FMRFamide-activated amiloride-sensitive sodium channel

Overview
NameFMRFamide-activated amiloride-sensitive sodium channel
Smed IDSMED30028157
Length (bp)2252
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of FMRFamide-activated amiloride-sensitive sodium channel (SMED30028157) t-SNE clustered cells

Violin plots show distribution of expression levels for FMRFamide-activated amiloride-sensitive sodium channel (SMED30028157) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of FMRFamide-activated amiloride-sensitive sodium channel (SMED30028157) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for FMRFamide-activated amiloride-sensitive sodium channel (SMED30028157) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028157

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30028157SMESG000081715.1 dd_Smed_v4_39659_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30028157SMESG000081715.1 dd_Smed_v4_39659_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30028157SMESG000081715.1 dd_Smed_v4_39659_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30028157SMESG000081715.1 Contig9576newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30028157SMESG000081715.1 Contig9576uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Human
Match: SCNN1G (sodium channel epithelial 1 gamma subunit [Source:HGNC Symbol;Acc:HGNC:10602])

HSP 1 Score: 57.3806 bits (137), Expect = 8.733e-8
Identity = 61/231 (26.41%), Postives = 94/231 (40.69%), Query Frame = 1
Query:  619 CDLKNEKFNIKLFSHQEYFNCYTIEGLEQYT---TDVIGLILLVQIIPSEKIPELSNSFLVDILQRGEGLKVAVHQPQTYPDIENSGINMHPAKMNSLVYSPTKWIRMSTSKNPCRDKQK--PINDLNRHFKYAFTQCVSAEIQRQIIKQCGCMLSNAPRPYPPNETIPYCIKLVSPTKAKLI--LERLSCVENIQSQSVEIRKTIQNDLCFLKCQFTTYETTMSLTRWTA 1290
            CD +N      LF H  + NCYT    E  T   T + G    +Q+I      E  N FLV       G KV +H+   YP +E+ G  +  A + S+    T+  ++S   + C +     PI ++  +  Y+   C+ +  Q +++++CGC   + P P   N    YC     P        L R    E +  QSV          C   C F  +  T SL +W +
Sbjct:  267 CDARN----FTLFHHPMHGNCYTFNNRENETILSTSMGGSEYGLQVILYINEEEY-NPFLVS----STGAKVIIHRQDEYPFVEDVGTEIETAMVTSIGMHLTESFKLSEPYSQCTEDGSDVPIRNI-YNAAYSLQICLHSCFQTKMVEKCGCAQYSQPLPPAAN----YCNYQQHPNWMYCYYQLHRAFVQEELGCQSV----------CKEACSFKEWTLTTSLAQWPS 473          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Human
Match: ASIC1 (acid sensing ion channel subunit 1 [Source:HGNC Symbol;Acc:HGNC:100])

HSP 1 Score: 55.0694 bits (131), Expect = 4.211e-7
Identity = 97/421 (23.04%), Postives = 166/421 (39.43%), Query Frame = 1
Query:  106 VKMSKTKLFCQISSIRGISKIHS-AKTKFERFLWT----GFVILMTCVLFVQMVFLIQDYLQYTTAWHTSTELDYPSP----FPAITLCAQNPF---SIDANRLWSKRKIMSPSELQDNLTIMSLNAFDDKNLDGLEYLRLYDLFSTFYMNL-PFLDTIKLGHS-KDMIRYCILIYKNDIIIAEKCDLKNEKFNIKLFSHQEYFNCYTI----EGLEQYTT----DVIGLILLVQIIPSEKIPELSNSFLVDILQRGEGLKVAVHQPQTYPDIENSGINMHPA-------KMNSLVYSPTKWIRMSTSKNPCRDKQKPINDLNRHFKYAFTQCVSAEIQRQIIKQCGCMLSNAPRPYPPNETIPYCIKLVSPTKAKLILERLSCVENIQSQSVEIRKTIQNDLCFLKCQFTTYETTMSLTR 1281
            V+    + F   S++ G++ I S  +   +R LW     G + ++ CV          + +QY   +H  T+LD  +     FPA+TLC  N F    +  N L+   ++++   L +   I      D+K L+ L+    +  F     N+  F D  + GH  +DM+  C   ++ ++  AE        F + +F+   Y  CYT     +G  +  T       GL +++ I   E +P    +   D      G+KV +H     P I+  G  + P        +   L+Y P  W    T K    D     +DL+    Y+ T C      R +++ C C + + P         PYC    +P + K       C +      VE  K  +  +C + C  T Y   +S+ +
Sbjct:   13 VQPVSIQAFASSSTLHGLAHIFSYERLSLKRALWALCFLGSLAVLLCV--------CTERVQYYFHYHHVTKLDEVAASQLTFPAVTLCNLNEFRFSQVSKNDLYHAGELLAL--LNNRYEIPDTQMADEKQLEILQDKANFRSFKPKPFNMREFYD--RAGHDIRDMLLSCH--FRGEVCSAED-------FKV-VFTR--YGKCYTFNSGRDGRPRLKTMKGGTGNGLEIMLDIQQDEYLPVWGET---DETSFEAGIKVQIHSQDEPPFIDQLGFGVAPGFQTFVACQEQRLIYLPPPW---GTCKAVTMD-----SDLDFFDSYSITACRIDCETRYLVENCNCRMVHMPG------DAPYC----TPEQYK------ECADPALDFLVE--KDQEYCVCEMPCNLTRYGKELSMVK 380          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Human
Match: ASIC1 (acid sensing ion channel subunit 1 [Source:HGNC Symbol;Acc:HGNC:100])

HSP 1 Score: 54.6842 bits (130), Expect = 5.600e-7
Identity = 97/421 (23.04%), Postives = 166/421 (39.43%), Query Frame = 1
Query:  106 VKMSKTKLFCQISSIRGISKIHS-AKTKFERFLWT----GFVILMTCVLFVQMVFLIQDYLQYTTAWHTSTELDYPSP----FPAITLCAQNPF---SIDANRLWSKRKIMSPSELQDNLTIMSLNAFDDKNLDGLEYLRLYDLFSTFYMNL-PFLDTIKLGHS-KDMIRYCILIYKNDIIIAEKCDLKNEKFNIKLFSHQEYFNCYTI----EGLEQYTT----DVIGLILLVQIIPSEKIPELSNSFLVDILQRGEGLKVAVHQPQTYPDIENSGINMHPA-------KMNSLVYSPTKWIRMSTSKNPCRDKQKPINDLNRHFKYAFTQCVSAEIQRQIIKQCGCMLSNAPRPYPPNETIPYCIKLVSPTKAKLILERLSCVENIQSQSVEIRKTIQNDLCFLKCQFTTYETTMSLTR 1281
            V+    + F   S++ G++ I S  +   +R LW     G + ++ CV          + +QY   +H  T+LD  +     FPA+TLC  N F    +  N L+   ++++   L +   I      D+K L+ L+    +  F     N+  F D  + GH  +DM+  C   ++ ++  AE        F + +F+   Y  CYT     +G  +  T       GL +++ I   E +P    +   D      G+KV +H     P I+  G  + P        +   L+Y P  W    T K    D     +DL+    Y+ T C      R +++ C C + + P         PYC    +P + K       C +      VE  K  +  +C + C  T Y   +S+ +
Sbjct:   13 VQPVSIQAFASSSTLHGLAHIFSYERLSLKRALWALCFLGSLAVLLCV--------CTERVQYYFHYHHVTKLDEVAASQLTFPAVTLCNLNEFRFSQVSKNDLYHAGELLA--LLNNRYEIPDTQMADEKQLEILQDKANFRSFKPKPFNMREFYD--RAGHDIRDMLLSCH--FRGEVCSAED-------FKV-VFT--RYGKCYTFNSGRDGRPRLKTMKGGTGNGLEIMLDIQQDEYLPVWGET---DETSFEAGIKVQIHSQDEPPFIDQLGFGVAPGFQTFVACQEQRLIYLPPPW---GTCKAVTMD-----SDLDFFDSYSITACRIDCETRYLVENCNCRMVHMPG------DAPYC----TPEQYK------ECADPALDFLVE--KDQEYCVCEMPCNLTRYGKELSMVK 380          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Human
Match: SCNN1B (sodium channel epithelial 1 beta subunit [Source:HGNC Symbol;Acc:HGNC:10600])

HSP 1 Score: 51.2174 bits (121), Expect = 6.381e-6
Identity = 96/448 (21.43%), Postives = 167/448 (37.28%), Query Frame = 1
Query:  130 FCQISSIRGISKIHSAKTKFERFLWTGFVILMTCVLFVQMVFLIQDYLQYTTAWHTSTELDYP---SPFPAITLCAQNPFSI--------DANRLWSK--RKIMSPSELQDNLT-----------------------IMSLNAFDDKNLDGLEYLRLYD-------------LFSTFYMNLPFLDTIKLGH-SKDMIRYCILIYKNDIIIAEKCDLKNEKFNIKLFSHQEYFNCY------TIEGLEQYTTDV-IGLILLVQIIPSEKIPELSNSFLVDILQRGEGLKVAVHQPQTYPDIENSGINMHPAKMNSLVYSPTKWIRMSTSKNPC--RDKQKPINDLNRHFK--YAFTQCVSAEIQRQIIKQCGCMLSNAPRPYPPNETIPYCIKLVSPTKAKLILERLSCVENIQSQSVEIRKTIQNDLCFLKCQFTTYETTMSLTRWTA 1290
            +C  ++  G  +I     K ++ +W    +L   ++  Q    I+ YL    +W  S  L        FPA+T+C  +PF          D + L      +I++P     N T                        M L+ F D N +GL      +             L +  +  +P  + +++ +  + MI  C+         AE C+ +N  F    + H  Y NCY      T + L         GL L++ I   + +P L+++          G+++ +H+ ++YP I + GI        S+     K  RM    +PC     + P+ +    +   Y+   C+ +  Q  +I+ C C   +   P P  E   YC     P  A        C  ++Q  SV  R+T    +C   C  T Y+ T+S+  W +
Sbjct:   29 YCDNTNTHGPKRIICEGPK-KKAMWFLLTLLFAALVCWQWGIFIRTYL----SWEVSVSLSVGFKTMDFPAVTICNASPFKYSKIKHLLKDLDELMEAVLERILAPELSHANATRNLNFSIWNHTPLVLIDERNPHHPMVLDLFGD-NHNGLTSSSASEKICNAHGCKMAMRLATNIFAQVPQQELVEMSYPGEQMILACLFG-------AEPCNYRN--FTSIFYPH--YGNCYIFNWGMTEKALPSANPGTEFGLKLILDIGQEDYVPFLAST---------AGVRLMLHEQRSYPFIRDEGIYAMSGTETSIGVLVDKLQRMGEPYSPCTVNGSEVPVQNFYSDYNTTYSIQACLRSCFQDHMIRNCNC--GHYLYPLPRGEK--YCNNRDFPDWAH-------CYSDLQ-MSVAQRETCIG-MCKESCNDTQYKMTISMADWPS 437          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Celegans
Match: unc-8 (Degenerin unc-8 [Source:UniProtKB/Swiss-Prot;Acc:Q21974])

HSP 1 Score: 49.6766 bits (117), Expect = 7.508e-6
Identity = 72/347 (20.75%), Postives = 119/347 (34.29%), Query Frame = 1
Query:  643 NIKLFSHQEYFNCYT------IEGLEQYTTDVIGLILLVQIIPSEKIPELSNSFLVDILQRGEGLKVAVHQPQTYPDIENSGINMHPAKMNSLVYSPTKWIRMSTSKNPCRDKQKPINDL-NRHFKYAFTQCVSAEIQRQIIKQCGCMLSNAPRPYPPNETIPYCIKLVSPTKAKLILERLSCVENIQSQSVEIRKTIQNDLCFLKCQFTTYETTMSLTRWTAXXXXXXXXXXXYRSYFAYRHNSSSENIVKIKSIXXXXXXXXXXXXXQINKNQFNNLINYSRFDENAFTYISLMRRNFDIQWKTEKLVLDSNTLFSRMGGLTSICIGLTAAVFAEFIEFLYWIHK 1662
            + KL    EY NCYT      +E        + GL LL+ +  S+ +P               G+++ VH+    P  +  G +     ++S      +  R+S     C D  +P+  + N H  Y+   C     Q ++++ CGC     PR   P+E   +C        AK  ++R  C+ N+ S S       +   C   C    +ET  S + W +                 ++  +    +  I                      FN+    + +      YI +     + +   E        LFS  GG   + IG +   FAEF E    I K
Sbjct:  395 DFKLHVDPEYGNCYTFNFNDSVELKNSRAGPMYGLRLLLNVHQSDYMP----------TTEAAGVRLVVHEQDQEPFPDTFGYSAPTGFISSFGLKTKELHRLSAPWGNCSDTFRPVPYIYNEH--YSPEGCHRNCFQLKVLEICGC---GDPRFPLPSEEHRHC-------NAKSKIDR-QCLSNLTSDSGGYHHLHEQCECRQPCHEKVFETAYSASAWPSQN---------------FKIGTDCPAVSDI----------------------FNDTEACTEYYRQNTAYIEIYYEQLNFESLKETAGYTLVNLFSDFGGNIGLWIGFSVITFAEFAELFCEICK 681          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Celegans
Match: unc-8 (Degenerin unc-8 [Source:UniProtKB/Swiss-Prot;Acc:Q21974])

HSP 1 Score: 49.6766 bits (117), Expect = 8.043e-6
Identity = 72/347 (20.75%), Postives = 119/347 (34.29%), Query Frame = 1
Query:  643 NIKLFSHQEYFNCYT------IEGLEQYTTDVIGLILLVQIIPSEKIPELSNSFLVDILQRGEGLKVAVHQPQTYPDIENSGINMHPAKMNSLVYSPTKWIRMSTSKNPCRDKQKPINDL-NRHFKYAFTQCVSAEIQRQIIKQCGCMLSNAPRPYPPNETIPYCIKLVSPTKAKLILERLSCVENIQSQSVEIRKTIQNDLCFLKCQFTTYETTMSLTRWTAXXXXXXXXXXXYRSYFAYRHNSSSENIVKIKSIXXXXXXXXXXXXXQINKNQFNNLINYSRFDENAFTYISLMRRNFDIQWKTEKLVLDSNTLFSRMGGLTSICIGLTAAVFAEFIEFLYWIHK 1662
            + KL    EY NCYT      +E        + GL LL+ +  S+ +P               G+++ VH+    P  +  G +     ++S      +  R+S     C D  +P+  + N H  Y+   C     Q ++++ CGC     PR   P+E   +C        AK  ++R  C+ N+ S S       +   C   C    +ET  S + W +                 ++  +    +  I                      FN+    + +      YI +     + +   E        LFS  GG   + IG +   FAEF E    I K
Sbjct:  435 DFKLHVDPEYGNCYTFNFNDSVELKNSRAGPMYGLRLLLNVHQSDYMP----------TTEAAGVRLVVHEQDQEPFPDTFGYSAPTGFISSFGLKTKELHRLSAPWGNCSDTFRPVPYIYNEH--YSPEGCHRNCFQLKVLEICGC---GDPRFPLPSEEHRHC-------NAKSKIDR-QCLSNLTSDSGGYHHLHEQCECRQPCHEKVFETAYSASAWPSQN---------------FKIGTDCPAVSDI----------------------FNDTEACTEYYRQNTAYIEIYYEQLNFESLKETAGYTLVNLFSDFGGNIGLWIGFSVITFAEFAELFCEICK 721          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Celegans
Match: unc-8 (Degenerin unc-8 [Source:UniProtKB/Swiss-Prot;Acc:Q21974])

HSP 1 Score: 49.6766 bits (117), Expect = 8.046e-6
Identity = 72/347 (20.75%), Postives = 119/347 (34.29%), Query Frame = 1
Query:  643 NIKLFSHQEYFNCYT------IEGLEQYTTDVIGLILLVQIIPSEKIPELSNSFLVDILQRGEGLKVAVHQPQTYPDIENSGINMHPAKMNSLVYSPTKWIRMSTSKNPCRDKQKPINDL-NRHFKYAFTQCVSAEIQRQIIKQCGCMLSNAPRPYPPNETIPYCIKLVSPTKAKLILERLSCVENIQSQSVEIRKTIQNDLCFLKCQFTTYETTMSLTRWTAXXXXXXXXXXXYRSYFAYRHNSSSENIVKIKSIXXXXXXXXXXXXXQINKNQFNNLINYSRFDENAFTYISLMRRNFDIQWKTEKLVLDSNTLFSRMGGLTSICIGLTAAVFAEFIEFLYWIHK 1662
            + KL    EY NCYT      +E        + GL LL+ +  S+ +P               G+++ VH+    P  +  G +     ++S      +  R+S     C D  +P+  + N H  Y+   C     Q ++++ CGC     PR   P+E   +C        AK  ++R  C+ N+ S S       +   C   C    +ET  S + W +                 ++  +    +  I                      FN+    + +      YI +     + +   E        LFS  GG   + IG +   FAEF E    I K
Sbjct:  436 DFKLHVDPEYGNCYTFNFNDSVELKNSRAGPMYGLRLLLNVHQSDYMP----------TTEAAGVRLVVHEQDQEPFPDTFGYSAPTGFISSFGLKTKELHRLSAPWGNCSDTFRPVPYIYNEH--YSPEGCHRNCFQLKVLEICGC---GDPRFPLPSEEHRHC-------NAKSKIDR-QCLSNLTSDSGGYHHLHEQCECRQPCHEKVFETAYSASAWPSQN---------------FKIGTDCPAVSDI----------------------FNDTEACTEYYRQNTAYIEIYYEQLNFESLKETAGYTLVNLFSDFGGNIGLWIGFSVITFAEFAELFCEICK 722          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Celegans
Match: unc-8 (Degenerin unc-8 [Source:UniProtKB/Swiss-Prot;Acc:Q21974])

HSP 1 Score: 49.6766 bits (117), Expect = 9.457e-6
Identity = 72/347 (20.75%), Postives = 119/347 (34.29%), Query Frame = 1
Query:  643 NIKLFSHQEYFNCYT------IEGLEQYTTDVIGLILLVQIIPSEKIPELSNSFLVDILQRGEGLKVAVHQPQTYPDIENSGINMHPAKMNSLVYSPTKWIRMSTSKNPCRDKQKPINDL-NRHFKYAFTQCVSAEIQRQIIKQCGCMLSNAPRPYPPNETIPYCIKLVSPTKAKLILERLSCVENIQSQSVEIRKTIQNDLCFLKCQFTTYETTMSLTRWTAXXXXXXXXXXXYRSYFAYRHNSSSENIVKIKSIXXXXXXXXXXXXXQINKNQFNNLINYSRFDENAFTYISLMRRNFDIQWKTEKLVLDSNTLFSRMGGLTSICIGLTAAVFAEFIEFLYWIHK 1662
            + KL    EY NCYT      +E        + GL LL+ +  S+ +P               G+++ VH+    P  +  G +     ++S      +  R+S     C D  +P+  + N H  Y+   C     Q ++++ CGC     PR   P+E   +C        AK  ++R  C+ N+ S S       +   C   C    +ET  S + W +                 ++  +    +  I                      FN+    + +      YI +     + +   E        LFS  GG   + IG +   FAEF E    I K
Sbjct:  434 DFKLHVDPEYGNCYTFNFNDSVELKNSRAGPMYGLRLLLNVHQSDYMP----------TTEAAGVRLVVHEQDQEPFPDTFGYSAPTGFISSFGLKTKELHRLSAPWGNCSDTFRPVPYIYNEH--YSPEGCHRNCFQLKVLEICGC---GDPRFPLPSEEHRHC-------NAKSKIDR-QCLSNLTSDSGGYHHLHEQCECRQPCHEKVFETAYSASAWPSQN---------------FKIGTDCPAVSDI----------------------FNDTEACTEYYRQNTAYIEIYYEQLNFESLKETAGYTLVNLFSDFGGNIGLWIGFSVITFAEFAELFCEICK 720          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Xenopus
Match: cdh12 (cadherin 12, type 2 (N-cadherin 2) [Source:Xenbase;Acc:XB-GENE-982876])

HSP 1 Score: 63.5438 bits (153), Expect = 1.083e-9
Identity = 70/284 (24.65%), Postives = 108/284 (38.03%), Query Frame = 1
Query:  478 EYLRLYDLFSTFYMNLPFLDTIKLGHSKD-MIRYCILIYKNDIIIAEKCDLKNEKFNIKLFSHQEYFNCYTIEGLEQYTTDV-------IGLILLVQIIPSEKIPELSNSFLVDILQRGEGLKVAVHQPQTYPDIENSGINMHPAKMNSLVYSPTKWIRMSTSKNPCRDKQKPINDLNRHF-KYAFTQCVSAEIQRQIIKQCGCMLSNAPRP----YPPNETIPYCIKLVSPTKAKLILERLSCVENIQSQSVEIRKTIQNDLCFLKCQFTTYETTMSLTRWTA 1290
            E+ RL+  ++     +   D I +G+  D +I  C             CD +N      LF H  Y NCYT    E+    V        GL +++ I   E  P LS +          G K+ VH    YP IE+ G  +  A   S+    T+  ++S   + C      ++  N +  KY    C+++  QR++++ CGC   + P P    Y   E  P  I        + + E L C      QS           C   C F  +  T SL +W +
Sbjct:  231 EWYRLH--YTNVLAKISMEDKIAMGYKADELIVTCFFD-------GLSCDARN----FTLFHHPLYGNCYTFNSAERGNLLVSSMGGAEYGLKVVLYIDEDEYNPYLSTA---------AGAKILVHDQDEYPFIEDLGTELETATETSIGMQLTESTKLSDPYSDCTMDGSDVSVENLYSKKYTLQICLNSCFQREMVRTCGCAHYDQPLPNGAKYCNYEEYPSWIYCYFKLYKQFVQEELGC------QSA----------CRESCSFKEWTLTRSLAKWPS 476          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Xenopus
Match: cdh12 (cadherin 12, type 2 (N-cadherin 2) [Source:Xenbase;Acc:XB-GENE-982876])

HSP 1 Score: 63.1586 bits (152), Expect = 1.160e-9
Identity = 68/282 (24.11%), Postives = 105/282 (37.23%), Query Frame = 1
Query:  478 EYLRLYDLFSTFYMNLPFLDTIKLGHSKD-MIRYCILIYKNDIIIAEKCDLKNEKFNIKLFSHQEYFNCYTIEGLEQYTTDV-------IGLILLVQIIPSEKIPELSNSFLVDILQRGEGLKVAVHQPQTYPDIENSGINMHPAKMNSLVYSPTKWIRMSTSKNPCRDKQKPINDLNRHF-KYAFTQCVSAEIQRQIIKQCGCMLSNAPRP----YPPNETIPYCIKLVSPTKAKLILERLSCVENIQSQSVEIRKTIQNDLCFLKCQFTTYETTMSLTRW 1284
            E+ RL+  ++     +   D I +G+  D +I  C             CD +N      LF H  Y NCYT    E+    V        GL +++ I   E  P LS +          G K+ VH    YP IE+ G  +  A   S+    T+  ++S   + C      ++  N +  KY    C+++  QR++++ CGC   + P P    Y   E  P  I        + + E L C                   C   C F  +  T SL +W
Sbjct:  229 EWYRLH--YTNVLAKISMEDKIAMGYKADELIVTCFFD-------GLSCDARN----FTLFHHPLYGNCYTFNSAERGNLLVSSMGGAEYGLKVVLYIDEDEYNPYLSTA---------AGAKILVHDQDEYPFIEDLGTELETATETSIGMQLTESTKLSDPYSDCTMDGSDVSVENLYSKKYTLQICLNSCFQREMVRTCGCAHYDQPLPNGAKYCNYEEYPSWIYCYFKLYKQFVQEELGC----------------QSACRESCSFKEWTLTRSLAKW 472          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Xenopus
Match: cdh12 (cadherin 12, type 2 (N-cadherin 2) [Source:Xenbase;Acc:XB-GENE-982876])

HSP 1 Score: 63.1586 bits (152), Expect = 1.222e-9
Identity = 70/284 (24.65%), Postives = 108/284 (38.03%), Query Frame = 1
Query:  478 EYLRLYDLFSTFYMNLPFLDTIKLGHSKD-MIRYCILIYKNDIIIAEKCDLKNEKFNIKLFSHQEYFNCYTIEGLEQYTTDV-------IGLILLVQIIPSEKIPELSNSFLVDILQRGEGLKVAVHQPQTYPDIENSGINMHPAKMNSLVYSPTKWIRMSTSKNPCRDKQKPINDLNRHF-KYAFTQCVSAEIQRQIIKQCGCMLSNAPRP----YPPNETIPYCIKLVSPTKAKLILERLSCVENIQSQSVEIRKTIQNDLCFLKCQFTTYETTMSLTRWTA 1290
            E+ RL+  ++     +   D I +G+  D +I  C             CD +N      LF H  Y NCYT    E+    V        GL +++ I   E  P LS +          G K+ VH    YP IE+ G  +  A   S+    T+  ++S   + C      ++  N +  KY    C+++  QR++++ CGC   + P P    Y   E  P  I        + + E L C      QS           C   C F  +  T SL +W +
Sbjct:  239 EWYRLH--YTNVLAKISMEDKIAMGYKADELIVTCFFD-------GLSCDARN----FTLFHHPLYGNCYTFNSAERGNLLVSSMGGAEYGLKVVLYIDEDEYNPYLSTA---------AGAKILVHDQDEYPFIEDLGTELETATETSIGMQLTESTKLSDPYSDCTMDGSDVSVENLYSKKYTLQICLNSCFQREMVRTCGCAHYDQPLPNGAKYCNYEEYPSWIYCYFKLYKQFVQEELGC------QSA----------CRESCSFKEWTLTRSLAKWPS 484          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Xenopus
Match: cdh12 (cadherin 12, type 2 (N-cadherin 2) [Source:Xenbase;Acc:XB-GENE-982876])

HSP 1 Score: 63.1586 bits (152), Expect = 1.338e-9
Identity = 68/284 (23.94%), Postives = 106/284 (37.32%), Query Frame = 1
Query:  478 EYLRLYDLFSTFYMNLPFLDTIKLGHSKD-MIRYCILIYKNDIIIAEKCDLKNEKFNIKLFSHQEYFNCYTIEGLEQYTTDV-------IGLILLVQIIPSEKIPELSNSFLVDILQRGEGLKVAVHQPQTYPDIENSGINMHPAKMNSLVYSPTKWIRMSTSKNPCRDKQKPINDLNRHF-KYAFTQCVSAEIQRQIIKQCGCMLSNAPRP----YPPNETIPYCIKLVSPTKAKLILERLSCVENIQSQSVEIRKTIQNDLCFLKCQFTTYETTMSLTRWTA 1290
            E+ RL+  ++     +   D I +G+  D +I  C             CD +N      LF H  Y NCYT    E+    V        GL +++ I   E  P LS +          G K+ VH    YP IE+ G  +  A   S+    T+  ++S   + C      ++  N +  KY    C+++  QR++++ CGC   + P P    Y   E  P  I        + + E L C                   C   C F  +  T SL +W +
Sbjct:  229 EWYRLH--YTNVLAKISMEDKIAMGYKADELIVTCFFD-------GLSCDARN----FTLFHHPLYGNCYTFNSAERGNLLVSSMGGAEYGLKVVLYIDEDEYNPYLSTA---------AGAKILVHDQDEYPFIEDLGTELETATETSIGMQLTESTKLSDPYSDCTMDGSDVSVENLYSKKYTLQICLNSCFQREMVRTCGCAHYDQPLPNGAKYCNYEEYPSWIYCYFKLYKQFVQEELGC----------------QSACRESCSFKEWTLTRSLAKWPS 474          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Xenopus
Match: cdh12 (cadherin 12, type 2 (N-cadherin 2) [Source:Xenbase;Acc:XB-GENE-982876])

HSP 1 Score: 58.9214 bits (141), Expect = 2.409e-8
Identity = 61/244 (25.00%), Postives = 96/244 (39.34%), Query Frame = 1
Query:  478 EYLRLYDLFSTFYMNLPFLDTIKLGHSKD-MIRYCILIYKNDIIIAEKCDLKNEKFNIKLFSHQEYFNCYTIEGLEQYTTDV-------IGLILLVQIIPSEKIPELSNSFLVDILQRGEGLKVAVHQPQTYPDIENSGINMHPAKMNSLVYSPTKWIRMSTSKNPCRDKQKPINDLNRHF-KYAFTQCVSAEIQRQIIKQCGCMLSNAPRP----YPPNETIPYCIKLVSPTKAKLILERLSC 1170
            E+ RL+  ++     +   D I +G+  D +I  C             CD +N      LF H  Y NCYT    E+    V        GL +++ I   E  P LS +          G K+ VH    YP IE+ G  +  A   S+    T+  ++S   + C      ++  N +  KY    C+++  QR++++ CGC   + P P    Y   E  P  I        + + E L C
Sbjct:  229 EWYRLH--YTNVLAKISMEDKIAMGYKADELIVTCFFD-------GLSCDARN----FTLFHHPLYGNCYTFNSAERGNLLVSSMGGAEYGLKVVLYIDEDEYNPYLSTA---------AGAKILVHDQDEYPFIEDLGTELETATETSIGMQLTESTKLSDPYSDCTMDGSDVSVENLYSKKYTLQICLNSCFQREMVRTCGCAHYDQPLPNGAKYCNYEEYPSWIYCYFKLYKQFVQEELGC 450          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Mouse
Match: Scnn1g (sodium channel, nonvoltage-gated 1 gamma [Source:MGI Symbol;Acc:MGI:104695])

HSP 1 Score: 58.5362 bits (140), Expect = 2.322e-8
Identity = 64/234 (27.35%), Postives = 90/234 (38.46%), Query Frame = 1
Query:  619 CDLKNEKFNIKLFSHQEYFNCYTIEGLEQYT---TDVIGLILLVQIIPSEKIPELSNSFLVDILQRGEGLKVAVHQPQTYPDIENSGINMHPAKMNSLVYSPTKWIRMSTSKNPCRDKQKPINDLNRH-FKYAFTQCVSAEIQRQIIKQCGCMLSNAPRPYPPNETIPYCIKLVSPT--------KAKLILERLSCVENIQSQSVEIRKTIQNDLCFLKCQFTTYETTMSLTRW 1284
            CD +N      LF H  Y NCYT    E  T   T + G    +Q+I      E  N FLV       G KV VHQ   YP IE+ G  +  A   S+    T+  ++S   + C +    +   N +   Y+   C+ +  Q +++++CGC   + P P   N    YC     P             + E L C      QSV          C   C F  +  T SL +W
Sbjct:  273 CDARN----FTLFHHPMYGNCYTFNNRENATILSTSMGGSEYGLQVILYINEDEY-NPFLVS----STGAKVLVHQQNEYPFIEDVGTEIETAMSTSIGMHLTESFKLSEPYSQCTEDGSDVPVTNIYNAAYSLQICLYSCFQTKMVEKCGCAQYSQPLPPAAN----YCNYQQHPNWMYCYYQLYQAFVREELGC------QSV----------CKQSCSFKEWTLTTSLAQW 477          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. UniProt/SwissProt
Match: sp|Q25011|FANA_CORAP (FMRFamide-activated amiloride-sensitive sodium channel OS=Cornu aspersum OX=6535 PE=2 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 1.158e-15
Identity = 97/404 (24.01%), Postives = 167/404 (41.34%), Query Frame = 1
Query:  142 SSIRGISKIHSAKTKFERFLWTGFVILMTCVLFVQMVFLIQDYLQYTTAWHTSTELDYPSPFPAITLCAQNPFSIDANRLWSKRKIMSPSELQDNLTIMS-LNAFDDKNLDGLEYLRLYDLFSTFYMNLPFLDTIKLGHS-KDMIRYCILIYKNDIIIAEKCDLKNEKFNIKLFSHQEYFNCYTI---EGLEQYTTDVI-GLILLVQIIPSEKIPELSNSFLVD--ILQRGEGLKVAVHQPQTYPDIENSGINMHPAKMNSLVYSPTKWIRMSTSKNPCRDKQKPINDLNRHFKYAFTQCVSAEIQRQIIKQCGCMLSNAPRPYPPNETIPYCIK---------------LVSPTKAKLILERLSCVENIQSQSVEIRKTIQNDLCFLKCQFTTYETTMSLTRW 1284
            S+  G++KI +++    + +W   VI       +Q+  L++ YLQ+     +  +   P  +P++++C   P S     L + R++   +E Q+ +T +  +  F  +    +  +R       FY NL   D  KL H+ +DM+ +C           E C +     N   F    YFNC+T    + L+ + T    GL L+  +   + +P     +  D  IL    G++V VH P + P   + GI++ P   +S+        R+      C +    +N + + +KY F  C+    QR II++CGC  S  P     N T    IK                    +A +    L+C E  Q      R    +  CF  C  T+Y  ++SL+ W
Sbjct:   50 SNAHGLAKIVTSRDTKRKVIWALLVIAGFTAATLQLSLLVRKYLQFQVVELSEIKDSMPVQYPSVSICNIEPIS-----LRTIRRMYFNNESQNLITWLRFIQKFRFEQDSFMNSIR------AFYENLG-QDAKKLSHNLEDMLMHCRF-------NRELCHVS----NFSTFFDGNYFNCFTFNSGQRLQMHATGPENGLSLIFSVEKDDPLPGTYGVYNFDNNILHSA-GVRVVVHAPGSMPSPVDHGIDIPPGYSSSVGLKAILHTRLPYPYGNCTNDM--LNGI-KQYKYTFFACLQLCKQRLIIQRCGCKSSALPEVPSYNATFCGVIKDWQEINRNHSNEDHNQSEEDRAFIPTPYLACEEREQKNLNNDRTYELSCGCFQPCSETSYLKSVSLSYW 426          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. UniProt/SwissProt
Match: sp|H2QAR5|SCNNG_PANTR (Amiloride-sensitive sodium channel subunit gamma OS=Pan troglodytes OX=9598 GN=SCNN1G PE=3 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 3.927e-14
Identity = 92/409 (22.49%), Postives = 166/409 (40.59%), Query Frame = 1
Query:  124 KLFCQISSIRGISKIHSAKTKFERFLWTGFVILMTCVLFVQMVFLIQDYLQYTTAWHTS-TELDYPSPFPAITLCAQNPFSIDANRLWSKRKIMSPSELQDNLTIMSLNAFDD--KNLDGLEYLRLYDLFST-FYMNLPFL--DTIKLGHSKDM-------IRYCILIYKNDIIIAEKCDLKNEKFNIKLFSHQEYFNCYTIEGLEQYT---TDVIGLILLVQIIPSEKIPELSNSFLVDILQRGEGLKVAVHQPQTYPDIENSGINMHPAKMNSLVYSPTKWIRMSTSKNPCRDKQK--PINDLNRHFKYAFTQCVSAEIQRQIIKQCGCMLSNAPRPYPPNETIPYCIKLVSPTKAKLI--LERLSCVENIQSQSVEIRKTIQNDLCFLKCQFTTYETTMSLTRWTA 1290
            + +C  ++  G  +I  ++ +  R LW GF +    ++  Q   L+  +   + +      +LD    FPA+T+C  NP+        + R +++  E +    + SL  F +  K  +   +  + +     F   +P L  D  + G ++D        +   I+   ++++  E   +   + N  LF H  + NCYT    E  T   T + G    +Q+I      E  N FLV       G KV +H+   YP +E+ G  +  A + S+    T+  ++S   + C +     PI ++  +  Y+   C+ +  Q +++++CGC   + P P   N    YC     P        L R    E +  QSV          C   C F  +  T SL +W +
Sbjct:   30 RWYCLNTNTHGCRRIVVSRGRLRRLLWIGFTLTAVALILWQCALLVFSFYTVSVSIKVHFRKLD----FPAVTICNINPYKYS-----TVRHLLADLEQETREALKSLYGFPESRKRREAESWSSISEGKQPRFSHRIPLLIFDQDEKGKARDFFTGRKRKVGGSIIHKASNVMHIESKQVVGFQLNFTLFHHPMHGNCYTFNNRENETILSTSMGGSEYGLQVILYINEEEY-NPFLVS----STGAKVIIHRQDEYPFVEDVGTEIETAMVTSIGMHLTESFKLSEPYSQCTEDGSDVPIRNI-YNAAYSLQICLHSCFQTKMVEKCGCAQYSQPLPPAAN----YCNYQQHPNWMYCYYQLHRAFVQEELGCQSV----------CKEACSFKEWTLTTSLAQWPS 409          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. UniProt/SwissProt
Match: sp|O13263|SCNNH_XENLA (Amiloride-sensitive sodium channel subunit gamma-2 OS=Xenopus laevis OX=8355 GN=scnn1g-b PE=1 SV=1)

HSP 1 Score: 63.5438 bits (153), Expect = 4.739e-9
Identity = 70/282 (24.82%), Postives = 107/282 (37.94%), Query Frame = 1
Query:  478 EYLRLYDLFSTFYMNLPFLDTIKLGHSKD-MIRYCILIYKNDIIIAEKCDLKNEKFNIKLFSHQEYFNCYTIEGLEQYTTDV-------IGLILLVQIIPSEKIPELSNSFLVDILQRGEGLKVAVHQPQTYPDIENSGINMHPAKMNSLVYSPTKWIRMSTSKNPCRDKQKPINDLNRH-FKYAFTQCVSAEIQRQIIKQCGCMLSNAPRP----YPPNETIPYCIKLVSPTKAKLILERLSCVENIQSQSVEIRKTIQNDLCFLKCQFTTYETTMSLTRW 1284
            E+ RL+  ++     +   D I +G+  D +I  C+            CD +N      LF H  Y NCYT    E+    V        GL +++ I   E  P LS +          G K+ VH    YP IE+ G  +      S+    T+  ++S   + C      I+  N +  KY    C+++  QR++++ CGC   + P P    Y   E  P  I        + + E L C      QS           C   C F  +  T SL +W
Sbjct:  231 EWYRLH--YNNILAKISMEDKIAMGYKADELIVTCLFD-------GLSCDARN----FTLFHHPLYGNCYTFNSAERGNLLVSSMGGAEYGLKVVLYIDEDEYNPYLSTA---------AGAKILVHDQDEYPFIEDLGTELETGTETSIGMQLTESTKLSDPYSDCTIDGSDISVENLYNKKYTLQICLNSCFQREMVRSCGCAHYDQPLPNGAKYCNYEEYPNWIYCYVKLYKQFVQEELGC------QST----------CRESCSFKEWTLTRSLAKW 474          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. UniProt/SwissProt
Match: sp|P51171|SCNNG_XENLA (Amiloride-sensitive sodium channel subunit gamma OS=Xenopus laevis OX=8355 GN=scnn1g-a PE=1 SV=1)

HSP 1 Score: 63.5438 bits (153), Expect = 5.760e-9
Identity = 70/284 (24.65%), Postives = 108/284 (38.03%), Query Frame = 1
Query:  478 EYLRLYDLFSTFYMNLPFLDTIKLGHSKD-MIRYCILIYKNDIIIAEKCDLKNEKFNIKLFSHQEYFNCYTIEGLEQYTTDV-------IGLILLVQIIPSEKIPELSNSFLVDILQRGEGLKVAVHQPQTYPDIENSGINMHPAKMNSLVYSPTKWIRMSTSKNPCRDKQKPINDLNRH-FKYAFTQCVSAEIQRQIIKQCGCMLSNAPRP----YPPNETIPYCIKLVSPTKAKLILERLSCVENIQSQSVEIRKTIQNDLCFLKCQFTTYETTMSLTRWTA 1290
            E+ RL+  ++     +   D I +G+  D +I  C             CD +N      LF H  Y NCYT    E+    V        GL +++ I   E  P LS +          G K+ VH    YP IE  G  +  A   S+    T+  ++S   + C    + ++  N +  KY    C+++  QR++++ CGC   + P P    Y   E  P  I        + + E L C      QS           C   C F  +  T SL +W +
Sbjct:  231 EWYRLH--YTNILAKISMEDKIAMGYKADELIVTCFFD-------GLSCDARN----FTLFHHPLYGNCYTFNSAERGNLLVSSMGGAEYGLKVVLYIDEDEYNPYLSTA---------AGAKILVHDQDEYPFIEYLGTELETATETSIGMQLTESAKLSDPYSDCTMDGRDVSVENLYNKKYTLQICLNSCFQREMVRSCGCAHYDQPLPNGAKYCNYEEYPSWIYCYFKVYKQFVQEELGC------QSA----------CRESCSFKEWTLTRSLAKWPS 476          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. UniProt/SwissProt
Match: sp|P37091|SCNNG_RAT (Amiloride-sensitive sodium channel subunit gamma OS=Rattus norvegicus OX=10116 GN=Scnn1g PE=1 SV=2)

HSP 1 Score: 58.9214 bits (141), Expect = 1.497e-7
Identity = 63/234 (26.92%), Postives = 91/234 (38.89%), Query Frame = 1
Query:  619 CDLKNEKFNIKLFSHQEYFNCYTIEGLEQYT---TDVIGLILLVQIIPSEKIPELSNSFLVDILQRGEGLKVAVHQPQTYPDIENSGINMHPAKMNSLVYSPTKWIRMSTSKNPCRDKQKPINDLNRH-FKYAFTQCVSAEIQRQIIKQCGCMLSNAPRPYPPNETIPYCIKLVSPT--------KAKLILERLSCVENIQSQSVEIRKTIQNDLCFLKCQFTTYETTMSLTRW 1284
            CD +N      LF H  Y NCYT    E  T   T + G    +Q+I      E  N FLV       G KV +HQ   YP IE+ G+ +  A   S+    T+  ++S   + C +    +   N +   Y+   C+ +  Q +++++CGC   + P P   N    YC     P             + E L C      QSV          C   C F  +  T SL +W
Sbjct:  268 CDARN----FTLFHHPMYGNCYTFNNKENATILSTSMGGSEYGLQVILYINEDEY-NPFLVS----STGAKVLIHQQNEYPFIEDVGMEIETAMSTSIGMHLTESFKLSEPYSQCTEDGSDVPVTNIYNAAYSLQICLYSCFQTKMVEKCGCAQYSQPLPPAAN----YCNYQQHPNWMYCYYQLYQAFVREELGC------QSV----------CKQSCSFKEWTLTTSLAQW 472          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. TrEMBL
Match: A0A4E0RFC3 (FMRFamide-activated amiloride-sensitive sodium channel OS=Fasciola hepatica OX=6192 GN=D915_003846 PE=3 SV=1)

HSP 1 Score: 392.889 bits (1008), Expect = 1.342e-123
Identity = 216/529 (40.83%), Postives = 313/529 (59.17%), Query Frame = 1
Query:  115 SKTKLFCQISSIRGISKIHSAKTKFERFLWTGFVILMTCVLFVQMVFLIQDYLQYTTAWHTSTELDYPSPFPAITLCAQNPFSIDANRLWSKRKIMSPSELQDNLTIMSLNAFDDKNLDGLEYLRLYDLFSTFYMNLPFLDTIKLGHSKDMIRYCILIYKNDIIIAEKCDLKNEKFNI-KLFSHQEYFNCYTIE-GLEQYTTDVIGLILLVQIIPSEKIPELSNSFLVDILQRGEGLKVAVHQPQTYPDIENSGINMHPAKMNSLVYSPTKWIRMSTSKNPCRDKQKPINDLNRHFKYAFTQCVSAEIQRQIIKQCGCMLSNAPRP----YPPNETIPYCIKL----VSPTKAKLILERLSCVENIQSQSVEIR-KTIQNDLCFLKCQFTTYETTMSLTRWTAXXXXXXXXXXXYRSYFAYRHNSSSENIVKIKSIXXXXXXXXXXXXXQINKNQFNNLI-NYSRFDENAFTYISLMRRNFDIQWKTEKLVLDSNTLFSRMGGLTSICIGLTAAVFAEFIEFLYWIHKS 1665
            SK KLF +ISSIRG+ +I  A+T F R LW  FVI MTC+L V    LI DYLQYTT+WHT +  D  S FPAITLCA NPFS+ AN+LWS   ++SP++++ N+  +SL   +   ++    + L D F  +Y NL   D+ K+ H  ++I +CIL      ++AEKC+++N    + + FSH +YFNC TIE G  + T+D+  L+LL  ++PS KI +  ++F++D   RGEG+KV +H+  TYP IE  G N+ P +MN ++Y    W R+ST   PC+D Q PI+DL  ++ Y  +QC+    Q ++I++CGCM S  PRP    + P   +PYC  +         A ++ ERL+C      +   IR + I+  +C  +C+F TY+T +S+T W  + +KL +    YR    Y     +E I   K  L + L    +        Q+N  I +Y +F +  +TYISL+RR+FD   K EKLV D+  L SR+GGL S+CIGLT A F E IEF+Y +  S
Sbjct:   71 SKIKLFGEISSIRGVQRIFRAETPFIRTLWILFVISMTCLLTVSSFMLIVDYLQYTTSWHTRSLPDDKSEFPAITLCAHNPFSLKANKLWSTGHVISPNQVKSNMAAVSLEMLNQDKVEDSVIMALSDSFEFYYTNLSPEDSQKISHDFEIIPHCILYSPEHTVVAEKCEMENVTAMVRRTFSHPKYFNCLTIEGGGNESTSDISRLVLLAHLVPSSKIVQARSAFIMDTFTRGEGIKVVIHERNTYPQIERYGFNVQPNRMNEIIYETLSWKRLSTPVAPCKDSQPPISDLGVNYTYETSQCLDIATQEEMIRRCGCMNSEWPRPTRAVHGPR-LVPYCTSMDRNSSVEVTATVLSERLACSRIFFEELPVIRERIIRAGICIPRCRFFTYDTKLSVTSWEPSPVKLSSYTANYRIVEEYL----TEPIESKKKELSSFLQSIIDPTLDSADEQWNKRIGDYKQFGDGTYTYISLIRRDFDTTLKEEKLVFDAPILLSRIGGLCSLCIGLTMAFFIEIIEFIYAVFHS 594          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. TrEMBL
Match: A0A4Z2DAR5 (FMRFamide-activated amiloride-sensitive sodium channel (Fragment) OS=Schistosoma japonicum OX=6182 GN=EWB00_002806 PE=3 SV=1)

HSP 1 Score: 378.637 bits (971), Expect = 4.561e-118
Identity = 211/541 (39.00%), Postives = 311/541 (57.49%), Query Frame = 1
Query:   85 SFTSKNVVKMSKTKLFCQISSIRGISKIHSAKTKFERFLWTGFVILMTCVLFVQMVFLIQDYLQYTTAWHTSTELDYPSPFPAITLCAQNPFSIDANRLWSKRKIMSPSELQDNLTIMSLNAFDDKNLDGLEYLRLYDLFSTFYMNLPFLDTIKLGHSKDMIRYCILIYKNDIIIAEKCDLKNE-KFNIKLFSHQEYFNCYTIEGLEQYTT-DVIGLILLVQIIPSEKIPELSNSFLVDILQRGEGLKVAVHQPQTYPDIENSGINMHPAKMNSLVYSPTKWIRMSTSKNPCRDKQKPINDLNRHFKYAFTQCVSAEIQRQIIKQCGCMLSNAPRP---YPPNETIPYCIKLVSPTK------AKLILERLSCVENIQSQSVEIR-KTIQNDLCFLKCQFTTYETTMSLTRWTAXXXXXXXXXXXYRSYFAYRHNSSSENIVKIKSIXXXXXXXXXXXXXQINKNQFNNL-----INYSRFDENAFTYISLMRRNFDIQWKTEKLVLDSNTLFSRMGGLTSICIGLTAAVFAEFIEFLYWI 1656
            S++ +   +  K +LFC +SSIRG+ +I+S++  F R LW  FVI MTCVL V   FLI DYL+Y+TAW+T + LD  S FPAITLCA NPFS+  NRLW +  + SP E++  L  + +   D+   D    L   D    +Y NL   DTIK+GH KDM+ +C+L  +   ++AEKCDL+ E    I+ F+H +YFNC+TIE     +T DV  LI+L Q+IP +KI   + SF++D   RGEG+KV +H+  TYP+IE  G+N+ P +MN + Y    W R+ T   PC D+   I DL  ++ Y  +QC++  +Q ++  +CGC+ S  PR        +++PYC KL  PT       A+ +  RL C  ++ +   +++ K +Q  +C  +C + TY+T +S+T W  +  KL      YR    + +  +       K I     N   ++    +KNQ  ++      +Y RFD+   TYISL+R++FD   K E+LV D   L SR+GGL S+CIGLT A   E +EFLY +
Sbjct:   50 SYSIQENKRKGKLELFCVLSSIRGVQRIYSSEIPFIRLLWIIFVITMTCVLMVSSGFLISDYLRYSTAWNTRSLLDDKSEFPAITLCAHNPFSLAVNRLWKENIVPSPREIKSRLRQLLMTMLDNGITDYTGDLAFSDSIEFYYTNLNSEDTIKVGHDKDMLYHCMLYEEGSTVVAEKCDLEPETSIRIRRFTHPKYFNCWTIESKPNASTADVTRLIILAQLIPLKKIEGANTSFIMDSFTRGEGIKVVIHEKGTYPEIEKHGVNIQPGRMNEINYETLFWKRLHTPVAPCTDENISIEDLGVYYTYKQSQCLNRMLQNELFTRCGCLNSEWPRSIKLLDHQKSLPYCQKL--PTNVNDLHGAEQMKTRLDCFGSVLADLKQLKEKAVQQRVCIPRCGYYTYDTKLSVTSWDPDPYKLALYTKGYRHVDKFLNEPNQR-----KHIDELLENFDASIDVMKSKNQLTSISTLFSSDYQRFDDGTHTYISLIRQDFDTTLKEERLVFDIYILISRIGGLCSLCIGLTMAFIVELVEFLYLL 583          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. TrEMBL
Match: A0A183NDT0 (Uncharacterized protein OS=Schistosoma mattheei OX=31246 GN=SMTD_LOCUS266 PE=3 SV=1)

HSP 1 Score: 372.089 bits (954), Expect = 1.636e-114
Identity = 205/529 (38.75%), Postives = 306/529 (57.84%), Query Frame = 1
Query:  115 SKTKLFCQISSIRGISKIHSAKTKFERFLWTGFVILMTCVLFVQMVFLIQDYLQYTTAWHTSTELDYPSPFPAITLCAQNPFSIDANRLWSKRKIMSPSELQDNLTIMSLNAFDDKNLDGLEYLRLYDLFSTFYMNLPFLDTIKLGHSKDMIRYCILIYKNDIIIAEKCDLKNE-KFNIKLFSHQEYFNCYTIEGLEQY-TTDVIGLILLVQIIPSEKIPELSNSFLVDILQRGEGLKVAVHQPQTYPDIENSGINMHPAKMNSLVYSPTKWIRMSTSKNPCRDKQKPINDLNRHFKYAFTQCVSAEIQRQIIKQCGCMLSNAPRP---YPPNETIPYCIKLV----SPTKAKLILERLSCVENIQSQSVEIR-KTIQNDLCFLKCQFTTYETTMSLTRWTAXXXXXXXXXXXYRSYFAYRHNSSSENIVKIKSIXXXXXXXXXXXXXQINKNQFNNLI-----NYSRFDENAFTYISLMRRNFDIQWKTEKLVLDSNTLFSRMGGLTSICIGLTAAVFAEFIEFLYWI 1656
             K +LFC +SSIRG+ +I+S++  F R LW  FVI+MTCVL V   FLI DYL Y+TAW+T + LD  S FPAITLCA NPFS++ N LW +  + SP E++  L  + +   D+   D    L   D    +Y NL   DTIK+GH KDM+ +C+L  +   ++AEKCDL+ E    I+ F+H +YFNC+TI+G     T+DV  LI+L  +IP +KI   + SF++D   RGEG+KV +H+  TYP+IE  G+N+ P +MN + Y    W R+ T   PC ++   I DL  ++ Y  +QC++  +Q ++  +CGC+ S  PR       ++++PYC KL     +   A+ +  RL C   + +   +++ K +Q  +C  +C + TY+T +S+T W  +  KL      YR    + +  +       K I     N   ++    NKNQ +++      +Y RFD+   TYISL+R++FD   K E+LV D   L SR+GGL S+CIGLT A   E +EF+Y +
Sbjct:   59 GKLELFCVLSSIRGVQRIYSSQIPFIRILWILFVIIMTCVLMVSSGFLISDYLCYSTAWNTRSLLDDKSEFPAITLCAHNPFSLNVNSLWKENIVPSPREIKSRLRELLVTMLDNGITDYTGDLAFSDSIEFYYTNLNLNDTIKVGHDKDMLYHCMLYEEGSTVVAEKCDLEPETSIRIRRFTHPKYFNCWTIDGKPNASTSDVTRLIILAHLIPLKKIEGANTSFIMDSFTRGEGIKVVIHEKGTYPEIEKHGVNIQPGRMNEINYETIFWKRLHTPVAPCTNENISIEDLGIYYTYKQSQCLNRMLQNELFTRCGCLNSEWPRSIKLLDQHKSLPYCQKLPINVNNIHGAEEMKTRLDCFGTVLTDLKQLKEKAVQKGVCIPRCGYYTYDTKLSVTSWDPDPYKLALYTKGYRHVDKFLNEPNQR-----KHIDELLENFDASIDPIKNKNQLHSIRTLFSNDYQRFDDGTHTYISLIRQDFDTIMKEERLVFDIYILISRIGGLCSLCIGLTMAFIVELVEFVYLL 582          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. TrEMBL
Match: A0A095BVN9 (FMRFamide-activated amiloride-sensitive sodium channel OS=Schistosoma haematobium OX=6185 GN=MS3_01206 PE=3 SV=1)

HSP 1 Score: 370.933 bits (951), Expect = 4.480e-114
Identity = 204/529 (38.56%), Postives = 306/529 (57.84%), Query Frame = 1
Query:  115 SKTKLFCQISSIRGISKIHSAKTKFERFLWTGFVILMTCVLFVQMVFLIQDYLQYTTAWHTSTELDYPSPFPAITLCAQNPFSIDANRLWSKRKIMSPSELQDNLTIMSLNAFDDKNLDGLEYLRLYDLFSTFYMNLPFLDTIKLGHSKDMIRYCILIYKNDIIIAEKCDLKNE-KFNIKLFSHQEYFNCYTIEGLEQY-TTDVIGLILLVQIIPSEKIPELSNSFLVDILQRGEGLKVAVHQPQTYPDIENSGINMHPAKMNSLVYSPTKWIRMSTSKNPCRDKQKPINDLNRHFKYAFTQCVSAEIQRQIIKQCGCMLSNAPRP---YPPNETIPYCIKLV----SPTKAKLILERLSCVENIQSQSVEIR-KTIQNDLCFLKCQFTTYETTMSLTRWTAXXXXXXXXXXXYRSYFAYRHNSSSENIVKIKSIXXXXXXXXXXXXXQINKNQFNNLI-----NYSRFDENAFTYISLMRRNFDIQWKTEKLVLDSNTLFSRMGGLTSICIGLTAAVFAEFIEFLYWI 1656
             K +LFC +SSIRG+ +I+S++  F R LW  FVI+MTCVL V   FLI DYL Y+TAW+T + LD  S FPAITLCA NPFS++ N LW +  + SP +++  L  + +   D+   D    L   D    +Y NL   DTIK+GH KDM+ +C+L  +   ++AEKCDL+ E    I+ F+H +YFNC+TI+G     T+DV  LI+L  +IP +KI   + SF++D   RGEG+KV +H+  TYP+IE  G+N+ P +MN + Y    W R+ T   PC ++   I DL  ++ Y  +QC++  +Q ++  +CGC+ S  PR       ++++PYC KL     +   A+ +  RL C   + +   +++ K +Q  +C  +C + TY+T +S+T W  +  KL      YR    + +  +       K I     N   ++    NKNQ +++      +Y RFD+   TYISL+R++FD   K E+LV D   L SR+GGL S+CIGLT A   E +EF+Y +
Sbjct:   59 GKLELFCVLSSIRGVQRIYSSQIPFIRILWILFVIIMTCVLMVSSGFLISDYLCYSTAWNTRSLLDDKSEFPAITLCAHNPFSLNVNSLWKENIVPSPRQIKSRLRQLLVTMLDNGITDYTGDLAFSDSIEFYYTNLNLNDTIKVGHDKDMLYHCMLYEEGSTVVAEKCDLEPETSIRIRRFTHPKYFNCWTIDGKPNASTSDVTRLIILAHLIPLKKIEGANTSFIMDSFTRGEGIKVVIHEKGTYPEIEKHGVNIQPGRMNEINYETIFWKRLHTPVAPCTNENISIEDLGIYYTYKQSQCLNRMLQNELFTRCGCLNSEWPRSIKLLDQHKSLPYCQKLPINVNNIHGAEEMKTRLDCFGTVLTDLKQLKEKAVQKGVCIPRCGYYTYDTKLSVTSWDPDPYKLALYTKGYRHVDKFLNEPNQR-----KHIDELLENFDASIDPIKNKNQLHSIRTLFSNDYQRFDDGTHTYISLIRQDFDTIMKEERLVFDIYILISRIGGLCSLCIGLTMAFIVELVEFVYLL 582          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. TrEMBL
Match: A0A430QBJ6 (Uncharacterized protein OS=Schistosoma bovis OX=6184 GN=DC041_0009852 PE=3 SV=1)

HSP 1 Score: 370.933 bits (951), Expect = 6.108e-114
Identity = 204/529 (38.56%), Postives = 306/529 (57.84%), Query Frame = 1
Query:  115 SKTKLFCQISSIRGISKIHSAKTKFERFLWTGFVILMTCVLFVQMVFLIQDYLQYTTAWHTSTELDYPSPFPAITLCAQNPFSIDANRLWSKRKIMSPSELQDNLTIMSLNAFDDKNLDGLEYLRLYDLFSTFYMNLPFLDTIKLGHSKDMIRYCILIYKNDIIIAEKCDLKNE-KFNIKLFSHQEYFNCYTIEGLEQY-TTDVIGLILLVQIIPSEKIPELSNSFLVDILQRGEGLKVAVHQPQTYPDIENSGINMHPAKMNSLVYSPTKWIRMSTSKNPCRDKQKPINDLNRHFKYAFTQCVSAEIQRQIIKQCGCMLSNAPRP---YPPNETIPYCIKLV----SPTKAKLILERLSCVENIQSQSVEIR-KTIQNDLCFLKCQFTTYETTMSLTRWTAXXXXXXXXXXXYRSYFAYRHNSSSENIVKIKSIXXXXXXXXXXXXXQINKNQFNNLI-----NYSRFDENAFTYISLMRRNFDIQWKTEKLVLDSNTLFSRMGGLTSICIGLTAAVFAEFIEFLYWI 1656
             K +LFC +SSIRG+ +I+S++  F R LW  FVI+MTCVL V   FLI DYL Y+TAW+T + LD  S FPAITLCA NPFS++ N LW +  + SP +++  L  + +   D+   D    L   D    +Y NL   DTIK+GH KDM+ +C+L  +   ++AEKCDL+ E    I+ F+H +YFNC+TI+G     T+DV  LI+L  +IP +KI   + SF++D   RGEG+KV +H+  TYP+IE  G+N+ P +MN + Y    W R+ T   PC ++   I DL  ++ Y  +QC++  +Q ++  +CGC+ S  PR       ++++PYC KL     +   A+ +  RL C   + +   +++ K +Q  +C  +C + TY+T +S+T W  +  KL      YR    + +  +       K I     N   ++    NKNQ +++      +Y RFD+   TYISL+R++FD   K E+LV D   L SR+GGL S+CIGLT A   E +EF+Y +
Sbjct:   59 GKLELFCVLSSIRGVQRIYSSQIPFIRILWILFVIIMTCVLMVSSGFLISDYLCYSTAWNTRSLLDDKSEFPAITLCAHNPFSLNVNSLWKENIVPSPRQIKSRLRQLLVTMLDNGITDYTGDLAFSDSIEFYYTNLNLNDTIKVGHDKDMLYHCMLYEEGSTVVAEKCDLEPETSIRIRRFTHPKYFNCWTIDGKPNASTSDVTRLIILAHLIPLKKIEGANTSFIMDSFTRGEGIKVVIHEKGTYPEIEKHGVNIQPGRMNEINYETIFWKRLHTPVAPCTNENISIEDLGIYYTYKQSQCLNRMLQNELFTRCGCLNSEWPRSIKLLDQHKSLPYCQKLPINVNNIHGAEEMKTRLDCFGTVLTDLKQLKEKAVQKGVCIPRCGYYTYDTKLSVTSWDPDPYKLALYTKGYRHVDKFLNEPNQR-----KHIDELLENFDASIDPIKNKNQLHSIRTLFSNDYQRFDDGTHTYISLIRQDFDTIMKEERLVFDIYILISRIGGLCSLCIGLTMAFIVELVEFVYLL 582          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Sea Lamprey
Match: SCNN1G (sodium channel epithelial 1 gamma subunit [Source:HGNC Symbol;Acc:HGNC:10602])

HSP 1 Score: 48.9062 bits (115), Expect = 4.236e-6
Identity = 71/299 (23.75%), Postives = 111/299 (37.12%), Query Frame = 1
Query:  445 NAFDDKNLDGLEYLRLYDLFSTFYMNLPFLDTIKLGHSKD-MIRYCILIYKNDIIIAEKCDLKNEKFNIKLFSHQEYFNCYTI-EGLEQYTTDVI------GLILLVQIIPSEKIPELSNSFLVDILQRGEGLKVAVHQPQTYPDIENSGINMHPAKMNSLVYSPTKWIRMSTSKNPCRDKQKPINDLNRHFK--YAFTQCVSAEIQRQIIKQCGCMLSNAPRP-------YPPNETIPYCIKLVSPTKAKLILERLSCVENIQSQSVEIRKTIQNDLCFLKCQFTTYETTMSLTRWTA 1290
            NAF       +++ RL+  F      +P  D  KLG+S D  I  C+            CD      + K   H    NC+T  +G +  + D+       GL +++       +P L+          G G K+ +H   T P IE  GI++ PA  +SL        ++    + C      I D+   +   Y+   C ++  Q ++IK CGC     P P       Y  N    YC   +     K   E L C++                +C   C  T +E T+SL  W +
Sbjct:  210 NAFTSAIDAVIQWYRLH--FINIMAIVPEKDKDKLGYSADEFIIDCLFS-------GTVCDPST---SFKKLQHPILGNCFTFNDGSDGKSLDIASAGIDYGLHMVLNTRQDNSLPYLA---------MGAGAKIGIHLQNTTPFIEAVGIDIPPAMESSLGLRVNDVQKLGDPYSDCTMDGSDI-DVKSLYDSPYSVQTCQNSCFQWEMIKSCGCANYEQPLPEGSRFCNYDNNPGWEYCYYRLYDMYIK---EELKCIQ----------------VCRQICSETEHEVTLSLADWPS 467          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Nematostella
Match: EDO42137 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2F2])

HSP 1 Score: 59.3066 bits (142), Expect = 4.011e-9
Identity = 88/432 (20.37%), Postives = 160/432 (37.04%), Query Frame = 1
Query:   79 MKSFTSKNVVKMSKTKLFCQISSIRGISKIHSAKTKFERFLWTGFVILMTCVLFVQMVFLIQDYLQYTTAWHTSTELDYPSP--FPAITLCAQNPFSIDANRLWSKRK------IMSPSELQDNLTIMSLNAFDDKNLDGLEYLRLYDLFSTFYMNLPFLDTIKLGHS-KDMIRYCILIYKNDIIIAEKCDLKNEKFNIKLFSHQEYFNCYTIEGLEQYTTDVIGLILLVQIIPSEKIPELSNSFLVDI-LQRGE---------GLKVAVHQPQTYPDIENSGINMHPAKMNSLVYSPTKWIRMSTSKNPCRDKQKPINDLNRHFKYAFT----QCVSAEIQRQIIKQCGCMLSNAPRPYPPNETIPYCIKLVSP-----TKAKLILERLSCVENIQSQSVEIRKTIQNDLCFLKCQFTTYETTMSLTRWTA 1290
            M+  T      + +   F Q ++  G  ++ +      R  W  F +   CV   Q+V L+  Y   +    T T+L +     FP +T+C  N   + A+RL  K +      I + ++     +  S NAF D      E  + +++      +  + + +   H  +D++  C     N +      D     +  + + +  + NCY    ++ +  + + L        S  +P  SN   + + L++ E         G+KV +      P     GI + P +   +  +  +  R+   KN   +    ++D N  F Y  T     C  + +  + I++CGC   N P     N  IP C +L S       KA    E  SC                +  C   C   +++ T+S  RW A
Sbjct:    1 MRRNTDPKETALEQINQFLQETTAHGFGRLGATAGSKWRLYWVMFCLAAYCVFVWQLVGLVNQY--NSKPIKTRTQLKHAQKLDFPVVTICNMN--VLRASRLPPKLRTKFDQIINNTNKTSPRNSSNSRNAFVDPQDLSFEETKKFEILHAVTAHDDYRELVSAAHQLEDILLSCNF---NGVNCRNSKDPTIPTYWTQTW-NDNFGNCYMFNSVKTHNGEKVDLY-------SSSVPGESNGLTLQLNLEQNEYLEGITEVAGMKVTISDQGVLPFPGQQGIRIMPGQSTGIQMTKLQTRRIDPFKNRSCESSNEMSDKNLFFGYNMTYSIMACKYSCLNARKIERCGCTNYNTPEMQKRN--IPLCNRLNSTIIDCLNKAYDTFEDGSC----------------DRECPPSCSEVSFDLTVSSARWPA 399          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Nematostella
Match: EDO30893 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZH4])

HSP 1 Score: 48.1358 bits (113), Expect = 6.039e-6
Identity = 43/156 (27.56%), Postives = 62/156 (39.74%), Query Frame = 1
Query:  814 GLKVAVHQPQTYPDIENSGINMHPAKMNSLVYSPTKWIRMSTSKNPCRDK-QKPINDLNRHFK--YAFTQCVSAEIQRQIIKQCGCMLSNAPRPYPPNETIPYCIKLVSPTKAKLILERLSCVENIQSQSVEIRKTIQNDLCFLKCQFTTYETTMS 1272
            G KV VH  + YP +E +G  + P    +  +  TK  +      P   K  + I D NR+F   Y+ + C    +    IK+CGC      +P  P     YC K +    A  IL  L   E  +              C + C +T YET +S
Sbjct:   49 GFKVLVHDRKEYPIMEQTGFALQPG---THTFCSTKLKKYKNLPTPYNTKCGENITDFNRYFSVNYSMSTCGKQCLHDYGIKKCGC------QPIYPITMKLYCQKRIVFKNAPKILIFLFAAECFKK------------YCPVPCDYTKYETKLS 183          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Planmine SMEST
Match: SMESG000081715.1 (SMESG000081715.1)

HSP 1 Score: 1205.66 bits (3118), Expect = 0.000e+0
Identity = 607/609 (99.67%), Postives = 608/609 (99.84%), Query Frame = 1
Query:  112 MSKTKLFCQISSIRGISKIHSAKTKFERFLWTGFVILMTCVLFVQMVFLIQDYLQYTTAWHTSTELDYPSPFPAITLCAQNPFSIDANRLWSKRKIMSPSELQDNLTIMSLNAFDDKNLDGLEYLRLYDLFSTFYMNLPFLDTIKLGHSKDMIRYCILIYKNDIIIAEKCDLKNEKFNIKLFSHQEYFNCYTIEGLEQYTTDVIGLILLVQIIPSEKIPELSNSFLVDILQRGEGLKVAVHQPQTYPDIENSGINMHPAKMNSLVYSPTKWIRMSTSKNPCRDKQKPINDLNRHFKYAFTQCVSAEIQRQIIKQCGCMLSNAPRPYPPNETIPYCIKLVSPTKAKLILERLSCVENIQSQSVEIRKTIQNDLCFLKCQFTTYETTMSLTRWTAXXXXXXXXXXXYRSYFAYRHNSSSENIVKIKSIXXXXXXXXXXXXXQINKNQFNNLINYSRFDENAFTYISLMRRNFDIQWKTEKLVLDSNTLFSRMGGLTSICIGLTAAVFAEFIEFLYWIHKSPFTNKTDSDSNHVRKEVYFQSQRLIGFPVEENMFDFDRNEKANNIFMEHSSSERCPSSFNDVNEELNDLSVNSDSGRSAMIQKDRQYGIYN 1938
            MSKTKLFCQISSIRGISKIHSAKTKFERFLWTGFVILMTCVLFVQMVFLIQDYLQYTTAWHTSTELDYPSPFPAITLCAQNPFSIDANRLWSKRKIMSPSELQDNLTIMSLNAFDDKNLDGLEYLRLYDLFSTFYMNLPFLDTIKLGHSKDMIRYCILIYKNDIIIAEKCDLKNEKFNIKLFSHQEYFNCYTIEGLEQYTTDVIGLILLVQIIPSEKIPELSNSFLVDILQRGEGLKVAVHQPQTYPDIENSGINMHPAKMNSLVYSPTKWIRMSTSKNPCRDKQKPINDLNRHFKYAFTQCVSAEIQRQIIKQCGCMLSNAPRPYPPNETIPYCIKLVSPTKAKLILERLSCVENIQSQSVEIRKTIQNDLCFLKCQFTTYETTMSLTRWTANELKLKNLENLYRSYFAYRHNSSSENIVKIKSILLNSLNRSHNLRHQINKNQFNNLINYSRFDENAFTYISLMRRNFDIQWKTEKLVLDSNTLFSRMGGLTSICIGLTAAVFAEFIEFLYWIH+SPFTNKTDSDSNHVRKEVYFQSQRLIGFPVEENMFDFDRNEKANNIFME SSSERCPSSFNDVNEELNDLSVNSDSGRSAMIQKDRQYGIYN
Sbjct:    1 MSKTKLFCQISSIRGISKIHSAKTKFERFLWTGFVILMTCVLFVQMVFLIQDYLQYTTAWHTSTELDYPSPFPAITLCAQNPFSIDANRLWSKRKIMSPSELQDNLTIMSLNAFDDKNLDGLEYLRLYDLFSTFYMNLPFLDTIKLGHSKDMIRYCILIYKNDIIIAEKCDLKNEKFNIKLFSHQEYFNCYTIEGLEQYTTDVIGLILLVQIIPSEKIPELSNSFLVDILQRGEGLKVAVHQPQTYPDIENSGINMHPAKMNSLVYSPTKWIRMSTSKNPCRDKQKPINDLNRHFKYAFTQCVSAEIQRQIIKQCGCMLSNAPRPYPPNETIPYCIKLVSPTKAKLILERLSCVENIQSQSVEIRKTIQNDLCFLKCQFTTYETTMSLTRWTANELKLKNLENLYRSYFAYRHNSSSENIVKIKSILLNSLNRSHNLRHQINKNQFNNLINYSRFDENAFTYISLMRRNFDIQWKTEKLVLDSNTLFSRMGGLTSICIGLTAAVFAEFIEFLYWIHRSPFTNKTDSDSNHVRKEVYFQSQRLIGFPVEENMFDFDRNEKANNIFMERSSSERCPSSFNDVNEELNDLSVNSDSGRSAMIQKDRQYGIYN 609          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Planmine SMEST
Match: SMESG000035185.1 (SMESG000035185.1)

HSP 1 Score: 550.051 bits (1416), Expect = 0.000e+0
Identity = 272/534 (50.94%), Postives = 381/534 (71.35%), Query Frame = 1
Query:  115 SKTKLFCQISSIRGISKIHSAKTKFERFLWTGFVILMTCVLFVQMVFLIQDYLQYTTAWHTSTELDYPSPFPAITLCAQNPFSIDANRLWSKRKIMSPSELQDNLTIMSLNAFDDKNLDGLEYLRLYDLFSTFYMNLPFLDTIKLGHSKDMIRYCILIYKNDIIIAEKCDLKNEKFNIKLFSHQEYFNCYTIEGLEQYTTDVIGLILLVQIIPSEKIPELSNSFLVDILQRGEGLKVAVHQPQTYPDIENSGINMHPAKMNSLVYSPTKWIRMSTSKNPCRDKQKPINDLNRHFKYAFTQCVSAEIQRQIIKQCGCMLSNAPRPYPPNETIPYCIKLVSPTKAKLILERLSCVENIQSQSVEIRKTIQNDLCFLKCQFTTYETTMSLTRWTAXXXXXXXXXXXYRSYFAYRHNSSSENIVKIKSIXXXXXXXXXXXXXQINKNQFNNL-INYSRFDENAFTYISLMRRNFDIQWKTEKLVLDSNTLFSRMGGLTSICIGLTAAVFAEFIEFLYWIHKSPFTNKTDSDSNHVRKE 1713
            SKTKLF Q  SIRG+SKIH AK++FE+ LW  FVI+MT +L + M+FL+++YLQY T WHTST+ +  + FP IT CAQNPFS  +N +W + +I+SP+++QD LT++SLNA ++ N   L YLRLYDLFSTFYMNL   +++K+GHS+D+IRYCI++  +DI +AE C     +  I LFSHQ++FNCYTIEG ++YT  ++GLI ++ I+PS++I ELS SFL+D+L RG+G+K+ +H+P   PDI+NSG N+HP+KMNS+VYS T W R+ T K  C D Q  + DL R FKY    C+ ++ Q ++I +C CMLSN PRP+ PN + PYC+KL     ++++ +R SCVE +Q      R+ I+N  C L+C+++TYETTMSLT+W A+E KL++L+ LYRSYF+ +   S ENI  + +IL +SL  + + R  + K  F+ L  +  R   N  TY+S+ R+NF+I  K EKLVLDSNTL SRMGGL+S+CIGLTAA  AE IEF+Y I K    NK+    + +R++
Sbjct:   10 SKTKLFFQTFSIRGVSKIHHAKSQFEKTLWISFVIIMTFILILTMIFLVKNYLQYITTWHTSTKFEDQAAFPGITFCAQNPFSKKSNEIWMRNQILSPTQMQDKLTLLSLNALENLNNSLLSYLRLYDLFSTFYMNLSPNESVKVGHSRDIIRYCIIMKGHDIDVAENCQDSISQLKISLFSHQDFFNCYTIEGEQEYTKSIVGLIFILDIVPSDEIYELSKSFLIDMLNRGDGMKIVIHEPHNLPDIDNSGFNLHPSKMNSIVYSQTDWYRLRTPKVNCHDNQPNLYDLGRSFKYTHKHCMESQFQTEVINKCQCMLSNHPRPFLPNSSFPYCLKLNYTNNSEILDKRFSCVEKVQEHFSLNREIIENQFCSLRCRYSTYETTMSLTQWKASEQKLEHLQKLYRSYFSLKQKQSKENINNVINILKSSLKDTKDFRENLRK--FHKLNKSLVRNKINDLTYVSITRKNFEISIKKEKLVLDSNTLLSRMGGLSSLCIGLTAAFVAEIIEFIYIICK---CNKSRCSKSRIRRK 538          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Planmine SMEST
Match: SMESG000064696.1 (SMESG000064696.1)

HSP 1 Score: 381.333 bits (978), Expect = 7.584e-123
Identity = 211/528 (39.96%), Postives = 302/528 (57.20%), Query Frame = 1
Query:  103 VVKMSKTKLFCQISSIRGISKIHSAKTKFERFLWTGFVILMTCVLFVQMVFLIQDYLQYTTAWHTSTELDYPSPFPAITLCAQNPFSIDANRLWSKRKIMSPSELQDNLTIMSLNAFDD-KNLDGLEYLRLYDLFSTFYMNLPFLDTIKLGHSKDMIRYCILIYKNDIIIAEKCDLKNEKFNIKL-FSHQEYFNCYTIEGLEQYTTDVI-GLILLVQIIPSEKIPELSNSFLVDILQRGEGLKVAVHQPQTYPDIENSGINMHPAKMNSLVYSPTKWIRMSTSKNPCRDKQKPINDLNRHFKYAFTQCVSAEIQRQIIKQCGCMLSNAPRPYPPNETIPYCIKLVSPTKAKLILERLSCVENIQSQSVEIRKTIQNDLCFLKCQFTTYETTMSLTRWTAXXXXXXXXXXXYRSYFAY----RHNSSSENIVKIKSIXXXXXXXXXXXXXQINKNQFNNLINYSRFD---ENAFTYISLMRRNFDIQWKTEKLVLDSNTLFSRMGGLTSICIGLTAAVFAEFIEFLYWI 1656
            V+  +   LFC+ISSIRG+ KI  A T F + LW  FV  MT +LF+    LI+DYL Y TAWH  T+ D  S FPAITLC+ NPFS+ AN LW K    +P   ++ L  + ++  +  K+ + L  +  +D    +YMN+ +  ++K+ H  +M++YC +     III   C+ + +K   K+ FSHQ++FNCYTI+    Y+   I  LI+LV + P+  IPEL NSFL+DIL+RGEGLK+ +H+P +YP+IE  GI++ P KMN++ Y P KW R ST    C++ Q PI DL R F Y+F+ C++  +Q ++I+ CGCM +  PRP+ PNE I YC+ L     ++ I   L C ++       ++K  +N  C  KC + TY T +S+T+W  +  KL  + +L      Y    R   S E+ +                   I  N  N+ IN S  D   EN FTYISL R+  +   K E+LVLD   L SR+GGL S+ IGLT + F E +EF Y I
Sbjct:   22 VIDKNAFNLFCEISSIRGMHKITKAPTLFLKVLWIAFVFCMTSLLFLVTGLLIKDYLNYYTAWHVRTKFDDNSEFPAITLCSHNPFSLRANSLWKKPNAPNPEMFRERLKQVVIDEVNTTKDPNELTLMMFHDKIENYYMNIDYDFSLKISHGTEMLKYCAIFSDGLIIITYNCETEKDKVVEKIVFSHQKFFNCYTIQQTSNYSQQTITSLIILVSLTPAADIPELKNSFLMDILERGEGLKLVIHEPNSYPEIEEEGIDVQPGKMNNIKYEPVKWARHSTPPQKCKNGQSPIFDLKRQFNYSFSFCMNYNLQLKLIETCGCMNALFPRPFIPNEKIGYCMNLTHRNSSQ-IFTNLKCAQDFTMNVKTLKKQWENTKCMQKCNYFTYNTELSITKWVPSYEKLFRIADLINKTEIYLKNHRERESKEDYISY-----------------IQANITNSYINSSFLDLENENKFTYISLSRKTRNTVIKDEELVLDLAILMSRIGGLCSLFIGLTVSFFIELVEFGYLI 531          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Planmine SMEST
Match: SMESG000045131.1 (SMESG000045131.1)

HSP 1 Score: 361.688 bits (927), Expect = 1.383e-115
Identity = 205/522 (39.27%), Postives = 309/522 (59.20%), Query Frame = 1
Query:  127 LFCQISSIRGISKIHSAKTKFERFLWTGFVILMTCVLFVQMVFLIQDYLQYTTAWHTSTELDYPSPFPAITLCAQNPFSIDANRLWSKRKIMSPSELQDNLTIMSLNAFDDKNLDGLEYLRLYDLFSTFYMNLPFLDTIKLGHSKDMIRYCILIYKNDIIIAEKCDLKNE-KFNIKLFSHQEYFNCYTIE----GLEQYTTDVIG------LILLVQIIPSEKIPELSNSFLVDILQRGEGLKVAVHQPQTYPDIENSGINMHPAKMNSLVYSPTKWIRMSTSKNPCRDKQKPINDLNRHFKYAFTQCVSAEIQRQIIKQCGCMLSNAPRPYPPNETIPYCIKLVSPTKAKLILERLSCVENIQSQSVEIRKTIQNDLCFLKCQFTTYETTMSLTRWTAXXXXXXXXXXXYR---SYFAYRHNSSSENIVKIKSIXXXXXXXXXXXXXQINKNQFNNLINYSRFDENAFTYISLMRRNFDIQWKTEKLVLDSNTLFSRMGGLTSICIGLTAAVFAEFIEFLY 1650
            LFC+  SIRG+ KI  A   F R +W G+VILMT +L V   FL +D+  Y TAWHTST  D  + FPAI++C+ NPFS +ANR+W +  +M+P + ++ LT +S+N   + N  G E L  YD    +Y N+ +  ++ L H ++++RYC+L     + IAE+CDL +   + ++ FS+ +YFNC+TIE     L+ ++ DV+       +I+L+QI P   + ++++SF++D L RG G+KV +H+  T P+IEN GIN+ P KMN + +    W R ++ K PC + Q  I DL   +KY  ++CV AE+Q+  IK CGCM SN PRP  P++ IPYC      T    IL+R  C  +I+ Q +  +K +    CF  C + TY+T +S+T W  +  KL  +  +Y+     +       +E + K+K             +  I+KN  N L      DE+ FTYI+++R+NFD   KTE+LV+D++   SR+GGL S+ +GLT AVFAE IEF Y
Sbjct:   88 LFCEAISIRGMQKIARAPNNFLRSVWIGYVILMTTLLTVTSYFLFRDFFNYNTAWHTSTAFDEKTEFPAISICSHNPFSENANRMWQENLVMTPKKFEELLTNVSINMVKN-NRGGGEIL--YDSAEYYYGNIEYESSVNLSHKEEILRYCVLTTDAYVYIAEQCDLASYVAYRLRKFSNSKYFNCFTIEEDPEKLKTHSADVVSTRELLSIIILIQITPESDLTQINSSFVMDTLTRGTGVKVVLHEVGTSPEIENYGINLQPGKMNEISFETIHWNRYNSPKRPCLNNQSNIIDLGNSYKYTMSKCVEAELQKSTIKNCGCMNSNWPRPVKPSQNIPYCTNFSCSTDE--ILKRYEC-SSIKDQGLTKQKLVDTK-CFGVCSYFTYDTKVSVTNWKPSLYKLNRVTQIYKLANENYTETDEGKTERVKKLKE----------KPQDTISKN-LNMLT-----DESRFTYINVVRKNFDTIKKTERLVIDASIFMSRVGGLCSLLVGLTTAVFAELIEFCY 586          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Planmine SMEST
Match: SMESG000016707.1 (SMESG000016707.1)

HSP 1 Score: 350.517 bits (898), Expect = 1.061e-110
Identity = 197/530 (37.17%), Postives = 305/530 (57.55%), Query Frame = 1
Query:  112 MSKTKLFCQISSIRGISKIHSAKTKFERFLWTGFVILMTCVLFVQMVFLIQDYLQYTTAWHTSTELDYPSPFPAITLCAQNPFSIDANRLWSKRKIMSPSELQDNLTIMSLNAFDDKNLDGLEYLRLYDLFSTFYMNLPFLDTIKLGHSKDMIRYCILIYKNDIIIAEKCDLKNE-KFNIKLFSHQEYFNCYTIEG-------LEQY---TTDVIGLILLVQIIPSEKIPELSNSFLVDILQRGEGLKVAVHQPQTYPDIENSGINMHPAKMNSLVYSPTKWIRMSTSKNPCRDKQKPINDLNRHFKYAFTQCVSAEIQRQIIKQCGCMLSNAPRPYPPNETIPYCIKLVSPTKAKLILERLSCV-ENIQSQSVEIRKTIQNDLCFLKCQFTTYETTMSLTRWTAXXXXXXXXXXXYRSYFAYRHNSS-----SENIVKIKSIXXXXXXXXXXXXXQINKNQFNNLINYSRFDENAFTYISLMRRNFDIQWKTEKLVLDSNTLFSRMGGLTSICIGLTAAVFAEFIEFLY 1650
            +SK  +FC+ SS+RG+ KIH +KT F + LW  FV  M+ +L +    L+ D+  Y TAWH STELD  + FPAI++C+ NPFS  A+R W + KI+ P + ++ L  + +      NL G     L D    +Y N+ +  +IKLGH + +++YC++      IIAE C ++NE  F +  FSH  YFNC+TIE        ++ Y   T + + LILL+ +     + + + SF++D L RGEGL++ +H+  +YPDI+ +GIN+ P KMN + +    W R S+ K  C+D Q PI DL+R + Y F QC+ A + ++++++C CM +  PRP  P++ +PYC           I++R  CV E +  +   I+       C+  C F TY++T+S+TRW  + LKL+ +   YRS   Y  + S     +E I ++KS  +N L R    +  ++ ++   +     F+E+   YI+L+R+NFD   K EKL +D     SR+GGL S+CIGLT A F E IEF+Y
Sbjct:   50 ISKFAIFCEASSVRGMQKIHKSKTPFLKALWIAFVFFMSILLIIISTNLVIDFRNYHTAWHVSTELDEKTRFPAISICSHNPFSKQASRYWKEGKILPPEKFRERLFEVEMELIKSGNLPGQ---TLLDKAEEYYGNVDYPSSIKLGHVRKILQYCVVQNDGFTIIAEDCLVENETGFTVSQFSHYNYFNCFTIEAKSEKNGLIKSYGDKTNETVSLILLINVNLFSDLFQANESFVMDSLTRGEGLRIVIHRVGSYPDIDKNGINIQPGKMNEVNFQNIHWTRYSSPKRECKDDQPPIVDLDRIYDYTFAQCLDAIVNKELVEKCQCMSTIWPRPQLPSKDVPYCNDYSG--NLTTIVKRTQCVYEEVFQKLKPIKAAAVGTKCWPLCTFNTYDSTLSITRWKPSLLKLRQITKRYRSVNKYIDDISLAKNNTETIEQLKSNYINELKRELKYKPTLSHHKSEEI-----FNEHQMNYINLVRKNFDTTKKIEKLFIDIYIFISRVGGLCSLCIGLTTAFFIEIIEFVY 569          
The following BLAST results are available for this feature:
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
SCNN1G8.733e-826.41sodium channel epithelial 1 gamma subunit [Source:... [more]
ASIC14.211e-723.04acid sensing ion channel subunit 1 [Source:HGNC Sy... [more]
ASIC15.600e-723.04acid sensing ion channel subunit 1 [Source:HGNC Sy... [more]
SCNN1B6.381e-621.43sodium channel epithelial 1 beta subunit [Source:H... [more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
unc-87.508e-620.75Degenerin unc-8 [Source:UniProtKB/Swiss-Prot;Acc:... [more]
unc-88.043e-620.75Degenerin unc-8 [Source:UniProtKB/Swiss-Prot;Acc:... [more]
unc-88.046e-620.75Degenerin unc-8 [Source:UniProtKB/Swiss-Prot;Acc:... [more]
unc-89.457e-620.75Degenerin unc-8 [Source:UniProtKB/Swiss-Prot;Acc:... [more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cdh121.083e-924.65cadherin 12, type 2 (N-cadherin 2) [Source:Xenbase... [more]
cdh121.160e-924.11cadherin 12, type 2 (N-cadherin 2) [Source:Xenbase... [more]
cdh121.222e-924.65cadherin 12, type 2 (N-cadherin 2) [Source:Xenbase... [more]
cdh121.338e-923.94cadherin 12, type 2 (N-cadherin 2) [Source:Xenbase... [more]
cdh122.409e-825.00cadherin 12, type 2 (N-cadherin 2) [Source:Xenbase... [more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Scnn1g2.322e-827.35sodium channel, nonvoltage-gated 1 gamma [Source:M... [more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q25011|FANA_CORAP1.158e-1524.01FMRFamide-activated amiloride-sensitive sodium cha... [more]
sp|H2QAR5|SCNNG_PANTR3.927e-1422.49Amiloride-sensitive sodium channel subunit gamma O... [more]
sp|O13263|SCNNH_XENLA4.739e-924.82Amiloride-sensitive sodium channel subunit gamma-2... [more]
sp|P51171|SCNNG_XENLA5.760e-924.65Amiloride-sensitive sodium channel subunit gamma O... [more]
sp|P37091|SCNNG_RAT1.497e-726.92Amiloride-sensitive sodium channel subunit gamma O... [more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4E0RFC31.342e-12340.83FMRFamide-activated amiloride-sensitive sodium cha... [more]
A0A4Z2DAR54.561e-11839.00FMRFamide-activated amiloride-sensitive sodium cha... [more]
A0A183NDT01.636e-11438.75Uncharacterized protein OS=Schistosoma mattheei OX... [more]
A0A095BVN94.480e-11438.56FMRFamide-activated amiloride-sensitive sodium cha... [more]
A0A430QBJ66.108e-11438.56Uncharacterized protein OS=Schistosoma bovis OX=61... [more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
SCNN1G4.236e-623.75sodium channel epithelial 1 gamma subunit [Source:... [more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO421374.011e-920.37Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO308936.039e-627.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000081715.10.000e+099.67SMESG000081715.1[more]
SMESG000035185.10.000e+050.94SMESG000035185.1[more]
SMESG000064696.17.584e-12339.96SMESG000064696.1[more]
SMESG000045131.11.383e-11539.27SMESG000045131.1[more]
SMESG000016707.11.061e-11037.17SMESG000016707.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028157 ID=SMED30028157|Name=FMRFamide-activated amiloride-sensitive sodium channel|organism=Schmidtea mediterranea sexual|type=transcript|length=2252bp
AGTTAATCCAATAACTTTTATAAATTCCGTTGTTAATACTTAATTGGGAA
TGAATTAATTTTCAAATTTTAACTTGAAATGAAAAGTTTTACATCAAAAA
ATGTGGTGAAAATGTCAAAAACGAAATTGTTCTGTCAAATTTCATCAATT
AGAGGAATATCTAAAATTCATTCTGCAAAAACCAAATTCGAAAGGTTTTT
GTGGACGGGTTTTGTGATTTTAATGACTTGTGTACTATTTGTACAAATGG
TATTTTTAATTCAAGATTATCTTCAATATACAACAGCTTGGCATACCTCA
ACTGAACTCGACTATCCCAGTCCATTTCCTGCAATTACACTTTGTGCACA
GAATCCATTTTCAATTGATGCTAATCGATTATGGTCGAAAAGAAAAATAA
TGTCTCCTTCTGAATTACAAGACAATTTAACTATTATGTCTCTGAACGCT
TTTGACGATAAAAATCTCGATGGTCTCGAGTACTTAAGGCTATATGATTT
ATTCAGTACATTTTATATGAATTTACCTTTTTTGGATACTATAAAATTGG
GCCACTCGAAAGATATGATTCGTTATTGTATATTAATTTACAAAAATGAT
ATTATTATCGCAGAAAAGTGTGACCTAAAAAATGAAAAATTTAACATAAA
ACTTTTTTCTCATCAAGAGTATTTTAATTGCTACACTATTGAAGGTTTAG
AACAGTACACTACTGATGTAATTGGTTTAATTCTTCTTGTACAGATCATA
CCCAGTGAAAAAATACCAGAACTATCAAATAGTTTTCTAGTTGATATTTT
ACAAAGAGGGGAAGGCTTAAAAGTTGCTGTTCATCAACCGCAAACATATC
CGGACATCGAAAACTCAGGTATTAATATGCATCCAGCAAAAATGAATTCA
CTAGTTTATTCACCAACAAAATGGATACGTATGAGTACATCGAAAAATCC
TTGTCGAGATAAACAAAAACCAATCAATGATCTAAATCGGCATTTTAAAT
ATGCTTTTACTCAATGTGTTTCAGCTGAAATCCAAAGACAAATAATTAAA
CAATGTGGCTGTATGCTAAGCAATGCTCCTAGGCCATACCCACCGAATGA
AACTATACCTTATTGTATCAAACTCGTTTCACCAACAAAAGCCAAATTAA
TACTTGAACGATTGAGTTGTGTTGAAAATATACAAAGTCAGTCAGTAGAA
ATTCGAAAAACAATTCAAAACGACCTTTGTTTTCTTAAATGTCAATTTAC
CACTTATGAAACAACAATGTCCTTAACCCGTTGGACGGCTAATGAATTGA
AATTGAAAAACCTTGAAAACCTTTACCGATCTTACTTTGCGTACAGGCAC
AATTCATCATCAGAGAATATCGTCAAAATAAAATCCATTCTTTTAAACTC
CCTTAATCGTTCTCACAATCTAAGACACCAAATAAACAAAAACCAGTTTA
ATAATTTAATAAATTACAGCAGATTTGATGAAAATGCATTCACTTATATC
AGTTTAATGAGAAGAAATTTCGACATTCAGTGGAAAACAGAGAAATTAGT
TTTAGATTCAAATACACTTTTCTCAAGAATGGGAGGTTTGACGTCCATTT
GTATTGGTTTAACAGCAGCAGTATTTGCGGAGTTCATTGAATTCCTTTAC
TGGATCCACAAATCACCATTTACAAATAAAACCGACTCAGATTCAAACCA
TGTCAGAAAAGAAGTTTACTTTCAATCGCAGAGACTTATAGGATTTCCTG
TAGAGGAAAATATGTTTGACTTTGATCGAAATGAAAAAGCTAATAATATA
TTCATGGAACACAGCTCATCTGAACGTTGTCCTTCTTCATTTAATGATGT
GAATGAAGAATTGAATGACTTGTCCGTAAATTCTGACTCTGGTAGATCAG
CAATGATTCAAAAGGATCGTCAATATGGGATATATAACTAAAAATTTATA
ATTCGAAAATATTTTTCTAGCCATTTTTAACATGTCCTGTATAATTTTTG
ATTGTTTTTCATGAAAAATAAATTTGTCCAAAAAATATCAAATTGTATTT
TATTGAAATTTTTATTTGGTCTGCAAAGAAACATGGTCTTGAAAATTATA
TTTCCTACAACAATGAGTCAAAACCTTTTTCACGCCAAGCGCAAGAGAAA
ATCATATATAACATCATTGGTCACTCATTTAAAACAAAATTTCAATGAGA
TTTCTCCTTCAAAAAATGTGCCAATTCTCGACACTTGAAATTTTTTTAAC
GA
back to top

protein sequence of SMED30028157-orf-1

>SMED30028157-orf-1 ID=SMED30028157-orf-1|Name=SMED30028157-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=621bp
MKSFTSKNVVKMSKTKLFCQISSIRGISKIHSAKTKFERFLWTGFVILMT
CVLFVQMVFLIQDYLQYTTAWHTSTELDYPSPFPAITLCAQNPFSIDANR
LWSKRKIMSPSELQDNLTIMSLNAFDDKNLDGLEYLRLYDLFSTFYMNLP
FLDTIKLGHSKDMIRYCILIYKNDIIIAEKCDLKNEKFNIKLFSHQEYFN
CYTIEGLEQYTTDVIGLILLVQIIPSEKIPELSNSFLVDILQRGEGLKVA
VHQPQTYPDIENSGINMHPAKMNSLVYSPTKWIRMSTSKNPCRDKQKPIN
DLNRHFKYAFTQCVSAEIQRQIIKQCGCMLSNAPRPYPPNETIPYCIKLV
SPTKAKLILERLSCVENIQSQSVEIRKTIQNDLCFLKCQFTTYETTMSLT
RWTANELKLKNLENLYRSYFAYRHNSSSENIVKIKSILLNSLNRSHNLRH
QINKNQFNNLINYSRFDENAFTYISLMRRNFDIQWKTEKLVLDSNTLFSR
MGGLTSICIGLTAAVFAEFIEFLYWIHKSPFTNKTDSDSNHVRKEVYFQS
QRLIGFPVEENMFDFDRNEKANNIFMEHSSSERCPSSFNDVNEELNDLSV
NSDSGRSAMIQKDRQYGIYN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
Vocabulary: INTERPRO
TermDefinition
IPR001873ENaC
Vocabulary: biological process
TermDefinition
GO:0006814sodium ion transport
GO:0006810transport
GO:0006811ion transport
GO:0035725sodium ion transmembrane transport
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: molecular function
TermDefinition
GO:0005272sodium channel activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001873Epithelial sodium channelPRINTSPR01078AMINACHANNELcoord: 39..56
score: 19.11
coord: 189..205
score: 35.06
coord: 384..404
score: 30.29
coord: 246..264
score: 29.26
coord: 319..336
score: 35.33
coord: 79..95
score: 44.24
IPR001873Epithelial sodium channelPFAMPF00858ASCcoord: 18..522
e-value: 1.6E-55
score: 188.9
IPR001873Epithelial sodium channelPANTHERPTHR11690AMILORIDE-SENSITIVE SODIUM CHANNEL-RELATEDcoord: 18..538
NoneNo IPR availableGENE3DG3DSA:1.10.3590.10coord: 92..246
e-value: 2.4E-36
score: 127.6
NoneNo IPR availableGENE3DG3DSA:2.60.470.10coord: 69..490
e-value: 2.4E-36
score: 127.6
NoneNo IPR availableGENE3DG3DSA:1.10.287.770coord: 39..520
e-value: 2.4E-36
score: 127.6
NoneNo IPR availableGENE3DG3DSA:1.10.287.820coord: 284..388
e-value: 2.4E-36
score: 127.6
NoneNo IPR availableTMHMMTMhelixcoord: 40..62
NoneNo IPR availableTMHMMTMhelixcoord: 503..525