])

HSP 1 Score: 72.4034 bits (176), Expect = 2.317e-14
Identity = 46/153 (30.07%), Postives = 73/153 (47.71%), Query Frame = 2
Query: 1814 EEKIYYLNNFWKPPPNFCFPGTKIQNENFK-RKFNYSWLLNYPWLVYSKSIDAVYCKYCCFFATNNSADRATQALGQLVKDPFKTWRRATRTFNKHQITN--YHKYSVLRADDLQTVVDGKRQSVIDLIDTCRVKHAKKNRLKLTPIIKTLLF 2263
            ++K+ ++ N WKP   F FP   +  EN K RKF  +WL  YPWL YSK  + V+C  C  F       R    L +L+K P   W  A   F KH   N   HK+S++  ++ + ++  +   +   +     +   +NR  L  + K ++F
Sbjct:   30 QDKLKFIENVWKPGELFDFP---VSIENGKSRKFVLNWLKKYPWLAYSKYYNGVFCLACVCFGVQ--CGRNANKLDKLLKSPLTNWTSAASRFTKHAQGNCEIHKFSMIAIEEFKKMMRTEAVPINLQLHNIVQQQIARNREILRFLFKRIIF 177          
BLAST of TTF-type domain-containing protein vs. Ensembl Nematostella
Match: EDO32247 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SVL6])

HSP 1 Score: 69.3218 bits (168), Expect = 6.748e-14
Identity = 39/95 (41.05%), Postives = 59/95 (62.11%), Query Frame = 2
Query: 3653 LIAEYELWQRKFSLNPIQKNA---SVLQYLCEYSGEIFPNIFKLLKILATIPVTTSTVERSFSTLKYLKNYLRSTTAEDRLNGLALLYIYIETCL 3928
            L AE  LW+R +     +      ++   L +   + F NI+ +LKIL T+P+++++ ERS S+L+ LK YLRST  EDRLNGLAL+Y + +  L
Sbjct:   11 LQAELLLWERLWKGRDNRGEVIPDTLKATLEDIDKDAFVNIYFMLKILITLPISSASCERSISSLRNLKTYLRSTMTEDRLNGLALMYTHKDMDL 105          
BLAST of TTF-type domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000028133.1 (zinc finger MYM-type protein 1-like [Source:NCBI gene;Acc:111948955])

HSP 1 Score: 159.073 bits (401), Expect = 3.570e-39
Identity = 137/519 (26.40%), Postives = 254/519 (48.94%), Query Frame = 2
Query: 2420 TFRNANYLSWKIQNEMINAGNQIILKRIIERANQSECFSVLADETTDMSTQEQFSICIRFID--KDKKLNESFLQFVPVVSTSSKSLANTLVQFLSSIGLNPSYLKGQGYDGAEAMSGRFNGVQAKIMDLYPSALYVHCVSHSLNLALSDVCQIQ-DIRNCMGVVEKCYS-FMNTPKRDAVLQKKISDICPDAKRTKLKK*CPTRWVERHDSIMIMVELLNPLILALEEI-ETWKD---KESSSSKNRAIKSTNIFLSILTVEKIFSYTLPLSKIMQTESLDLVTAIKICEDVVGQFEKFRKSAVTVFNEIYKRAEVLLRKMVDTNYAISIPRINKLQIHRCNISSQSPEEYY-------RISLFIPFLDATVTQLKERFLKHKAILKAFNIL--IPSNTNTSHHEYSTNLEILLQ-KYNTDLNCTINMLIAEYELWQRKFSLNPIQKNASVLQYLCEYS----GEIFPNIFKLLKILATIPVTTSTVERSFSTLKYLKNYLRSTTAEDRLNGLALLYI 3910
            T  + +Y+   +QNE+I+  +  IL  I++   +++ FS++ D T D+S  EQ S+ IR +   +  ++ E F+ F+    ++ + LA+ ++  L  +G++    +GQ YD    M G+  GVQA++++  P AL++ C +H+LNL + D  +   D  +  GV++K Y+ F  + +R A+L+ ++S          LK    TRW  +  SI  M      +  AL E+ +  KD   K  + S +  + S    +  +    I S    +SK+MQ+ ++ +  A+ + +      + +R +        +  A++  ++M       +I +  +++  +C  S +S +E +        +  F   +D  ++ + ERF   + +   F +L   PS  +    E    L  +L  + N DL+     L+ E +      S  P     S+L+ +   S     EI+PN +  L+I  T+PVT +  ERSFS LK +K+YLRST +++RL  LA++ I
Sbjct:  328 TASHNSYIGHHVQNELIDLLSSKILSAIVDDIKKAKYFSIILDCTLDISHTEQLSVIIRVVSLMEKPQIREHFMGFLEAEESTGQHLASMILNRLEELGISFEDCRGQSYDNGANMKGKNKGVQARLLEKNPRALFLPCGAHTLNLVVCDAAKRSVDAMSYFGVLQKLYTLFSASAQRWAILKSQVS--------ITLKSWTETRWESKIKSIEPMRYQGAAVREALIEVRDKTKDPVIKAEAQSLSEEVGSYRFNICTVVWHDILSTIKHVSKLMQSPNMHVDLAVSLLKKTEQSLQSYRANG-------FVNAQMAAKEMCKEMNVEAILKQKRIRSTKCQFSYESHDEPFSDALKKLEVEFFNVVVDEALSAIAERFSTLEVVQNRFGVLTNFPSLGDEELTEQCEALGNILHFEKNWDLDS--RELVQEIKNLPNLPSTTP-----SLLELISFMSDKDLSEIYPNFWTALRIALTLPVTVAQAERSFSKLKLIKSYLRSTMSQERLTNLAVVSI 824          
BLAST of TTF-type domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000042294.1 (zinc finger MYM-type protein 1-like [Source:NCBI gene;Acc:110016639])

HSP 1 Score: 159.073 bits (401), Expect = 3.570e-39
Identity = 137/519 (26.40%), Postives = 254/519 (48.94%), Query Frame = 2
Query: 2420 TFRNANYLSWKIQNEMINAGNQIILKRIIERANQSECFSVLADETTDMSTQEQFSICIRFID--KDKKLNESFLQFVPVVSTSSKSLANTLVQFLSSIGLNPSYLKGQGYDGAEAMSGRFNGVQAKIMDLYPSALYVHCVSHSLNLALSDVCQIQ-DIRNCMGVVEKCYS-FMNTPKRDAVLQKKISDICPDAKRTKLKK*CPTRWVERHDSIMIMVELLNPLILALEEI-ETWKD---KESSSSKNRAIKSTNIFLSILTVEKIFSYTLPLSKIMQTESLDLVTAIKICEDVVGQFEKFRKSAVTVFNEIYKRAEVLLRKMVDTNYAISIPRINKLQIHRCNISSQSPEEYY-------RISLFIPFLDATVTQLKERFLKHKAILKAFNIL--IPSNTNTSHHEYSTNLEILLQ-KYNTDLNCTINMLIAEYELWQRKFSLNPIQKNASVLQYLCEYS----GEIFPNIFKLLKILATIPVTTSTVERSFSTLKYLKNYLRSTTAEDRLNGLALLYI 3910
            T  + +Y+   +QNE+I+  +  IL  I++   +++ FS++ D T D+S  EQ S+ IR +   +  ++ E F+ F+    ++ + LA+ ++  L  +G++    +GQ YD    M G+  GVQA++++  P AL++ C +H+LNL + D  +   D  +  GV++K Y+ F  + +R A+L+ ++S          LK    TRW  +  SI  M      +  AL E+ +  KD   K  + S +  + S    +  +    I S    +SK+MQ+ ++ +  A+ + +      + +R +        +  A++  ++M       +I +  +++  +C  S +S +E +        +  F   +D  ++ + ERF   + +   F +L   PS  +    E    L  +L  + N DL+     L+ E +      S  P     S+L+ +   S     EI+PN +  L+I  T+PVT +  ERSFS LK +K+YLRST +++RL  LA++ I
Sbjct:  328 TASHNSYIGHHVQNELIDLLSSKILSAIVDDIKKAKYFSIILDCTLDISHTEQLSVIIRVVSLMEKPQIREHFMGFLEAEESTGQHLASMILNRLEELGISFEDCRGQSYDNGANMKGKNKGVQARLLEKNPRALFLPCGAHTLNLVVCDAAKRSVDAMSYFGVLQKLYTLFSASAQRWAILKSQVS--------ITLKSWTETRWESKIKSIEPMRYQGAAVREALIEVRDKTKDPVIKAEAQSLSEEVGSYRFNICTVVWHDILSTIKHVSKLMQSPNMHVDLAVSLLKKTEQSLQSYRANG-------FVNAQMAAKEMCKEMNVEAILKQKRIRSTKCQFSYESHDEPFSDALKKLEVEFFNVVVDEALSAIAERFSTLEVVQNRFGVLTNFPSLGDEELTEQCEALGNILHFEKNWDLDS--RELVQEIKNLPNLPSTTP-----SLLELISFMSDKDLSEIYPNFWTALRIALTLPVTVAQAERSFSKLKLIKSYLRSTMSQERLTNLAVVSI 824          
BLAST of TTF-type domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000045044.1 (zinc finger MYM-type protein 1-like [Source:NCBI gene;Acc:111948193])

HSP 1 Score: 159.073 bits (401), Expect = 3.570e-39
Identity = 137/519 (26.40%), Postives = 254/519 (48.94%), Query Frame = 2
Query: 2420 TFRNANYLSWKIQNEMINAGNQIILKRIIERANQSECFSVLADETTDMSTQEQFSICIRFID--KDKKLNESFLQFVPVVSTSSKSLANTLVQFLSSIGLNPSYLKGQGYDGAEAMSGRFNGVQAKIMDLYPSALYVHCVSHSLNLALSDVCQIQ-DIRNCMGVVEKCYS-FMNTPKRDAVLQKKISDICPDAKRTKLKK*CPTRWVERHDSIMIMVELLNPLILALEEI-ETWKD---KESSSSKNRAIKSTNIFLSILTVEKIFSYTLPLSKIMQTESLDLVTAIKICEDVVGQFEKFRKSAVTVFNEIYKRAEVLLRKMVDTNYAISIPRINKLQIHRCNISSQSPEEYY-------RISLFIPFLDATVTQLKERFLKHKAILKAFNIL--IPSNTNTSHHEYSTNLEILLQ-KYNTDLNCTINMLIAEYELWQRKFSLNPIQKNASVLQYLCEYS----GEIFPNIFKLLKILATIPVTTSTVERSFSTLKYLKNYLRSTTAEDRLNGLALLYI 3910
            T  + +Y+   +QNE+I+  +  IL  I++   +++ FS++ D T D+S  EQ S+ IR +   +  ++ E F+ F+    ++ + LA+ ++  L  +G++    +GQ YD    M G+  GVQA++++  P AL++ C +H+LNL + D  +   D  +  GV++K Y+ F  + +R A+L+ ++S          LK    TRW  +  SI  M      +  AL E+ +  KD   K  + S +  + S    +  +    I S    +SK+MQ+ ++ +  A+ + +      + +R +        +  A++  ++M       +I +  +++  +C  S +S +E +        +  F   +D  ++ + ERF   + +   F +L   PS  +    E    L  +L  + N DL+     L+ E +      S  P     S+L+ +   S     EI+PN +  L+I  T+PVT +  ERSFS LK +K+YLRST +++RL  LA++ I
Sbjct:  328 TASHNSYIGHHVQNELIDLLSSKILSAIVDDIKKAKYFSIILDCTLDISHTEQLSVIIRVVSLMEKPQIREHFMGFLEAEESTGQHLASMILNRLEELGISFEDCRGQSYDNGANMKGKNKGVQARLLEKNPRALFLPCGAHTLNLVVCDAAKRSVDAMSYFGVLQKLYTLFSASAQRWAILKSQVS--------ITLKSWTETRWESKIKSIEPMRYQGAAVREALIEVRDKTKDPVIKAEAQSLSEEVGSYRFNICTVVWHDILSTIKHVSKLMQSPNMHVDLAVSLLKKTEQSLQSYRANG-------FVNAQMAAKEMCKEMNVEAILKQKRIRSTKCQFSYESHDEPFSDALKKLEVEFFNVVVDEALSAIAERFSTLEVVQNRFGVLTNFPSLGDEELTEQCEALGNILHFEKNWDLDS--RELVQEIKNLPNLPSTTP-----SLLELISFMSDKDLSEIYPNFWTALRIALTLPVTVAQAERSFSKLKLIKSYLRSTMSQERLTNLAVVSI 824          
BLAST of TTF-type domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000027735.1 (pep primary_assembly:ASM223467v1:9:30712608:30715295:1 gene:ENSORLG00000030268.1 transcript:ENSORLT00000027735.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 132.109 bits (331), Expect = 4.999e-31
Identity = 108/366 (29.51%), Postives = 166/366 (45.36%), Query Frame = 2
Query: 1847 KPPPNFCFPGTKIQNENFKRKFNYSWLLNYPWLVYSKSIDAVYCKYCCFFATNNSADRATQALGQLVKDPFKTWRRAT---RTFNKHQITNYHKYSVLRADDLQTVVDGKRQSVIDLIDTCRVKHAKKNRLKLTPIIKTLLFLW*K*FSTSGTSRYGHL*YEY**N*QKYNTPXXXXXXXXXXXXXXXXXXXXXTFRNANYLSWKIQNEMINAGNQIILKRIIERANQSECFSVLADETTDMSTQEQFSICIRFIDKDKKLNESFLQFVPVVSTSSKSLANTLVQFLSSIGLN-PSYLKGQGYDGAEAMSGRFNGVQAKIMDLYPSALYVHCVSHSLNLALSDVCQIQDIRNC-MGVVEKCYSFMN 2929
            K P   CFP T  Q +  +R F+  W   + WL YS+S D+ +C  C  F    S +    +     ++ FK W++AT        H  +  H  ++L   + +    G   S+   +D    K  K+NR  +  + +TLL       +T   ++ GH   E        +             +           RNA  L    QNEMI+   +++   I     +SE FS+L DET DMS +EQ S  IR+   +  + E FL F      ++ +L+  +++ L   GL+  ++L GQ YDGA  MSG+  GVQA+I    P A YVHC +H LNL L D  +     NC   +++K Y F++
Sbjct:  101 KQPHLKCFPRT-YQGDR-RRCFSKDWYNAHKWLEYSQSKDSAFCYACRHFGLPASGESVLTS-----EEGFKNWKKATFKDGGLLGHARSEAHTTAMLAWAEYEKSTSGT-ASLSASLDAEYSKLVKENREYIKVVGETLLLT-----ATQNIAQRGHKESEV------DSKGNFLAIMELLAKNNPIVKRKMAGQRNATCLGHDTQNEMIDCLAEMVRSSITGEVAESEAFSILVDETKDMSKKEQMSFVIRYY-YNGSVCECFLAFEAAQRLNAAALSQKIIEILQKHGLDYKNHLVGQAYDGASVMSGKNTGVQARIKSEAPLAFYVHCNAHCLNLVLVDSVKFIPEANCFFSLLQKLYVFVS 446          

HSP 2 Score: 56.6102 bits (135), Expect = 1.601e-7
Identity = 26/60 (43.33%), Postives = 42/60 (70.00%), Query Frame = 2
Query: 3731 LCEYSGEIFPNIFKLLKILATIPVTTSTVERSFSTLKYLKNYLRSTTAEDRLNGLALLYI 3910
            +C  S ++  + FKL K+   +PV+T++ ERSFSTLK +K  LRST +++RL+ L +L +
Sbjct:  572 VCRGSKKVEKHCFKLCKVALALPVSTASCERSFSTLKLIKTALRSTISDERLSNLGVLSV 631          
BLAST of TTF-type domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000041223.1 (zinc finger MYM-type protein 1 [Source:NCBI gene;Acc:101155882])

HSP 1 Score: 118.627 bits (296), Expect = 1.101e-26
Identity = 162/700 (23.14%), Postives = 289/700 (41.29%), Query Frame = 2
Query: 1895 NFKRKFNYSWLLNYPWLVYSKSIDAVYCKYCCFFATNNSADRATQALGQLVKDPFKTWRRATRTFNKHQITNYHKYSVLRAD-------DLQTVVDGKRQSVIDLIDTCRVKHAKKNRLKLTPIIKTLLFLW*K*FSTSGTSRYGHL*YEY**N*QKYNTPXXXXXXXXXXXXXXXXXXXXXTFRNANYLSWKIQNEMINAGNQIILKRIIERANQSECFSVLADETTDMSTQEQFSICIRFIDKDKKLNESFLQFVPVVSTS-SKSLANTLVQFLSSIGLNPSYLK---GQGYDGAEAMSGRFNGVQAKIMDLYPSALYVHCVSHSLNLALS-DVCQIQDIRNCMGVVEKCYSFMN-TPKRDAVLQKKISDICPDAKRTKLKK*CPTRWVERH---DSIMIMVELLNPLILALEEIETWKDKESSSSKN--RAIKSTNIFLSIL-TVEKIFSYTLPLSKIMQTESLDLVTAIKICEDVVGQFEKFRKSAVTVFNEIYKRAEVLLRKMVDTNYAISIPRINKLQIHRCNISSQSPEEYYRISLFIPFLDATVTQLKERFLKHKAILKAFNILIPSNTNTSHHEYSTNLEILLQKYNTDLNCTINMLIAEYELWQRKFSLNPI--------QKNASVLQYLCEYS-GEIFPNIFKLLKILATIPVTTSTVERSFSTLKYLKNYLRSTTAEDRLNGLALLYI 3910
             F R F  +    YPWL  S+    +YC  C  FA +     +    G L           T+   KHQ T  H  S++ +        +LQ     +R++ +        +  KKNR  L  +I  +LFL  +  S  G    G             N             S         T    +  S KIQ+++I+A +++I   I      +   SV+ +ETTD S   Q ++ +R++ +   + E F++F  V S   +  +A  +++FL    L    L     Q ++GA   S   NGVQAK+ +  P AL++HC +H L+L LS    ++++ +     +    +F + +P R  +L     +IC    + +L    PT W       +++    E L  L   + E  +  D++S    +  +A+     F  +L T   IF Y+  L  I+Q +  D    ++ C D V +F    +   + +  +Y+  E           A   P   K     C+  +  P E+YR  L    LD  + Q + RF  H+ ++    +L P             LE      +  L+       A ++  Q K  L  +        +  + +L ++ + +  E+   +++ + +  TIP + ++V+R+FS L+ ++ + ++TT + RL+ LAL+ I
Sbjct:   49 GFVRHFQVTNYERYPWLTGSEVHCKLYCWECLLFALDRHGVWSHTGFGNLTC--------LTKAAKKHQNTAGHLQSIVLSKTFGESRVELQLNEHARRETEL------HNEKVKKNREILKRLIDCVLFLGKQELSFRGRDESG----------GSSNRGNYCELLSVIAESNTDLHYHLSTNEAFSGTSGKIQDDLISAIDEVIRDEIRREVKNAPFVSVMVEETTDASNAAQLALALRYVTR-SGVKERFVRFEDVTSGKRADDIAGLVIKFL----LENECLDKVVAQCFEGATVTSSGLNGVQAKVKESAPLALFIHCYAHQLSLVLSQGASKLKECKIFFAHLNGLVAFFSRSPWRTQLL----DEIC----QRRLPGVTPTPWQSTSRVVNTVFEKREALKELFGHILENHSEYDEDSVRCADGFKALLDCFEFCFLLHTFNGIFHYSDMLFSILQDKKSD----VQFCLDRVKEFCDTVERERSRYEGVYEATE----------RAAGAPSARK-----CH--AVDPREHYR-QLHGSILDNIICQTQTRFQDHEKMM-FVTLLDPLRF----------LEYRRSFPHAGLSSLARSHGALFDFSQLKTELTVMYTMDDFYGKSPSDILHFIHQNNLSEVMKQLYRFVCLALTIPASPASVKRTFSALERIQTHAKNTTGQTRLSALALMAI 678          
BLAST of TTF-type domain-containing protein vs. Planmine SMEST
Match: SMESG000003943.1 (SMESG000003943.1)

HSP 1 Score: 651.358 bits (1679), Expect = 0.000e+0
Identity = 342/477 (71.70%), Postives = 357/477 (74.84%), Query Frame = 2
Query: 1715 KAQPSNSQNLENRNDNDVLNVLSRHSNLNILKDEEKIYYLNNFWKPPPNFCFPGTKIQNENFKRKFNYSWLLNYPWLVYSKSIDAVYCKYCCFFATNNSADRATQALGQLVKDPFKTWRRATRTFNKHQITNYHKYSVLRADDLQTVVDGKRQSVIDLIDTCRVKHAKKNRLKLTPIIKTLLFLW*K*FSTSGTSRYGHL*YE-Y**N*QKYNTPXXXXXX--------XXXXXXXXXXXXXXXTFRNANYLSWKIQNEMINAGNQIILKRIIERANQSECFSVLADETTDMSTQEQFSICIRFIDKDKKLNESFLQFVPVVSTSSKSLANTLVQFLSSIGLNPSYLKGQGYDGAEAMSGRFNGVQAKIMDLYPSALYVHCVSHSLNLALSDVCQIQDIRNCMGVVEKCYSFMNTPKRDAVLQKKISDICPDAKRTKLKK*CPTRWVERHDSIMIMVELLNPLILALEEIETWKDKE 3118
            +AQPSNSQNLENRNDND                                              RKFNYSWLLNYPWLVYSKSIDAVYCKYCC FATNN ADRATQALGQLVKD FKTW RATRTFNKHQITNYHKYSVLRA DLQ        SVIDLIDTCRVK AK+NRLKLTPIIKTLLF        +G    GH   + +  N  K +T   +             +      +     + +NANYLSWKIQNE INA NQIILKRI+ERANQSECFSVLADETTDMSTQEQFSICIRFIDKDKK+NESFLQFVPVV TSSKSL NTLVQFLSSIGLN SYLKGQGYDGA AMSGRFN VQAKIMDLYPS LYVHC SHSLNL+LSDVCQIQDIRNC+GVVEKCYSFMNT KRDAVLQKKISDICPDAKRTKLKK CPTRWVERHDSIMIMVELLNPLILALEEIETWKDKE
Sbjct: 1157 QAQPSNSQNLENRNDNDN--------------------------------------------DRKFNYSWLLNYPWLVYSKSIDAVYCKYCCLFATNNPADRATQALGQLVKDHFKTWCRATRTFNKHQITNYHKYSVLRAYDLQ--------SVIDLIDTCRVKQAKENRLKLTPIIKTLLFC-----DRNGFPLRGHRDTDTFNMNIDKIDTSTIRQEGNFHQLIRFRLESGDQALKEHLKNSSKNANYLSWKIQNENINACNQIILKRIVERANQSECFSVLADETTDMSTQEQFSICIRFIDKDKKMNESFLQFVPVVRTSSKSLENTLVQFLSSIGLNLSYLKGQGYDGAAAMSGRFNRVQAKIMDLYPSTLYVHCASHSLNLSLSDVCQIQDIRNCIGVVEKCYSFMNTLKRDAVLQKKISDICPDAKRTKLKKLCPTRWVERHDSIMIMVELLNPLILALEEIETWKDKE 1576          

HSP 2 Score: 102.449 bits (254), Expect = 2.002e-21
Identity = 48/60 (80.00%), Postives = 51/60 (85.00%), Query Frame = 3
Query: 2250 KPFCFCGRNSFRLRGHRDTDIFNMNIDEIDKSTIRQKGNFRQLIRFRLESGDQALKEHLE 2429
            K   FC RN F LRGHRDTD FNMNID+ID STIRQ+GNF QLIRFRLESGDQALKEHL+
Sbjct: 1283 KTLLFCDRNGFPLRGHRDTDTFNMNIDKIDTSTIRQEGNFHQLIRFRLESGDQALKEHLK 1342          
BLAST of TTF-type domain-containing protein vs. Planmine SMEST
Match: SMESG000008969.1 (SMESG000008969.1)

HSP 1 Score: 176.407 bits (446), Expect = 7.453e-47
Identity = 117/414 (28.26%), Postives = 202/414 (48.79%), Query Frame = 2
Query: 1874 GTKIQNENF--KRKFNYSWLLNYPWLVYSKSIDAVYCKYCCFFATNNSADRATQALGQLVKDPFKTWRRATRTFNKHQITNYHKYSVLRADDLQTVVDGKRQSVIDLIDTCRVKHAKKNRLKLTPIIKTLLFLW*K*FSTSGTSRYGHL*YEY**N*QKYNTPXXXXXXXXXXXXXXXXXXXXXTFRNANYLSWKIQNEMINAGNQIILKRIIERANQSECFSVLADETTDMSTQEQFSICIRFIDKDKK----LNESFLQFVPVVSTSSKSLANTLVQFLSSIGLNPSYLKGQGYDGAEAMSGRFNGVQAKIMDLYPSALYVHCVSHSLNLALSDVCQIQDIRNCMGVVEKCYSFMNTPKRDAVLQKKISDICPDAKRTKLKK*CPTRWVERHDSIMIMVELLNPLILALEEI 3097
            G   +N++    R F ++WL +YP + YS  +  V C+ C  F  +   DR  Q  G  +   F  +++       H  + +H+ S+ +A++   ++  KR++V +++++   +  K NR  L PI+KT++F         G +              K       L         I  +       NA Y+S ++QNE+I   N ++ + IIE A +S   S++ADE+ D+   EQ SI IRFI+K         E FL FVP+    ++ ++ T++  L   GL+ S + GQ Y G   M+G+ +GV+ +I D YP A + HC SH LNL ++D+  + +IRN +G ++   +F     R++ L++K     P          C TRW  ++ S+ I  E +  ++ AL ++
Sbjct:   39 GNDFKNDSLDSSRTFRHTWLHDYPEMSYSAKLKGVVCRTCVLFKPH--VDRGIQ--GAFILKEFTKYKKFHECAKLHLQSKWHRESINKANNFSQIIQNKRRNVAEMMNSVLEQTIKNNRKNLLPIVKTIVFCAINNIPFRGKT-------------DKTAIFNNLLQFRIDTGDLILSNHLQSCPSNATYISHRVQNELIGICNDVLRENIIEDAKKSPFLSIIADESCDIYGIEQLSIGIRFINKMSTNEFCCREEFLGFVPLERMDAEYISETIISSLVKFGLDLSKMVGQAYYGCSTMAGKISGVKKRIQDQYPFANFYHCSSHRLNLVINDLNDVCEIRNAVGTIKSIINFF----RESSLRRKHIPNIPLF--------CETRWTAKYKSVRIFKENIIVILEALHKL 423          
BLAST of TTF-type domain-containing protein vs. Planmine SMEST
Match: SMESG000036749.1 (SMESG000036749.1)

HSP 1 Score: 164.081 bits (414), Expect = 8.110e-41
Identity = 145/511 (28.38%), Postives = 249/511 (48.73%), Query Frame = 2
Query: 2426 RNANYLSWKIQNEMINAGNQIILKRIIERANQSECFSVLADETTDMSTQEQFSICIRFI---DKDKKLNESFLQFVPVVSTSSKSLANTLVQFLSSIGLNPSYLKGQGYDGAEAMSGRFNGVQAKIMDLYPSALYVHCVSHSLNLALSDVCQIQ----DIRNCMGVVEKCYSFMNTPKRDAVLQKKISDICPDAKRTKLKK*CPTRWVERHDSIMI----MVELLNPLILALEEIETWKDKESSSSKNRAIKSTNIFLSILTVEKIFSYTLPLSKIMQTESLDLVTAIKICEDVVGQFEKFRKS-AVTVFNEIYKRAEVLLRKMVDTNYAISIPRINKLQIHRCNISSQ-------SPEEYYRISLFIPFLDATVTQLKERFLKHKAILKAFNILIPSNTNTSHHEYSTNLEILLQKYNTDLNCTINMLIAEYELWQRKFSLNPIQKN----ASVLQYLCEYSGEI-FPNIFKLLKILATIPVTTSTVERSFSTLKYLKNYLRSTTAEDRL 3886
            R  +YL  + QNE+I      I K I+    +++ FSV+ D T D    EQ ++ IR++   + + ++ E+F+ F      + +S  + L+Q L+ I LN S ++GQGYD    MSG+  G+Q +I+D YP AL++ C +H+LNLA++D   +     D  + +  +   +S   +P R  VL+K +       K   LK+   TRW  R  +I      + E+ + LI   EE      +  +      +KS     SI+   +I      +SK+MQ  S ++ +  +  ++V+  F+  R   +   + +I     V L    D    IS+    + + HR   S +       +P+E+++IS     LD  ++ L  RF       + F  L     +  H E   +   L  K+    +C I+ +    EL+Q   SL  I K+      ++++L +Y+ E  FPN+   LK+L T+PV+ ++ ERSFS LK +KN+LR++  ++RL
Sbjct:  242 RMPHYLGNRFQNEIIAILATQIQKYILTSIKEAKYFSVILDCTPDTGHVEQITMVIRYVHIKNYEVEVRENFIGFYQAKKCTGESFYDFLIQKLNYIELNISDMRGQGYDNGSNMSGKHRGLQKRILDNYPRALFMPCNAHTLNLAINDAANVSFSTVDFFSNVSAISNFFS--ASPFRWQVLKKNV-------KSLTLKQVSETRWEARIKAIRPLRNELGEIYDSLIEIAEESSMPTVQHEAECLAMKLKSYKFISSIIIWFEILEKVDFISKMMQKVSWNISSCAESIKEVLKYFKSIRNDESFENYLQISNELCVALETEPDFPAEISV----RSRHHRKQFSYERDEDIQFTPKEHFQISFSYVILDTAISSLTTRFETLSGFERCFGFLYKF-IDMEHEEIKKSCFDLHNKFKDGESCDISGV----ELYQELVSLKIIIKDRKQPEELIKFLYKYNLETSFPNVATSLKLLLTVPVSVASGERSFSKLKIIKNHLRTSMTQERL 734          
BLAST of TTF-type domain-containing protein vs. Planmine SMEST
Match: SMESG000047334.1 (SMESG000047334.1)

HSP 1 Score: 149.828 bits (377), Expect = 2.946e-36
Identity = 178/688 (25.87%), Postives = 305/688 (44.33%), Query Frame = 2
Query: 1898 FKRKFNYSWLLNYPWLVYSKSIDAVYCKYCCFFATNNSADRATQALGQLVKDPFKTWRRATRTFNKHQITNYH--KYSVLRADDLQTVVDGKRQSVIDLIDTCRVKHAKKNRL--KLTPIIKTLLFLW*K*FSTSGTSRYGHL*YEY**N*QKYNTPXXXXXXXXXXXXXXXXXXXXXTFRNANYLSWKIQNEMINAGNQIILKRIIERANQSECFSVLADETTDMSTQEQFSICIRFIDKDKKLNESFLQFVPVVSTSSKSLANTLVQFLSSIGLNPSYLKGQGYDGAEAMSGRFNGVQAKIMDLYPSALYVHCVSHSLNLALSDVCQIQ-DIRNCMGVVEKCYS-FMNTPKRDAVLQKKISDICPDAKRTKLKK*CPTRWVERHDSIMI----MVELLNPLILALEEIETWKDKESSSSKNRAIKSTNIFLSILTVEKIFSYTLPLSKIMQTESLDLVTAIKICEDVVGQFEKFRKSAVTVFNEIYKRAEVLLRKMVDTNYAISIPRINKLQIHRCNISSQ-------SPEEYYRISLFIPFLDATVTQLKERFLKHKAILKAFNILIPSNTNTSHHEYSTNLEILLQKYNTDLNCTINMLIAEYELWQRKFSLNPIQKN----ASVLQYLCEYSGEI-FPNIFKLLKILATIPVTTSTVERSFSTLKYLKNYLRSTTAEDRLNGL 3895
            F RK       N   L+YS   DA++C  C  F              +LV + F  W+  +   ++H+ T  H   Y+  +  +L      KR++ ID  +  R   A+K R    +  +I  + FL  +  +  G+S  G L  +   N  K      K   I        +  +    R  +YL  + QNE+I      I K I+    +++ FSV+ D T D    EQ ++ IR++                       + N  V+ L+ + LN S ++GQGYD    MSG+   +Q +I+D YP AL++ C +H+LNLA++D   +     +    V   Y+ F  +P R  VL+K +       K   LK+   T+W  R  +I      + E+ + LI   EE      +  +      +KS     SI+   +I      +SK+MQ  S ++ +  +  ++V+  F+  R    +  N +    E+ +    + ++   I  I + + HR   S +       +P+E+++IS F   LD  ++ L  RF       + F  L     +  H E   +   L  K+    +C I+ +    EL+Q   SL  I K+      ++++L +Y+ E  FPN+   LK+L T+PV+ ++ ERSFS LK +KN+LR++  ++RL+ +
Sbjct:  279 FYRKLPNGEKFNRELLIYSPKNDAIFCFCCKLFGKQEI---------KLVNEGFNDWQHISDNLSRHEKTTLHIENYTCWKKLELNL----KRKTTIDK-NMQRYYDAEKKRWCQIVKRMISVVQFLAGQCLAFRGSS--GILYEKNNGNFLKAIEMIGKFDDIMADHIKRVQEPNAPKNRMPHYLGNRFQNEIIAILATQIQKYILTSIKEAKYFSVILDCTPDTGHVEQITMVIRYV----------------------HIKNYEVE-LNYLELNISDMRGQGYDNGSNMSGKHRRLQKRILDNYPRALFMPCNAHTLNLAINDAANVSFSTVDFFSNVSAIYNIFSASPFRWQVLKKNV-------KSLTLKQVSETQWEARIKAIRPLRNELGEIYDSLIEIAEESSMPTVRHEAECLAMKLKSYKFISSIIIWYEILEKVDFISKMMQKVSWNISSCAESIKEVLKFFKSIRNDE-SFENYLQISNELCVALETEPDFPAEI--IVRSRHHRKQFSYERDEDIQFTPKEHFQISFFYVILDTAISSLTTRFETLSGFERCFGFLYKF-IDMEHEEIKKSCFDLHNKFKDGESCDISGV----ELYQELVSLKIIIKDRKQPEELIKFLYKYNLETSFPNVATSLKLLLTVPVSVASGERSFSKLKIIKNHLRTSMTQERLSNI 912          
BLAST of TTF-type domain-containing protein vs. Planmine SMEST
Match: SMESG000061124.1 (SMESG000061124.1)

HSP 1 Score: 145.591 bits (366), Expect = 1.195e-34
Identity = 140/511 (27.40%), Postives = 240/511 (46.97%), Query Frame = 2
Query: 2435 NYLSWKIQNEMINAGNQIILKRIIERANQSECFSVLADETTDMSTQEQFSICIRFIDKDKKLNESFLQFVPVVSTSSKSLANTLVQFLSSIGLNPSYLKGQGYDGAEAMSGRFNGVQAKIMDLYPSALYVHCVSHSLNLALSDVCQIQ-DIRNCMGVVEKCYSFMN-TPKRDAVLQKKISDICPDAKRTKLKK*CPTRWVERHDSIMI----MVELLNPLILALEEIETWKDKESSSSKNRAIKSTNIFLSILTVEKIFSYTLPLSKIMQTESLDLVTAIKICEDVVGQFEKFRKS-AVTVFNEIYKRAEVLLRKMVDTNYAISIPRINKLQIHRCNISSQ-------SPEEYYRISLFIPFLDATVTQLKERFLKHKAILKAFNILIPSNTNTSHHEYSTNLEILLQKYNTDLNCTINMLIAEYELWQRKFSLNPIQKN----ASVLQYLCEYSGEI-FPNIFKLLKILATIPVTTSTVERSFSTLKYLKNYLRSTTAEDRLNGLALLYI 3910
            +Y   + QNE+I      I K I+    +++ FSV+ D T D    EQ ++ IR++                       + N  V+ L+ + LN S ++GQGYD    MSG+  G+Q +I+D YP AL++ C +H+LNLA++D   +     +    V   Y+F + +P R  VL+K +       K   LK+   TRW  R  +I      + E+ + LI   EE      +  +      +KS     SI+   +I      +SK+MQ  S ++ +  +  ++V+  F+  R   +   + +I     V L    D    IS+    + + HR   S +       +P+E+++IS F   LD  ++ L  RF       + F  L     +  H E   +   L  K+    +C I+ +    EL+Q   SL  I K+      ++++L +Y+ E  FPN+   LK+L T+PV  ++ ERSFS LK +KN+LR++  ++ L+ ++++ I
Sbjct:  317 HYQGNRFQNEIIAILATQIQKYILTSIKEAKYFSVILDCTPDTGHVEQITMVIRYV----------------------YIKNYEVE-LNYLELNISDMRGQGYDNGSNMSGKHRGLQKRILDNYPRALFMPCNAHTLNLAINDAANVSFSTVDFFSNVSAVYNFFSASPFRWQVLKKNV-------KSLTLKQVSETRWEARIKAIRPLRNELGEIYDSLIEIAEESSMPTVRHEAECLANKLKSYKFISSIIIWYEILEKVDFISKMMQKVSWNISSCAESIKEVLKFFKSIRNDESFENYLQISNELCVALETEPDFPAEISV----RSRHHRKQFSYERDEDIQFTPKEHFQISFFNVILDTAISSLTTRFETLSGFERCFGFLYKF-IDMEHEEIKKSCFDLHNKFKDGESCDISGV----ELYQELVSLKIIIKDRKQPEELIKFLYKYNLETSFPNVATSLKLLLTVPVFVASGERSFSKLKIIKNHLRTSMTQECLSNISIIAI 788          
The following BLAST results are available for this feature:
BLAST of TTF-type domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
THAP125.123e-4125.83THAP domain containing 12 [Source:HGNC Symbol;Acc:... [more]
ZMYM11.161e-2725.00zinc finger MYM-type containing 1 [Source:HGNC Sym... [more]
ZMYM11.161e-2725.00zinc finger MYM-type containing 1 [Source:HGNC Sym... [more]
ZMYM11.161e-2725.00zinc finger MYM-type containing 1 [Source:HGNC Sym... [more]
ZMYM11.161e-2725.00zinc finger MYM-type containing 1 [Source:HGNC Sym... [more]
back to top
BLAST of TTF-type domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TTF-type domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TTF-type domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CR762475.19.650e-5330.33pep chromosome:GRCz11:4:55494751:55498830:1 gene:E... [more]
thap12a1.142e-2923.49THAP domain containing 12a [Source:ZFIN;Acc:ZDB-GE... [more]
thap12b1.401e-2922.39THAP domain containing 12b [Source:ZFIN;Acc:ZDB-GE... [more]
AL928808.15.739e-1128.80pep chromosome:GRCz11:20:17257101:17259573:-1 gene... [more]
si:ch211-240b21.28.152e-950.00si:ch211-240b21.2 [Source:ZFIN;Acc:ZDB-GENE-060526... [more]
back to top
BLAST of TTF-type domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tbx187.598e-6628.89T-box 18 [Source:Xenbase;Acc:XB-GENE-489907][more]
slc10a61.825e-4527.03solute carrier family 10 (sodium/bile acid cotrans... [more]
thap125.813e-3124.51THAP domain containing 12 [Source:NCBI gene;Acc:39... [more]
ENSXETT00000043220.11.139e-3025.87pep primary_assembly:Xenopus_tropicalis_v9.1:7:364... [more]
ENSXETT00000005329.12.527e-720.22uncharacterized LOC100494784 [Source:NCBI gene;Acc... [more]
back to top
BLAST of TTF-type domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Thap121.032e-3726.10THAP domain containing 12 [Source:MGI Symbol;Acc:M... [more]
Zmym11.126e-2623.06zinc finger, MYM domain containing 1 [Source:MGI S... [more]
Zmym11.712e-2623.12zinc finger, MYM domain containing 1 [Source:MGI S... [more]
Zmym11.712e-2623.12zinc finger, MYM domain containing 1 [Source:MGI S... [more]
back to top
BLAST of TTF-type domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O43422|P52K_HUMAN2.460e-4025.8352 kDa repressor of the inhibitor of the protein k... [more]
sp|Q9CUX1|P52K_MOUSE7.216e-3726.1052 kDa repressor of the inhibitor of the protein k... [more]
sp|Q5SVZ6|ZMYM1_HUMAN5.576e-2725.00Zinc finger MYM-type protein 1 OS=Homo sapiens OX=... [more]
sp|O60290|ZN862_HUMAN1.448e-1329.79Zinc finger protein 862 OS=Homo sapiens OX=9606 GN... [more]
sp|Q9HCI6|K1586_HUMAN6.156e-826.97E3 SUMO-protein ligase KIAA1586 OS=Homo sapiens OX... [more]
back to top
BLAST of TTF-type domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2S2Q5022.192e-16841.09Repressor of the inhibitor of the protein kinase O... [more]
A0A5N4AYX76.856e-16439.55Uncharacterized protein OS=Photinus pyralis OX=705... [more]
A0A1B6JRW01.868e-15739.34TTF-type domain-containing protein OS=Homalodisca ... [more]
J9LUK62.466e-15439.71TTF-type domain-containing protein OS=Acyrthosipho... [more]
J9M5M72.230e-15037.96Uncharacterized protein OS=Acyrthosiphon pisum OX=... [more]
back to top
BLAST of TTF-type domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000035789.11.201e-5729.28pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000042930.12.177e-5628.90pep primary_assembly:Astyanax_mexicanus-2.0:12:254... [more]
ENSAMXT00000032220.19.041e-5229.73pep primary_assembly:Astyanax_mexicanus-2.0:24:134... [more]
ENSAMXT00000057644.15.559e-4829.44pep primary_assembly:Astyanax_mexicanus-2.0:10:176... [more]
ENSAMXT00000046011.11.148e-4525.74pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of TTF-type domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TTF-type domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TTF-type domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO406621.835e-2331.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO423891.736e-2029.07Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO364273.177e-1624.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO261512.317e-1430.07Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO322476.748e-1441.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of TTF-type domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000028133.13.570e-3926.40zinc finger MYM-type protein 1-like [Source:NCBI g... [more]
ENSORLT00000042294.13.570e-3926.40zinc finger MYM-type protein 1-like [Source:NCBI g... [more]
ENSORLT00000045044.13.570e-3926.40zinc finger MYM-type protein 1-like [Source:NCBI g... [more]
ENSORLT00000027735.14.999e-3129.51pep primary_assembly:ASM223467v1:9:30712608:307152... [more]
ENSORLT00000041223.11.101e-2623.14zinc finger MYM-type protein 1 [Source:NCBI gene;A... [more]
back to top
BLAST of TTF-type domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000003943.12.002e-2171.70SMESG000003943.1[more]
SMESG000008969.17.453e-4728.26SMESG000008969.1[more]
SMESG000036749.18.110e-4128.38SMESG000036749.1[more]
SMESG000047334.12.946e-3625.87SMESG000047334.1[more]
SMESG000061124.11.195e-3427.40SMESG000061124.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028174 ID=SMED30028174|Name=TTF-type domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=4268bp
CTTTCGGGTAATATATTACTTCCACTTAATAATACAAGGTGTAAAATAGT
TGTAAAGAACTTCTTAATTTATCTCCTCAGAGTTATTTTCAGTTATTAAA
GGCAAAAAACGCAAAAATAATATATAATACTATCAAAATACATTGTTTAC
TAATGACTCAAATAAGGAAAACCTTTGATTTATTACTCAAGCGTTAAGTC
GCTAAATTCACTGTAGCGAAATTCAGCAACCAGTTGATCGTTGGAGGCGC
AATTAGAATGTCTCCTAGTGGCAATGGTGCATATAATCCTTATAACAAGA
TAATTATAAATTGTAACGCAAATTTACCTTTTAAATAAATTCTATAACTG
ATTCATTTAATTCCAACATGGAAAAGATTGGAAAGACACAACAGCTCAAC
CCCATAAATTAGTTATAAATCAATATAATAGTTGTTACAAGACTTCTTCC
ATACTTCTTTTGTATTTAATAATACGGCCCATTTTATTTATCAGATTGTG
AGATGTGACGAAATTATATTTAATCTGATAATGTAAGATAAAGCACAAAA
ACATTAGCCTAAACCTCAGCATCACCGACATGTTTGCAGCTAGCATTGAT
CAGCATAAATTATATTATTAACTTATGCCAGGCACAGTATAACAGTATGC
AATAACCATTGCAATATAATAACAATACCAAAAGTATTATTGTAAATCGG
GGCTATTCAGTTACCGGCCCGCGAACCCAAAAGAAAATTTTTGAATATGT
ATAATATACTTATTCAAAATTTGACTCCATTTAATCCAAAACGGCGTTGG
CGGCCCGCTTTGCGCCTTCGACCCCATGGTTTGTCCTCGGGCGACCACCA
CAAGTGTTGGTAAACCCTAGCGACACCCCTCTACTGAGCCTCTGGCATTC
CACCATTTCCAGATTTATTTGGTTTGGCCCTTGACTAAATGATGCATAAT
TGATGCATAAATGATGACTAATGATGCATAATCAAAATTAAATATTATTC
CAATATATTAATCAACAGTTTTAAGAAGCGTGAAACAACAAATGAACCAA
TTTAAACAAAAAATTAGTAAATATAATCAAGATGCTGTAATACAAAAAAT
AATGATTCAAAGGGTATAAATGTCATACAGATATCAATCCACAACAAGCT
CTTACATTTCTAACCTCAAGGATGCTGGAAATAGTGATAAACAGAAAAAT
AGCAAAAATTGTACTTTTAAAAATAGAAAATTGTTTACGAAAAACAAACA
TTACTGACATGTTAAGATTCCTGTCACTTAGTATGAAGAACCACAAAAAA
TTCATTATATAAACCACAAATTTTCTCAGTCAAAACACCCAAAAATTCTA
AGCTCAAGAAGAATTTCGTAGTTGATATTGGCTATCAAAATAATAAAATA
GAGCATACAATACATCGAGCTCAGAAAAATCATTCGATTTCACACACGTG
TACACATTTAAATTTATACACATATATTGTGAAATTGTAATTTTATCATT
GTCTCTTATATTAGATGCCATGTTGAGATTCTAGGAACCTCAACAGGTTG
AAGCTTAGGGAAAAGTATTATAATTCAAATCTGAATATGAATCCATTCTC
AGAAATCTTCATGAATTACACAATAAAGTCATTCAGAGTAGTTATCAATG
TGAAATGTCTTTAGTTTCAATATTTAGTGATCCTAATTTCCAAGAAAAGT
TGTAAAGTCAATTTAAAGCTCAGCCTTCTAATAGTCAAAATTTGGAAAAT
AGAAATGATAATGATGTGCTCAACGTTCTGTCCAGACATTCAAATTTGAA
TATTCTCAAGGACGAGGAGAAAATTTACTATCTAAATAATTTTTGGAAAC
CGCCACCAAATTTTTGTTTCCCTGGCACCAAAATACAGAACGAAAATTTT
AAGAGGAAATTCAATTACTCTTGGCTTCTAAATTATCCATGGCTAGTTTA
TTCCAAATCAATTGACGCGGTCTATTGCAAGTATTGCTGCTTCTTTGCTA
CAAACAACTCTGCAGATCGTGCAACTCAAGCTCTTGGTCAGTTGGTGAAA
GACCCTTTCAAGACTTGGCGTAGGGCAACAAGAACATTTAATAAACACCA
AATTACCAATTATCATAAATATTCAGTTTTGCGTGCAGACGATTTGCAAA
CGGTTGTTGACGGAAAGCGGCAATCGGTTATTGACCTCATTGATACTTGC
AGGGTCAAACATGCTAAGAAAAATCGTTTAAAGCTAACGCCAATAATAAA
AACCCTTTTGTTTTTGTGGTAGAAATAGTTTTCGACTTCGGGGACATCGA
GATACGGACATCTTTAATATGAATATTGATGAAATTGACAAAAGTACAAT
ACGCCAAAAAGGAAACTTTCGTCAATTAATAAGATTTCGTCTTGAATCAG
GCGATCAGGCTCTTAAAGAACATTTAGAAATGCCAATTATTTGTCTTGGA
AGATTCAGAATGAAATGATAAATGCCGGCAATCAAATAATACTAAAACGT
ATTATCGAAAGAGCAAATCAAAGTGAATGTTTTTCTGTGCTTGCCGATGA
AACCACAGATATGTCGACGCAAGAGCAATTTTCTATTTGCATACGGTTCA
TCGACAAAGACAAAAAACTGAACGAGTCCTTTTTGCAGTTTGTGCCTGTA
GTAAGCACATCAAGTAAAAGCCTGGCAAATACATTGGTGCAGTTTTTGAG
TAGCATTGGGTTAAATCCATCTTATTTAAAAGGACAAGGTTACGATGGCG
CAGAAGCAATGTCTGGCAGATTTAACGGAGTTCAAGCTAAAATAATGGAT
TTATACCCTTCTGCATTATACGTTCATTGTGTTTCACACTCGTTAAATTT
AGCTTTGTCTGATGTATGTCAAATACAGGACATCAGAAATTGTATGGGCG
TTGTGGAAAAATGTTACAGTTTCATGAATACACCGAAAAGAGATGCAGTT
CTTCAAAAGAAAATTTCTGATATATGCCCAGATGCAAAACGAACTAAACT
GAAAAAATGATGTCCAACACGTTGGGTTGAAAGACATGATTCAATAATGA
TAATGGTTGAATTACTTAATCCACTTATTCTCGCCCTAGAAGAAATTGAA
ACTTGGAAAGACAAAGAATCGTCTTCTTCAAAGAATCGTGCTATCAAAAG
TACCAATATTTTCTTATCAATTTTGACTGTGGAAAAAATATTTTCTTACA
CTCTACCGCTAAGCAAAATAATGCAAACTGAGTCACTTGACCTTGTAACA
GCCATTAAAATTTGCGAAGATGTAGTTGGACAGTTTGAGAAATTTCGTAA
ATCAGCAGTTACTGTTTTCAATGAAATATACAAAAGAGCTGAAGTATTAT
TGAGAAAAATGGTAGATACCAACTATGCTATTTCAATTCCGCGCATAAAT
AAACTACAAATCCACAGATGCAATATTAGTTCTCAATCCCCGGAAGAATA
TTATCGCATTTCATTATTTATCCCATTTTTGGACGCCACAGTAACCCAAT
TAAAGGAGAGGTTTCTAAAGCACAAGGCAATATTGAAAGCATTTAATATT
TTAATTCCATCAAATACAAATACTAGTCACCATGAGTATAGCACAAATTT
AGAGATATTATTGCAAAAATATAACACCGATTTAAATTGCACAATAAATA
TGTTAATAGCCGAATACGAACTGTGGCAAAGAAAGTTTAGTTTAAATCCA
ATACAAAAAAATGCAAGTGTTTTGCAATACCTCTGCGAATACAGTGGAGA
AATATTTCCCAACATTTTCAAATTGCTTAAAATCTTGGCCACAATTCCCG
TGACAACAAGTACGGTTGAAAGGTCATTTTCAACTTTAAAATATTTAAAG
AACTATTTGAGAAGCACCACGGCAGAAGATCGGCTAAATGGTTTGGCTTT
GCTCTATATATATATCGAGACATGCCTATAACGGAAGAAGAAATATTTAA
TATATTGCAGGAAAAAAAGAGGAAATTAGATATTGTTCTGTAAGGGTCGA
TTTATAAGTAATATTACTCTTTTGTTGTTTTTGCCTTTTGCACAAATTTA
TCGATTTGTTTTGTAAGTTTTTATGCTCTGCTTTATAATTTATCAAATTT
TTATAATAAATCAAATATTAAAAAAGCTCTGGCCAGTGTAGCATATGTGG
GTCCTTTAGTGCAAGGCCCGCACTTGACCCTCTTTGGGCCGATACTGACA
GCGTACCCCATTCAAAATTCCTGGTTGCGTCACTGGTAAGTATTGCCGTC
GATATTATTGAGCACTAC
back to top

protein sequence of SMED30028174-orf-1

>SMED30028174-orf-1 ID=SMED30028174-orf-1|Name=SMED30028174-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=295bp
MIMVELLNPLILALEEIETWKDKESSSSKNRAIKSTNIFLSILTVEKIFS
YTLPLSKIMQTESLDLVTAIKICEDVVGQFEKFRKSAVTVFNEIYKRAEV
LLRKMVDTNYAISIPRINKLQIHRCNISSQSPEEYYRISLFIPFLDATVT
QLKERFLKHKAILKAFNILIPSNTNTSHHEYSTNLEILLQKYNTDLNCTI
NMLIAEYELWQRKFSLNPIQKNASVLQYLCEYSGEIFPNIFKLLKILATI
PVTTSTVERSFSTLKYLKNYLRSTTAEDRLNGLALLYIYIETCL*
back to top

protein sequence of SMED30028174-orf-2

>SMED30028174-orf-2 ID=SMED30028174-orf-2|Name=SMED30028174-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=182bp
MINAGNQIILKRIIERANQSECFSVLADETTDMSTQEQFSICIRFIDKDK
KLNESFLQFVPVVSTSSKSLANTLVQFLSSIGLNPSYLKGQGYDGAEAMS
GRFNGVQAKIMDLYPSALYVHCVSHSLNLALSDVCQIQDIRNCMGVVEKC
YSFMNTPKRDAVLQKKISDICPDAKRTKLKK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0000074oocyte
PLANA:0000231vitelline gland
Vocabulary: INTERPRO
TermDefinition
IPR008906HATC_C_dom
IPR012337RNaseH-like_sf
IPR006580Znf_TTF
IPR025398DUF4371
Vocabulary: molecular function
TermDefinition
GO:0046983protein dimerization activity
GO:0003676nucleic acid binding
GO:0000981RNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0003677DNA binding
GO:0005515protein binding
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005654nucleoplasm
GO:0005737cytoplasm
Vocabulary: biological process
TermDefinition
GO:0006357regulation of transcription from RNA polymerase II promoter
GO:0006950response to stress
GO:0007165signal transduction
GO:0008285negative regulation of cell proliferation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR008906HAT, C-terminal dimerisation domainPFAMPF05699Dimer_Tnp_hATcoord: 144..230
e-value: 5.0E-13
score: 48.6
NoneNo IPR availablePANTHERPTHR46289:SF3coord: 1..230
NoneNo IPR availablePANTHERPTHR46289FAMILY NOT NAMEDcoord: 1..230
NoneNo IPR availableTMHMMTMhelixcoord: 222..244
IPR012337Ribonuclease H-like superfamilySUPERFAMILYSSF53098Ribonuclease H-likecoord: 94..231