Tissue factor pathway inhibitor

Overview
NameTissue factor pathway inhibitor
Smed IDSMED30028151
Length (bp)404
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Tissue factor pathway inhibitor (SMED30028151) t-SNE clustered cells

Violin plots show distribution of expression levels for Tissue factor pathway inhibitor (SMED30028151) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Tissue factor pathway inhibitor (SMED30028151) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Tissue factor pathway inhibitor (SMED30028151) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028151

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymaSMED30028151SMESG000044323.1 dd_Smed_v4_57_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30028151SMESG000044323.1 Contig47076newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30028151SMESG000044323.1 Contig47076uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
parenchymaSMED30028151SMESG000044323.1 dd_57dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
prepharyngeal regionSMED30028151SMESG000044323.1 dd_Smed_v6_57_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Tissue factor pathway inhibitor vs. Ensembl Human
Match: WFDC8 (WAP four-disulfide core domain 8 [Source:HGNC Symbol;Acc:HGNC:16163])

HSP 1 Score: 61.2326 bits (147), Expect = 1.188e-11
Identity = 27/67 (40.30%), Postives = 37/67 (55.22%), Query Frame = 1
Query:   73 CFVICFIQTLDCLNKICTKPVERGNCKASMDRFSYSTEHGKCIPFKFTGCRGNENNFINEAACNKIC 273
            CF  C  + +D   + C  PV  GNC     R+ +  ++ +C PFK+ GC GN NNF+NE AC   C
Sbjct:   79 CFFACQKKCMDPFQEPCMLPVRHGNCNHEAQRWHFDFKNYRCTPFKYRGCEGNANNFLNEDACRTAC 145          
BLAST of Tissue factor pathway inhibitor vs. Ensembl Human
Match: WFDC8 (WAP four-disulfide core domain 8 [Source:HGNC Symbol;Acc:HGNC:16163])

HSP 1 Score: 61.2326 bits (147), Expect = 1.188e-11
Identity = 27/67 (40.30%), Postives = 37/67 (55.22%), Query Frame = 1
Query:   73 CFVICFIQTLDCLNKICTKPVERGNCKASMDRFSYSTEHGKCIPFKFTGCRGNENNFINEAACNKIC 273
            CF  C  + +D   + C  PV  GNC     R+ +  ++ +C PFK+ GC GN NNF+NE AC   C
Sbjct:   79 CFFACQKKCMDPFQEPCMLPVRHGNCNHEAQRWHFDFKNYRCTPFKYRGCEGNANNFLNEDACRTAC 145          
BLAST of Tissue factor pathway inhibitor vs. Ensembl Human
Match: TFPI (tissue factor pathway inhibitor [Source:HGNC Symbol;Acc:HGNC:11760])

HSP 1 Score: 60.4622 bits (145), Expect = 3.244e-11
Identity = 26/54 (48.15%), Postives = 38/54 (70.37%), Query Frame = 1
Query:  121 CTKPVERGNCKASMDRFSYSTEHGKCIPFKFTGCRGNENNFINEAACNKICSRG 282
            C  P +RG C+A+ +RF Y++  GKC PFK++GC GNENNF ++  C + C +G
Sbjct:  217 CLTPADRGLCRANENRFYYNSVIGKCRPFKYSGCGGNENNFTSKQECLRACKKG 270          
BLAST of Tissue factor pathway inhibitor vs. Ensembl Human
Match: TFPI (tissue factor pathway inhibitor [Source:HGNC Symbol;Acc:HGNC:11760])

HSP 1 Score: 60.4622 bits (145), Expect = 3.244e-11
Identity = 26/54 (48.15%), Postives = 38/54 (70.37%), Query Frame = 1
Query:  121 CTKPVERGNCKASMDRFSYSTEHGKCIPFKFTGCRGNENNFINEAACNKICSRG 282
            C  P +RG C+A+ +RF Y++  GKC PFK++GC GNENNF ++  C + C +G
Sbjct:  217 CLTPADRGLCRANENRFYYNSVIGKCRPFKYSGCGGNENNFTSKQECLRACKKG 270          
BLAST of Tissue factor pathway inhibitor vs. Ensembl Human
Match: SPINT3 (serine peptidase inhibitor, Kunitz type 3 [Source:HGNC Symbol;Acc:HGNC:11248])

HSP 1 Score: 53.9138 bits (128), Expect = 5.693e-10
Identity = 23/57 (40.35%), Postives = 34/57 (59.65%), Query Frame = 1
Query:  103 DCLNKICTKPVERGNCKASMDRFSYSTEHGKCIPFKFTGCRGNENNFINEAACNKIC 273
            D L  +C  P+E+G C+  M R+ ++ E G+C  F + GC GN NNF+ +  C K C
Sbjct:   30 DLLPNVCAFPMEKGPCQTYMTRWFFNFETGECELFAYGGCGGNSNNFLRKEKCEKFC 86          
BLAST of Tissue factor pathway inhibitor vs. Ensembl Celegans
Match: mlt-11 (pep chromosome:WBcel235:V:20667211:20678513:1 gene:WBGene00012186.1 transcript:W01F3.3d.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:mlt-11)

HSP 1 Score: 57.7658 bits (138), Expect = 1.888e-10
Identity = 23/53 (43.40%), Postives = 32/53 (60.38%), Query Frame = 1
Query:  121 CTKPVERGNCKASMDRFSYSTEHGKCIPFKFTGCRGNENNFINEAACNKICSR 279
            C +PVE G CK   DR+ ++ + G C PFK+ GC GN N+F  +  C   C+R
Sbjct: 1074 CLQPVEPGPCKNFADRWYFNVDDGTCHPFKYGGCAGNRNHFFTQKECEVHCAR 1126          

HSP 2 Score: 50.447 bits (119), Expect = 5.768e-8
Identity = 20/53 (37.74%), Postives = 29/53 (54.72%), Query Frame = 1
Query:  121 CTKPVERGNCKASMDRFSYSTEHGKCIPFKFTGCRGNENNFINEAACNKICSR 279
            C  P + GNC+    R+ +  E   C  F +TGC+GN NNF ++  C  IC +
Sbjct:  728 CLHPRDSGNCRGQFVRWFFDDEKKNCDVFTYTGCQGNGNNFASKEECMAICHK 780          

HSP 3 Score: 48.521 bits (114), Expect = 2.720e-7
Identity = 19/54 (35.19%), Postives = 32/54 (59.26%), Query Frame = 1
Query:  112 NKICTKPVERGNCKASMDRFSYSTEHGKCIPFKFTGCRGNENNFINEAACNKIC 273
            N +C +PV +G+C+ +  R+ Y      C  F+++GC GN NNF +   C ++C
Sbjct: 2730 NPLCIQPVVKGSCQEAHLRYYYDRVTDSCRLFEYSGCDGNANNFGSLEDCQRLC 2783          

HSP 4 Score: 45.4394 bits (106), Expect = 3.284e-6
Identity = 17/52 (32.69%), Postives = 28/52 (53.85%), Query Frame = 1
Query:  118 ICTKPVERGNCKASMDRFSYSTEHGKCIPFKFTGCRGNENNFINEAACNKIC 273
            +C  P + G C     R+ ++++ G+C  F +  C GNENNF +   C + C
Sbjct: 2167 VCAMPPDAGVCTNYTPRWFFNSQTGQCEQFAYGSCGGNENNFFDRNTCERKC 2218          
BLAST of Tissue factor pathway inhibitor vs. Ensembl Celegans
Match: mlt-11 (pep chromosome:WBcel235:V:20667211:20678513:1 gene:WBGene00012186.1 transcript:W01F3.3b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:mlt-11)

HSP 1 Score: 57.7658 bits (138), Expect = 1.889e-10
Identity = 23/53 (43.40%), Postives = 32/53 (60.38%), Query Frame = 1
Query:  121 CTKPVERGNCKASMDRFSYSTEHGKCIPFKFTGCRGNENNFINEAACNKICSR 279
            C +PVE G CK   DR+ ++ + G C PFK+ GC GN N+F  +  C   C+R
Sbjct: 1083 CLQPVEPGPCKNFADRWYFNVDDGTCHPFKYGGCAGNRNHFFTQKECEVHCAR 1135          

HSP 2 Score: 52.373 bits (124), Expect = 1.088e-8
Identity = 23/61 (37.70%), Postives = 34/61 (55.74%), Query Frame = 1
Query:   97 TLDCLNKICTKPVERGNCKASMDRFSYSTEHGKCIPFKFTGCRGNENNFINEAACNKICSR 279
            T D +N+ C  P + GNC+    R+ +  E   C  F +TGC+GN NNF ++  C  IC +
Sbjct:  730 TTDSVNR-CLHPRDSGNCRGQFVRWFFDDEKKNCDVFTYTGCQGNGNNFASKEECMAICHK 789          

HSP 3 Score: 48.521 bits (114), Expect = 2.720e-7
Identity = 19/54 (35.19%), Postives = 32/54 (59.26%), Query Frame = 1
Query:  112 NKICTKPVERGNCKASMDRFSYSTEHGKCIPFKFTGCRGNENNFINEAACNKIC 273
            N +C +PV +G+C+ +  R+ Y      C  F+++GC GN NNF +   C ++C
Sbjct: 2739 NPLCIQPVVKGSCQEAHLRYYYDRVTDSCRLFEYSGCDGNANNFGSLEDCQRLC 2792          

HSP 4 Score: 45.4394 bits (106), Expect = 3.284e-6
Identity = 17/52 (32.69%), Postives = 28/52 (53.85%), Query Frame = 1
Query:  118 ICTKPVERGNCKASMDRFSYSTEHGKCIPFKFTGCRGNENNFINEAACNKIC 273
            +C  P + G C     R+ ++++ G+C  F +  C GNENNF +   C + C
Sbjct: 2176 VCAMPPDAGVCTNYTPRWFFNSQTGQCEQFAYGSCGGNENNFFDRNTCERKC 2227          
BLAST of Tissue factor pathway inhibitor vs. Ensembl Celegans
Match: mlt-11 (pep chromosome:WBcel235:V:20667209:20678513:1 gene:WBGene00012186.1 transcript:W01F3.3c.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:mlt-11)

HSP 1 Score: 57.3806 bits (137), Expect = 2.379e-10
Identity = 23/53 (43.40%), Postives = 32/53 (60.38%), Query Frame = 1
Query:  121 CTKPVERGNCKASMDRFSYSTEHGKCIPFKFTGCRGNENNFINEAACNKICSR 279
            C +PVE G CK   DR+ ++ + G C PFK+ GC GN N+F  +  C   C+R
Sbjct:  954 CLQPVEPGPCKNFADRWYFNVDDGTCHPFKYGGCAGNRNHFFTQKECEVHCAR 1006          

HSP 2 Score: 52.373 bits (124), Expect = 1.344e-8
Identity = 23/61 (37.70%), Postives = 34/61 (55.74%), Query Frame = 1
Query:   97 TLDCLNKICTKPVERGNCKASMDRFSYSTEHGKCIPFKFTGCRGNENNFINEAACNKICSR 279
            T D +N+ C  P + GNC+    R+ +  E   C  F +TGC+GN NNF ++  C  IC +
Sbjct:  601 TTDSVNR-CLHPRDSGNCRGQFVRWFFDDEKKNCDVFTYTGCQGNGNNFASKEECMAICHK 660          

HSP 3 Score: 48.521 bits (114), Expect = 3.200e-7
Identity = 19/54 (35.19%), Postives = 32/54 (59.26%), Query Frame = 1
Query:  112 NKICTKPVERGNCKASMDRFSYSTEHGKCIPFKFTGCRGNENNFINEAACNKIC 273
            N +C +PV +G+C+ +  R+ Y      C  F+++GC GN NNF +   C ++C
Sbjct: 2610 NPLCIQPVVKGSCQEAHLRYYYDRVTDSCRLFEYSGCDGNANNFGSLEDCQRLC 2663          

HSP 4 Score: 45.0542 bits (105), Expect = 3.863e-6
Identity = 17/52 (32.69%), Postives = 28/52 (53.85%), Query Frame = 1
Query:  118 ICTKPVERGNCKASMDRFSYSTEHGKCIPFKFTGCRGNENNFINEAACNKIC 273
            +C  P + G C     R+ ++++ G+C  F +  C GNENNF +   C + C
Sbjct: 2047 VCAMPPDAGVCTNYTPRWFFNSQTGQCEQFAYGSCGGNENNFFDRNTCERKC 2098          
BLAST of Tissue factor pathway inhibitor vs. Ensembl Celegans
Match: mlt-11 (pep chromosome:WBcel235:V:20667209:20678513:1 gene:WBGene00012186.1 transcript:W01F3.3h.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:mlt-11)

HSP 1 Score: 56.6102 bits (135), Expect = 4.351e-10
Identity = 23/53 (43.40%), Postives = 32/53 (60.38%), Query Frame = 1
Query:  121 CTKPVERGNCKASMDRFSYSTEHGKCIPFKFTGCRGNENNFINEAACNKICSR 279
            C +PVE G CK   DR+ ++ + G C PFK+ GC GN N+F  +  C   C+R
Sbjct:  862 CLQPVEPGPCKNFADRWYFNVDDGTCHPFKYGGCAGNRNHFFTQKECEVHCAR 914          

HSP 2 Score: 51.6026 bits (122), Expect = 2.504e-8
Identity = 23/61 (37.70%), Postives = 34/61 (55.74%), Query Frame = 1
Query:   97 TLDCLNKICTKPVERGNCKASMDRFSYSTEHGKCIPFKFTGCRGNENNFINEAACNKICSR 279
            T D +N+ C  P + GNC+    R+ +  E   C  F +TGC+GN NNF ++  C  IC +
Sbjct:  509 TTDSVNR-CLHPRDSGNCRGQFVRWFFDDEKKNCDVFTYTGCQGNGNNFASKEECMAICHK 568          

HSP 3 Score: 47.7506 bits (112), Expect = 5.356e-7
Identity = 19/54 (35.19%), Postives = 32/54 (59.26%), Query Frame = 1
Query:  112 NKICTKPVERGNCKASMDRFSYSTEHGKCIPFKFTGCRGNENNFINEAACNKIC 273
            N +C +PV +G+C+ +  R+ Y      C  F+++GC GN NNF +   C ++C
Sbjct: 2137 NPLCIQPVVKGSCQEAHLRYYYDRVTDSCRLFEYSGCDGNANNFGSLEDCQRLC 2190          

HSP 4 Score: 44.669 bits (104), Expect = 6.157e-6
Identity = 17/52 (32.69%), Postives = 28/52 (53.85%), Query Frame = 1
Query:  118 ICTKPVERGNCKASMDRFSYSTEHGKCIPFKFTGCRGNENNFINEAACNKIC 273
            +C  P + G C     R+ ++++ G+C  F +  C GNENNF +   C + C
Sbjct: 1574 VCAMPPDAGVCTNYTPRWFFNSQTGQCEQFAYGSCGGNENNFFDRNTCERKC 1625          
BLAST of Tissue factor pathway inhibitor vs. Ensembl Celegans
Match: mlt-11 (pep chromosome:WBcel235:V:20667211:20678513:1 gene:WBGene00012186.1 transcript:W01F3.3e.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:mlt-11)

HSP 1 Score: 56.225 bits (134), Expect = 5.762e-10
Identity = 23/53 (43.40%), Postives = 32/53 (60.38%), Query Frame = 1
Query:  121 CTKPVERGNCKASMDRFSYSTEHGKCIPFKFTGCRGNENNFINEAACNKICSR 279
            C +PVE G CK   DR+ ++ + G C PFK+ GC GN N+F  +  C   C+R
Sbjct: 1083 CLQPVEPGPCKNFADRWYFNVDDGTCHPFKYGGCAGNRNHFFTQKECEVHCAR 1135          

HSP 2 Score: 51.2174 bits (121), Expect = 3.189e-8
Identity = 23/61 (37.70%), Postives = 34/61 (55.74%), Query Frame = 1
Query:   97 TLDCLNKICTKPVERGNCKASMDRFSYSTEHGKCIPFKFTGCRGNENNFINEAACNKICSR 279
            T D +N+ C  P + GNC+    R+ +  E   C  F +TGC+GN NNF ++  C  IC +
Sbjct:  730 TTDSVNR-CLHPRDSGNCRGQFVRWFFDDEKKNCDVFTYTGCQGNGNNFASKEECMAICHK 789          

HSP 3 Score: 47.3654 bits (111), Expect = 6.819e-7
Identity = 19/54 (35.19%), Postives = 32/54 (59.26%), Query Frame = 1
Query:  112 NKICTKPVERGNCKASMDRFSYSTEHGKCIPFKFTGCRGNENNFINEAACNKIC 273
            N +C +PV +G+C+ +  R+ Y      C  F+++GC GN NNF +   C ++C
Sbjct: 2213 NPLCIQPVVKGSCQEAHLRYYYDRVTDSCRLFEYSGCDGNANNFGSLEDCQRLC 2266          

HSP 4 Score: 44.2838 bits (103), Expect = 7.686e-6
Identity = 17/52 (32.69%), Postives = 28/52 (53.85%), Query Frame = 1
Query:  118 ICTKPVERGNCKASMDRFSYSTEHGKCIPFKFTGCRGNENNFINEAACNKIC 273
            +C  P + G C     R+ ++++ G+C  F +  C GNENNF +   C + C
Sbjct: 1650 VCAMPPDAGVCTNYTPRWFFNSQTGQCEQFAYGSCGGNENNFFDRNTCERKC 1701          
BLAST of Tissue factor pathway inhibitor vs. Ensembl Fly
Match: CG13748 (gene:FBgn0033355 transcript:FBtr0088656)

HSP 1 Score: 54.299 bits (129), Expect = 3.806e-10
Identity = 23/55 (41.82%), Postives = 30/55 (54.55%), Query Frame = 1
Query:  112 NKICTKPVERGNCKASMDRFSYSTEHGKCIPFKFTGCRGNENNFINEAACNKICS 276
             + C  P  +G C+A + R+ Y  E  KC+ FKF GC GNENNF +   C   C 
Sbjct:   57 EQFCLMPARKGVCRALIPRWRYDPEQKKCVEFKFGGCDGNENNFASYKDCMSTCE 111          
BLAST of Tissue factor pathway inhibitor vs. Ensembl Fly
Match: Ppn (gene:FBgn0003137 transcript:FBtr0301837)

HSP 1 Score: 53.9138 bits (128), Expect = 5.254e-9
Identity = 23/54 (42.59%), Postives = 32/54 (59.26%), Query Frame = 1
Query:  118 ICTKPVERGNCKASMDRFSYSTEHGKCIPFKFTGCRGNENNFINEAACNKICSR 279
             C +PVE G C  + +R+ Y  E   C PF + GC+GN+NN+  E ACN  C +
Sbjct: 1729 TCEQPVESGPCAGNFERWYYDNETDICRPFTYGGCKGNKNNYPTEHACNYNCRQ 1782          

HSP 2 Score: 48.1358 bits (113), Expect = 4.382e-7
Identity = 20/59 (33.90%), Postives = 32/59 (54.24%), Query Frame = 1
Query:  109 LNKICTKPVERGNCKASMDRFSYSTEHGKCIPFKFTGCRGNENNFINEAACNKICSRGV 285
            L   C  P + G+C   + ++ +S    +C+PF ++GC GN+NNF    +C   C R V
Sbjct: 1786 LKDRCALPKQTGDCSEKLAKWHFSESEKRCVPFYYSGCGGNKNNFPTLESCEDHCPRQV 1844          

HSP 3 Score: 46.9802 bits (110), Expect = 1.032e-6
Identity = 21/52 (40.38%), Postives = 29/52 (55.77%), Query Frame = 1
Query:  118 ICTKPVERGNCKASMDRFSYSTEHGKCIPFKFTGCRGNENNFINEAACNKIC 273
             C  P  RG C     R+ +    G+C  F+FTGCRGN NNF++++ C   C
Sbjct: 2127 TCALPPVRGRCSDLSRRWYFDERSGECHEFEFTGCRGNRNNFVSQSDCLNFC 2178          
BLAST of Tissue factor pathway inhibitor vs. Ensembl Fly
Match: Ppn (gene:FBgn0003137 transcript:FBtr0300337)

HSP 1 Score: 53.5286 bits (127), Expect = 5.572e-9
Identity = 23/54 (42.59%), Postives = 32/54 (59.26%), Query Frame = 1
Query:  118 ICTKPVERGNCKASMDRFSYSTEHGKCIPFKFTGCRGNENNFINEAACNKICSR 279
             C +PVE G C  + +R+ Y  E   C PF + GC+GN+NN+  E ACN  C +
Sbjct: 1729 TCEQPVESGPCAGNFERWYYDNETDICRPFTYGGCKGNKNNYPTEHACNYNCRQ 1782          
BLAST of Tissue factor pathway inhibitor vs. Ensembl Fly
Match: Acp24A4 (gene:FBgn0051779 transcript:FBtr0305673)

HSP 1 Score: 49.6766 bits (117), Expect = 9.363e-9
Identity = 25/69 (36.23%), Postives = 37/69 (53.62%), Query Frame = 1
Query:   58 LVLAICFVICFIQTLDCLNKICTKPVE-RGNCKASMDRFSYSTEHGKCIPFKFTGCRGNENNFINEAAC 261
            L+L   F+     +L   N+IC  P    GNC A   R+SY  ++  C  F + GC+GNEN+F ++  C
Sbjct:    4 LILLFVFIALASNSLALKNEICGLPAAANGNCLALFSRWSYDAQYNVCFNFIYGGCQGNENSFESQEEC 72          
BLAST of Tissue factor pathway inhibitor vs. Ensembl Fly
Match: Acp24A4 (gene:FBgn0051779 transcript:FBtr0110767)

HSP 1 Score: 49.6766 bits (117), Expect = 9.363e-9
Identity = 25/69 (36.23%), Postives = 37/69 (53.62%), Query Frame = 1
Query:   58 LVLAICFVICFIQTLDCLNKICTKPVE-RGNCKASMDRFSYSTEHGKCIPFKFTGCRGNENNFINEAAC 261
            L+L   F+     +L   N+IC  P    GNC A   R+SY  ++  C  F + GC+GNEN+F ++  C
Sbjct:    4 LILLFVFIALASNSLALKNEICGLPAAANGNCLALFSRWSYDAQYNVCFNFIYGGCQGNENSFESQEEC 72          
BLAST of Tissue factor pathway inhibitor vs. Ensembl Zebrafish
Match: aplp2 (amyloid beta (A4) precursor-like protein 2 [Source:ZFIN;Acc:ZDB-GENE-061009-28])

HSP 1 Score: 59.6918 bits (143), Expect = 4.972e-11
Identity = 24/62 (38.71%), Postives = 36/62 (58.06%), Query Frame = 1
Query:   94 QTLDCLNKICTKPVERGNCKASMDRFSYSTEHGKCIPFKFTGCRGNENNFINEAACNKICSR 279
            +TL  +  +C+   E G C+ASM R+ +  +  KC+ F + GC GN NNF +E  C  +C R
Sbjct:  306 KTLQEVEAVCSLEAETGPCRASMPRWHFDMQQRKCVRFIYGGCAGNRNNFDSEEYCMVVCKR 367          
BLAST of Tissue factor pathway inhibitor vs. Ensembl Zebrafish
Match: aplp2 (amyloid beta (A4) precursor-like protein 2 [Source:ZFIN;Acc:ZDB-GENE-061009-28])

HSP 1 Score: 59.6918 bits (143), Expect = 4.980e-11
Identity = 24/62 (38.71%), Postives = 36/62 (58.06%), Query Frame = 1
Query:   94 QTLDCLNKICTKPVERGNCKASMDRFSYSTEHGKCIPFKFTGCRGNENNFINEAACNKICSR 279
            +TL  +  +C+   E G C+ASM R+ +  +  KC+ F + GC GN NNF +E  C  +C R
Sbjct:  306 KTLQEVEAVCSLEAETGPCRASMPRWHFDMQQRKCVRFIYGGCAGNRNNFDSEEYCMVVCKR 367          
BLAST of Tissue factor pathway inhibitor vs. Ensembl Zebrafish
Match: appb (amyloid beta (A4) precursor protein b [Source:ZFIN;Acc:ZDB-GENE-020220-1])

HSP 1 Score: 58.151 bits (139), Expect = 1.673e-10
Identity = 23/61 (37.70%), Postives = 32/61 (52.46%), Query Frame = 1
Query:  103 DCLNKICTKPVERGNCKASMDRFSYSTEHGKCIPFKFTGCRGNENNFINEAACNKICSRGV 285
            + +  +C  P   G C A + R+ +  E G+C  F F GC GN NNF +E  C  +CS  V
Sbjct:  300 EVVRAVCWAPARSGPCHAKLPRWYFVAEKGRCASFTFGGCGGNRNNFESEEYCMAVCSSSV 360          
BLAST of Tissue factor pathway inhibitor vs. Ensembl Zebrafish
Match: appb (amyloid beta (A4) precursor protein b [Source:ZFIN;Acc:ZDB-GENE-020220-1])

HSP 1 Score: 58.151 bits (139), Expect = 1.674e-10
Identity = 23/61 (37.70%), Postives = 32/61 (52.46%), Query Frame = 1
Query:  103 DCLNKICTKPVERGNCKASMDRFSYSTEHGKCIPFKFTGCRGNENNFINEAACNKICSRGV 285
            + +  +C  P   G C A + R+ +  E G+C  F F GC GN NNF +E  C  +CS  V
Sbjct:  288 EVVRAVCWAPARSGPCHAKLPRWYFVAEKGRCASFTFGGCGGNRNNFESEEYCMAVCSSSV 348          
BLAST of Tissue factor pathway inhibitor vs. Ensembl Zebrafish
Match: appb (amyloid beta (A4) precursor protein b [Source:ZFIN;Acc:ZDB-GENE-020220-1])

HSP 1 Score: 58.151 bits (139), Expect = 1.674e-10
Identity = 23/61 (37.70%), Postives = 32/61 (52.46%), Query Frame = 1
Query:  103 DCLNKICTKPVERGNCKASMDRFSYSTEHGKCIPFKFTGCRGNENNFINEAACNKICSRGV 285
            + +  +C  P   G C A + R+ +  E G+C  F F GC GN NNF +E  C  +CS  V
Sbjct:  289 EVVRAVCWAPARSGPCHAKLPRWYFVAEKGRCASFTFGGCGGNRNNFESEEYCMAVCSSSV 349          
BLAST of Tissue factor pathway inhibitor vs. Ensembl Xenopus
Match: cmtr2 (cap methyltransferase 2 [Source:Xenbase;Acc:XB-GENE-6035233])

HSP 1 Score: 47.7506 bits (112), Expect = 6.193e-8
Identity = 20/57 (35.09%), Postives = 30/57 (52.63%), Query Frame = 1
Query:  112 NKICTKPVERGNCKASMDRFSYSTEHGKCIPFKFTGCRGNENNFINEAACNKICSRG 282
            +  C  P+  G CKA+   +++    GKC+ F + GC+GN N F  E  C +  S G
Sbjct:    3 HAACRLPITPGPCKAAKTHWAFDAAQGKCVTFAYGGCQGNGNQFYTEKECKEYSSIG 59          
BLAST of Tissue factor pathway inhibitor vs. Ensembl Xenopus
Match: tfpi2 (tissue factor pathway inhibitor 2 [Source:NCBI gene;Acc:548483])

HSP 1 Score: 50.0618 bits (118), Expect = 9.180e-8
Identity = 21/55 (38.18%), Postives = 32/55 (58.18%), Query Frame = 1
Query:  118 ICTKPVERGNCKASMDRFSYSTEHGKCIPFKFTGCRGNENNFINEAACNKICSRG 282
             C  P + G+C AS+ R+ ++ E   C  F +TGC GN NNF+    C+ +C +G
Sbjct:  148 FCYSPKDEGSCSASVTRYYFNIESKACEEFVYTGCGGNSNNFVKMEDCDSVCKKG 202          

HSP 2 Score: 45.8246 bits (107), Expect = 3.113e-6
Identity = 20/56 (35.71%), Postives = 33/56 (58.93%), Query Frame = 1
Query:  109 LNKICTKPVERGNCKASMDRFSYSTEHGKCIPFKFTGCRGNENNFINEAACNKICS 276
            + K C    + G C+  + R++Y+ +  KC  F + GC GN+NNF ++A+C   CS
Sbjct:   85 VPKACRMDPDEGPCRGFLKRYAYNMQTMKCEQFYYGGCYGNDNNFKDKASCMDFCS 140          
BLAST of Tissue factor pathway inhibitor vs. Ensembl Xenopus
Match: rlbp1 (retinaldehyde binding protein 1 [Source:Xenbase;Acc:XB-GENE-976303])

HSP 1 Score: 50.0618 bits (118), Expect = 1.523e-7
Identity = 24/58 (41.38%), Postives = 31/58 (53.45%), Query Frame = 1
Query:  100 LDCLNKICTKPVERGNCKASMDRFSYSTEHGKCIPFKFTGCRGNENNFINEAACNKIC 273
            L C N  C    + G C+AS  RF Y     KC+ F + GC GN+NNF  E+ C + C
Sbjct:  351 LFCENSRCVDLPDTGPCRASFSRFYYDPNIRKCLRFTYGGCAGNDNNFHRESDCMRYC 408          
BLAST of Tissue factor pathway inhibitor vs. Ensembl Xenopus
Match: cmtr2 (cap methyltransferase 2 [Source:Xenbase;Acc:XB-GENE-6035233])

HSP 1 Score: 46.2098 bits (108), Expect = 2.087e-7
Identity = 18/55 (32.73%), Postives = 29/55 (52.73%), Query Frame = 1
Query:  112 NKICTKPVERGNCKASMDRFSYSTEHGKCIPFKFTGCRGNENNFINEAACNKICS 276
            +  C  P+  G CKA+   +++    GKC+ F + GC+GN N F  E  C +  +
Sbjct:    3 HAACRLPITPGPCKAAKTHWAFDAAQGKCVTFAYGGCQGNGNQFYTEKECKEYWA 57          
BLAST of Tissue factor pathway inhibitor vs. Ensembl Xenopus
Match: APLP2 (amyloid beta (A4) precursor-like protein 2 [Source:NCBI gene;Acc:100380132])

HSP 1 Score: 49.6766 bits (117), Expect = 2.189e-7
Identity = 19/55 (34.55%), Postives = 30/55 (54.55%), Query Frame = 1
Query:  109 LNKICTKPVERGNCKASMDRFSYSTEHGKCIPFKFTGCRGNENNFINEAACNKIC 273
            +  +C++    G C+A M R+ +     KC+ F + GC GN NNF +E  C  +C
Sbjct:  271 VKSVCSQEAMTGPCRAMMPRWYFDLGQKKCVRFIYGGCGGNRNNFESEDYCMAVC 325          
BLAST of Tissue factor pathway inhibitor vs. Ensembl Mouse
Match: Spint3 (serine peptidase inhibitor, Kunitz type, 3 [Source:MGI Symbol;Acc:MGI:3651470])

HSP 1 Score: 53.9138 bits (128), Expect = 4.028e-10
Identity = 22/56 (39.29%), Postives = 36/56 (64.29%), Query Frame = 1
Query:  109 LNKICTKPVERGNCKASMDRFSYSTEHGKCIPFKFTGCRGNENNFINEAACNKICS 276
            L  +C  P + G C+A   R+ Y+++ GKC  F++ GC+GNENNF + + C  +C+
Sbjct:   31 LPPMCILPKDIGGCRAVFVRWYYNSKTGKCEWFRYGGCKGNENNFPSRSQCQAVCT 86          
BLAST of Tissue factor pathway inhibitor vs. Ensembl Mouse
Match: Wfdc6b (WAP four-disulfide core domain 6B [Source:MGI Symbol;Acc:MGI:3575430])

HSP 1 Score: 53.9138 bits (128), Expect = 1.422e-9
Identity = 26/67 (38.81%), Postives = 37/67 (55.22%), Query Frame = 1
Query:   73 CFVICFIQTLDCLNKICTKPVERGNCKASMDRFSYSTEHGKCIPFKFTGCRGNENNFINEAACNKIC 273
            C   C  + LD    IC+ P + G C A + R+ Y+ +   CI F + GC+GN NNF ++A C  IC
Sbjct:   72 CLFACGRKCLDLSEDICSLPQDAGPCLAYLPRWWYNQDTKLCIEFIYGGCQGNPNNFESKAVCTSIC 138          
BLAST of Tissue factor pathway inhibitor vs. Ensembl Mouse
Match: Wfdc6a (WAP four-disulfide core domain 6A [Source:MGI Symbol;Acc:MGI:2684968])

HSP 1 Score: 51.6026 bits (122), Expect = 6.642e-9
Identity = 23/69 (33.33%), Postives = 36/69 (52.17%), Query Frame = 1
Query:   73 CFVICFIQTLDCLNKICTKPVERGNCKASMDRFSYSTEHGKCIPFKFTGCRGNENNFINEAACNKICSR 279
            C   C  + +D    +C+ P + G C A + R+ Y+ E   C  F + GC+GN NNF +E  C  +C +
Sbjct:   61 CLFSCGKKCMDLRQDVCSLPQDPGPCLAYLPRWWYNQETDLCTEFIYGGCQGNPNNFPSEGICTVVCKK 129          
BLAST of Tissue factor pathway inhibitor vs. Ensembl Mouse
Match: Wfdc6a (WAP four-disulfide core domain 6A [Source:MGI Symbol;Acc:MGI:2684968])

HSP 1 Score: 51.6026 bits (122), Expect = 6.642e-9
Identity = 23/69 (33.33%), Postives = 36/69 (52.17%), Query Frame = 1
Query:   73 CFVICFIQTLDCLNKICTKPVERGNCKASMDRFSYSTEHGKCIPFKFTGCRGNENNFINEAACNKICSR 279
            C   C  + +D    +C+ P + G C A + R+ Y+ E   C  F + GC+GN NNF +E  C  +C +
Sbjct:   61 CLFSCGKKCMDLRQDVCSLPQDPGPCLAYLPRWWYNQETDLCTEFIYGGCQGNPNNFPSEGICTVVCKK 129          
BLAST of Tissue factor pathway inhibitor vs. Ensembl Mouse
Match: App (amyloid beta (A4) precursor protein [Source:MGI Symbol;Acc:MGI:88059])

HSP 1 Score: 53.5286 bits (127), Expect = 7.363e-9
Identity = 20/46 (43.48%), Postives = 27/46 (58.70%), Query Frame = 1
Query:  136 ERGNCKASMDRFSYSTEHGKCIPFKFTGCRGNENNFINEAACNKIC 273
            E G C+A + R+ +    GKC+PF + GC GN NNF  E  C  +C
Sbjct:  296 ETGPCRAMISRWYFDVTEGKCVPFFYGGCGGNRNNFDTEEYCMAVC 341          
BLAST of Tissue factor pathway inhibitor vs. UniProt/SwissProt
Match: sp|P0DN12|VKT8_ANEVI (U-actitoxin-Avd3k OS=Anemonia viridis OX=51769 PE=3 SV=1)

HSP 1 Score: 58.151 bits (139), Expect = 4.379e-11
Identity = 27/72 (37.50%), Postives = 41/72 (56.94%), Query Frame = 1
Query:   70 ICFVICFIQTLDC---LNKICTKPVERGNCKASMDRFSYSTEHGKCIPFKFTGCRGNENNFINEAACNKICS 276
            + F++CF    D    +NK C  P++ G C+A   R+ Y++   +C  F + GCRGN NNFI +  C K+C 
Sbjct:    1 MVFLLCFFLVADVSYGINKDCLLPMDVGRCRARHPRYYYNSSSKRCEKFIYGGCRGNANNFITKKECEKVCG 72          
BLAST of Tissue factor pathway inhibitor vs. UniProt/SwissProt
Match: sp|P0DN20|VKTG_ANEVI (U-actitoxin-Avd3s (Fragment) OS=Anemonia viridis OX=51769 PE=2 SV=1)

HSP 1 Score: 58.151 bits (139), Expect = 4.694e-11
Identity = 27/70 (38.57%), Postives = 40/70 (57.14%), Query Frame = 1
Query:   76 FVICFIQTLDC---LNKICTKPVERGNCKASMDRFSYSTEHGKCIPFKFTGCRGNENNFINEAACNKICS 276
            F++CF    D    +NK C  P++ G C+A   R+ Y++   +C  F + GCRGN NNFI +  C K+C 
Sbjct:    1 FLLCFFLVADVSYGINKDCLLPMDVGRCRARHPRYYYNSSSKRCEMFNYGGCRGNANNFITKKECEKVCG 70          
BLAST of Tissue factor pathway inhibitor vs. UniProt/SwissProt
Match: sp|Q8IUA0|WFDC8_HUMAN (WAP four-disulfide core domain protein 8 OS=Homo sapiens OX=9606 GN=WFDC8 PE=2 SV=2)

HSP 1 Score: 61.2326 bits (147), Expect = 5.706e-11
Identity = 27/67 (40.30%), Postives = 37/67 (55.22%), Query Frame = 1
Query:   73 CFVICFIQTLDCLNKICTKPVERGNCKASMDRFSYSTEHGKCIPFKFTGCRGNENNFINEAACNKIC 273
            CF  C  + +D   + C  PV  GNC     R+ +  ++ +C PFK+ GC GN NNF+NE AC   C
Sbjct:   79 CFFACQKKCMDPFQEPCMLPVRHGNCNHEAQRWHFDFKNYRCTPFKYRGCEGNANNFLNEDACRTAC 145          
BLAST of Tissue factor pathway inhibitor vs. UniProt/SwissProt
Match: sp|P10646|TFPI1_HUMAN (Tissue factor pathway inhibitor OS=Homo sapiens OX=9606 GN=TFPI PE=1 SV=1)

HSP 1 Score: 60.4622 bits (145), Expect = 1.558e-10
Identity = 26/54 (48.15%), Postives = 38/54 (70.37%), Query Frame = 1
Query:  121 CTKPVERGNCKASMDRFSYSTEHGKCIPFKFTGCRGNENNFINEAACNKICSRG 282
            C  P +RG C+A+ +RF Y++  GKC PFK++GC GNENNF ++  C + C +G
Sbjct:  217 CLTPADRGLCRANENRFYYNSVIGKCRPFKYSGCGGNENNFTSKQECLRACKKG 270          
BLAST of Tissue factor pathway inhibitor vs. UniProt/SwissProt
Match: sp|Q28864|TFPI1_MACMU (Tissue factor pathway inhibitor OS=Macaca mulatta OX=9544 GN=TFPI PE=2 SV=1)

HSP 1 Score: 60.4622 bits (145), Expect = 1.653e-10
Identity = 26/54 (48.15%), Postives = 38/54 (70.37%), Query Frame = 1
Query:  121 CTKPVERGNCKASMDRFSYSTEHGKCIPFKFTGCRGNENNFINEAACNKICSRG 282
            C  P +RG C+A+ +RF Y++  GKC PFK++GC GNENNF ++  C + C +G
Sbjct:  217 CLAPADRGLCRANENRFYYNSVIGKCRPFKYSGCGGNENNFTSKRECLRACKKG 270          
BLAST of Tissue factor pathway inhibitor vs. TrEMBL
Match: A0A0N4VWW6 (BPTI/Kunitz inhibitor domain-containing protein OS=Haemonchus placei OX=6290 GN=HPLM_LOCUS1784 PE=4 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 1.646e-12
Identity = 31/74 (41.89%), Postives = 44/74 (59.46%), Query Frame = 1
Query:   58 LVLAICFVICFIQTLDCLNKICTKPVERGNCKASMDRFSYSTEHGKCIPFKFTGCRGNENNFINEAACNKICSR 279
            +++A+  +   + T   L+ IC   +E G C+A+  RF YST   KCI F + GCRGN+NNF  E  C + CSR
Sbjct:    1 MMIAVVVLFTLLTTASALDDICKLDLEVGPCRAAFRRFGYSTTENKCITFIYGGCRGNDNNFETEEECKQKCSR 74          
BLAST of Tissue factor pathway inhibitor vs. TrEMBL
Match: A0A5K3F6A2 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 66.2402 bits (160), Expect = 1.064e-11
Identity = 30/71 (42.25%), Postives = 41/71 (57.75%), Query Frame = 1
Query:   61 VLAICFVICFIQTLDCLNKICTKPVERGNCKASMDRFSYSTEHGKCIPFKFTGCRGNENNFINEAACNKIC 273
            VLA+   IC     + +   C  P+ERG C A M R++Y    G C+PF + GC GN N F ++AAC K+C
Sbjct:    4 VLAL-VAICLASFTEAITSPCYLPIERGMCMAHMKRWAYDATTGLCVPFVYGGCGGNANQFKSKAACRKVC 73          
BLAST of Tissue factor pathway inhibitor vs. TrEMBL
Match: A0A2K5RB57 (Serine peptidase inhibitor, Kunitz type 3 OS=Cebus capucinus imitator OX=1737458 GN=SPINT3 PE=4 SV=1)

HSP 1 Score: 65.4698 bits (158), Expect = 2.565e-11
Identity = 28/57 (49.12%), Postives = 41/57 (71.93%), Query Frame = 1
Query:  103 DCLNKICTKPVERGNCKASMDRFSYSTEHGKCIPFKFTGCRGNENNFINEAACNKIC 273
            D L K+CT P+E+G C+A  +R+ +++E G+C  F + GCRGN+NNF N+  C KIC
Sbjct:   30 DLLPKVCTFPMEKGVCRAYFNRWFFNSEAGECESFVYGGCRGNDNNFANKEECEKIC 86          
BLAST of Tissue factor pathway inhibitor vs. TrEMBL
Match: A0A3S2LXI9 (BPTI/Kunitz inhibitor domain-containing protein OS=Chilo suppressalis OX=168631 GN=evm_008805 PE=4 SV=1)

HSP 1 Score: 65.0846 bits (157), Expect = 2.929e-11
Identity = 29/70 (41.43%), Postives = 40/70 (57.14%), Query Frame = 1
Query:   70 ICFVICFIQTLDCLNKICTKPVERGNCKASMDRFSYSTEHGKCIPFKFTGCRGNENNFINEAACNKICSR 279
            + F++ F+     L K C +P+ERG C A   RF Y+ E  KC  F + GC+GN+N FI    C K+C R
Sbjct:    5 LIFLLAFVAVASALEKRCEEPIERGLCYAYFPRFGYNKEINKCEFFVYGGCQGNDNRFITAEECEKVCQR 74          
BLAST of Tissue factor pathway inhibitor vs. TrEMBL
Match: A0A0F7Z579 (Tissue factor pathway inhibitor OS=Crotalus adamanteus OX=8729 PE=2 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 3.551e-11
Identity = 34/73 (46.58%), Postives = 44/73 (60.27%), Query Frame = 1
Query:   64 LAICFVICFIQTLDCLNKICTKPVERGNCKASMDRFSYSTEHGKCIPFKFTGCRGNENNFINEAACNKICSRG 282
            L  C   C  + L  L  +C  P++RG CKA+  RF Y+   GKC PF +TGC GNENNF +  AC K+C +G
Sbjct:  167 LQECQNTCHDRDLFLLPSLCVMPMDRGLCKANEKRFFYNQTTGKCRPFSYTGCGGNENNFTSRKACVKMCKKG 239          
BLAST of Tissue factor pathway inhibitor vs. Ensembl Cavefish
Match: appb (amyloid beta A4 protein-like [Source:NCBI gene;Acc:103046668])

HSP 1 Score: 65.4698 bits (158), Expect = 4.005e-13
Identity = 25/61 (40.98%), Postives = 36/61 (59.02%), Query Frame = 1
Query:  103 DCLNKICTKPVERGNCKASMDRFSYSTEHGKCIPFKFTGCRGNENNFINEAACNKICSRGV 285
            + +  +C  P  RG C+A++ R+ +  E G+C PF F GC GN NNF +E  C  +CS  V
Sbjct:  305 EVVRAVCWAPPRRGPCRATLSRWYFVAETGRCAPFSFGGCGGNRNNFESEEYCMAVCSSSV 365          
BLAST of Tissue factor pathway inhibitor vs. Ensembl Cavefish
Match: appb (amyloid beta A4 protein-like [Source:NCBI gene;Acc:103046668])

HSP 1 Score: 65.4698 bits (158), Expect = 4.020e-13
Identity = 25/61 (40.98%), Postives = 36/61 (59.02%), Query Frame = 1
Query:  103 DCLNKICTKPVERGNCKASMDRFSYSTEHGKCIPFKFTGCRGNENNFINEAACNKICSRGV 285
            + +  +C  P  RG C+A++ R+ +  E G+C PF F GC GN NNF +E  C  +CS  V
Sbjct:  305 EVVRAVCWAPPRRGPCRATLSRWYFVAETGRCAPFSFGGCGGNRNNFESEEYCMAVCSSSV 365          
BLAST of Tissue factor pathway inhibitor vs. Ensembl Cavefish
Match: aplp2 (amyloid beta precursor like protein 2 [Source:NCBI gene;Acc:103022515])

HSP 1 Score: 60.4622 bits (145), Expect = 2.449e-11
Identity = 24/62 (38.71%), Postives = 36/62 (58.06%), Query Frame = 1
Query:   94 QTLDCLNKICTKPVERGNCKASMDRFSYSTEHGKCIPFKFTGCRGNENNFINEAACNKICSR 279
            +TL  +  +C+   E G C+ASM R+ +  +  KC+ F + GC GN NNF +E  C  +C R
Sbjct:  306 KTLQEVKAVCSLEAETGPCRASMPRWHFDMQQRKCVRFIYGGCAGNRNNFDSEEYCMAVCKR 367          
BLAST of Tissue factor pathway inhibitor vs. Ensembl Cavefish
Match: aplp2 (amyloid beta precursor like protein 2 [Source:NCBI gene;Acc:103022515])

HSP 1 Score: 60.4622 bits (145), Expect = 2.454e-11
Identity = 24/62 (38.71%), Postives = 36/62 (58.06%), Query Frame = 1
Query:   94 QTLDCLNKICTKPVERGNCKASMDRFSYSTEHGKCIPFKFTGCRGNENNFINEAACNKICSR 279
            +TL  +  +C+   E G C+ASM R+ +  +  KC+ F + GC GN NNF +E  C  +C R
Sbjct:  306 KTLQEVKAVCSLEAETGPCRASMPRWHFDMQQRKCVRFIYGGCAGNRNNFDSEEYCMAVCKR 367          
BLAST of Tissue factor pathway inhibitor vs. Ensembl Cavefish
Match: aplp2 (amyloid beta precursor like protein 2 [Source:NCBI gene;Acc:103022515])

HSP 1 Score: 60.4622 bits (145), Expect = 2.458e-11
Identity = 24/62 (38.71%), Postives = 36/62 (58.06%), Query Frame = 1
Query:   94 QTLDCLNKICTKPVERGNCKASMDRFSYSTEHGKCIPFKFTGCRGNENNFINEAACNKICSR 279
            +TL  +  +C+   E G C+ASM R+ +  +  KC+ F + GC GN NNF +E  C  +C R
Sbjct:  306 KTLQEVKAVCSLEAETGPCRASMPRWHFDMQQRKCVRFIYGGCAGNRNNFDSEEYCMAVCKR 367          
BLAST of Tissue factor pathway inhibitor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008261.1 (pep scaffold:Pmarinus_7.0:GL478901:735:1448:1 gene:ENSPMAG00000007479.1 transcript:ENSPMAT00000008261.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 48.1358 bits (113), Expect = 6.480e-8
Identity = 20/53 (37.74%), Postives = 32/53 (60.38%), Query Frame = 1
Query:  115 KICTKPVERGNCKASMDRFSYSTEHGKCIPFKFTGCRGNENNFINEAACNKIC 273
            ++C+ P  +G CKA   R+SY+    +C  F + GC GN N+F + +AC + C
Sbjct:   19 RVCSLPPVQGPCKAWETRWSYNPLGKRCATFLYGGCEGNGNSFASRSACERAC 71          
BLAST of Tissue factor pathway inhibitor vs. Ensembl Sea Lamprey
Match: tfpi2 (tissue factor pathway inhibitor 2 [Source:ZFIN;Acc:ZDB-GENE-060503-38])

HSP 1 Score: 47.7506 bits (112), Expect = 1.115e-7
Identity = 20/53 (37.74%), Postives = 30/53 (56.60%), Query Frame = 1
Query:  115 KICTKPVERGNCKASMDRFSYSTEHGKCIPFKFTGCRGNENNFINEAACNKIC 273
            + C    + GNC+ +  RF Y+ +   C+PF ++GC GN NNFI+   C   C
Sbjct:  145 RECLSRHDTGNCQGNFRRFYYNIQKRSCLPFSYSGCGGNNNNFISAKTCLSTC 197          

HSP 2 Score: 44.669 bits (104), Expect = 1.152e-6
Identity = 19/51 (37.25%), Postives = 29/51 (56.86%), Query Frame = 1
Query:  109 LNKICTKPVERGNCKASMDRFSYSTEHGKCIPFKFTGCRGNENNFINEAAC 261
            + K+C    E G C+A + R+ Y+   G C+PF + GC GN N F +  +C
Sbjct:   83 IPKLCRPDAETGRCRAHITRYFYNMTLGMCMPFVYGGCGGNNNRFEDMESC 133          

HSP 3 Score: 43.5134 bits (101), Expect = 3.468e-6
Identity = 21/60 (35.00%), Postives = 31/60 (51.67%), Query Frame = 1
Query:   97 TLDCLNKICTKPVERGNCKASMDRFSYSTEHGKCIPFKFTGCRGNENNFINEAACNKICS 276
            TL+     CT P + G+C+A+  R+ ++    +C  F + GC  NENNF     C   CS
Sbjct:   19 TLEDQRVTCTLPAKPGDCRAAFPRYFFNRSTLRCESFIYGGCHSNENNFETMQECRAACS 78          
BLAST of Tissue factor pathway inhibitor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005043.1 (pep scaffold:Pmarinus_7.0:GL481015:31246:35903:1 gene:ENSPMAG00000004579.1 transcript:ENSPMAT00000005043.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 46.9802 bits (110), Expect = 1.874e-7
Identity = 21/57 (36.84%), Postives = 32/57 (56.14%), Query Frame = 1
Query:  109 LNKICTKPVERGNCKASMDRFSYSTEHGKCIPFKFTGCRGNENNFINEAACNKICSR 279
            L +IC    + G C A + RF Y+ +   C  F + GC GN+NNF +E +C  +C +
Sbjct:  162 LPRICLMKADPGECTAVIPRFHYNPKTSNCESFTYGGCGGNDNNFSSERSCMSVCGQ 218          
BLAST of Tissue factor pathway inhibitor vs. Ensembl Sea Lamprey
Match: WFIKKN1 (WAP, follistatin/kazal, immunoglobulin, kunitz and netrin domain containing 1 [Source:HGNC Symbol;Acc:HGNC:30912])

HSP 1 Score: 47.3654 bits (111), Expect = 1.912e-7
Identity = 23/68 (33.82%), Postives = 37/68 (54.41%), Query Frame = 1
Query:   70 ICFVICFIQTLDCLNKICTKPVERGNCKASMDRFSYSTEHGKCIPFKFTGCRGNENNFINEAACNKIC 273
            I +  C +  +  +N  C+ PV++G CK    R++Y+    +C  F + GC GNENNF ++  C   C
Sbjct:  357 ITYEECKMACMANINNTCSLPVQQGPCKQWALRWAYNPLIKRCQSFIYGGCEGNENNFQSQELCEDNC 424          
BLAST of Tissue factor pathway inhibitor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009465.1 (pep scaffold:Pmarinus_7.0:GL478507:22936:25713:-1 gene:ENSPMAG00000008558.1 transcript:ENSPMAT00000009465.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 46.9802 bits (110), Expect = 2.112e-7
Identity = 20/46 (43.48%), Postives = 26/46 (56.52%), Query Frame = 1
Query:  142 GNCKASMDRFSYSTEHGKCIPFKFTGCRGNENNFINEAACNKICSR 279
            G C+ S  R++Y      C  F + GCRGN+NNF+ EA C   C R
Sbjct:    8 GPCRGSFTRWTYDAATSTCKEFTYGGCRGNQNNFLEEAECLMDCGR 53          

HSP 2 Score: 45.4394 bits (106), Expect = 7.496e-7
Identity = 22/57 (38.60%), Postives = 29/57 (50.88%), Query Frame = 1
Query:  106 CLNKICTKPVERGNCKASMDRFSYSTEHGKCIPFKFTGCRGNENNFINEAACNKICS 276
            CL +  T P     C+ S  R++Y  E G C  F + GC GN NNF+ E  C  +C 
Sbjct:  166 CLLEAVTSP-----CRGSFTRWTYDAESGHCKEFTYGGCGGNFNNFLEETECVAMCG 217          

HSP 3 Score: 42.743 bits (99), Expect = 5.477e-6
Identity = 21/56 (37.50%), Postives = 26/56 (46.43%), Query Frame = 1
Query:  118 ICTKPVERGNCKASMDRFSYSTEHGKCIPFKFTGCRGNENNFINEAACNKICSRGV 285
            IC      G C+ S  R+ Y  E   C  F + GC GN NNF+ E  C   C R +
Sbjct:   71 ICLLEEAVGPCRGSFTRWIYDAESSNCKEFTYGGCGGNFNNFLEETECMVTCGRSL 126          
BLAST of Tissue factor pathway inhibitor vs. Ensembl Nematostella
Match: EDO40368 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S7B9])

HSP 1 Score: 50.8322 bits (120), Expect = 7.819e-10
Identity = 23/44 (52.27%), Postives = 28/44 (63.64%), Query Frame = 1
Query:  142 GNCKASMDRFSYSTEHGKCIPFKFTGCRGNENNFINEAACNKIC 273
            G+C     R+ Y T  GKC PF +TGC GNENNF+NE  C + C
Sbjct:    8 GSCSRFTVRWFYDTNRGKCAPFVYTGCGGNENNFMNEQKCLETC 51          
BLAST of Tissue factor pathway inhibitor vs. Ensembl Nematostella
Match: EDO31760 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SX09])

HSP 1 Score: 50.0618 bits (118), Expect = 1.683e-9
Identity = 24/53 (45.28%), Postives = 31/53 (58.49%), Query Frame = 1
Query:  121 CTKPVERGNCKASMDRFSYSTEHGKCIPFKFTGCRGNENNFINEAACNKICSR 279
            C  P   G C+AS+ R+ Y+ E  KCI F F GC GN NNF  +++C   C R
Sbjct:    1 CDLPKNPGVCRASIQRWYYNNETRKCIKFTFGGCHGNANNFPTKSSCRNACMR 53          
BLAST of Tissue factor pathway inhibitor vs. Ensembl Nematostella
Match: EDO29819 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T2J6])

HSP 1 Score: 48.9062 bits (115), Expect = 5.531e-9
Identity = 23/54 (42.59%), Postives = 32/54 (59.26%), Query Frame = 1
Query:  112 NKICTKPVERGNCKASMDRFSYSTEHGKCIPFKFTGCRGNENNFINEAACNKIC 273
            N  CT P + G+C+A+M R  ++++ GKC  F + GC GN NNF     C K C
Sbjct:   11 NSACTLPKKVGDCRAAMPRVFFNSQSGKCEDFIYGGCGGNANNFHTMEECKKAC 64          
BLAST of Tissue factor pathway inhibitor vs. Ensembl Nematostella
Match: EDO26072 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TCY8])

HSP 1 Score: 46.595 bits (109), Expect = 5.271e-8
Identity = 22/55 (40.00%), Postives = 31/55 (56.36%), Query Frame = 1
Query:  112 NKICTKPVERGNCKASMDRFSYSTEHGKCIPFKFTGCRGNENNFINEAACNKICS 276
             ++C+ P   G C A   R+ Y     +C  F + GC+GN NNF ++AAC K CS
Sbjct:   12 TQVCSLPKLTGPCMARFIRWHYDMRSSECKMFTYGGCQGNANNFESKAACLKKCS 66          
BLAST of Tissue factor pathway inhibitor vs. Ensembl Nematostella
Match: EDO38466 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCV3])

HSP 1 Score: 46.2098 bits (108), Expect = 5.800e-8
Identity = 22/54 (40.74%), Postives = 31/54 (57.41%), Query Frame = 1
Query:  115 KICTKPVERGNCKASMDRFSYSTEHGKCIPFKFTGCRGNENNFINEAACNKICS 276
            ++C+ P   G C A   R+ Y     +C  F + GC+GN NNF ++AAC K CS
Sbjct:   13 QVCSLPKLTGPCMARFIRWHYDMRSSECKMFTYGGCQGNANNFESKAACLKKCS 66          
BLAST of Tissue factor pathway inhibitor vs. Ensembl Medaka
Match: aplp2 (amyloid beta precursor like protein 2 [Source:NCBI gene;Acc:101168561])

HSP 1 Score: 58.5362 bits (140), Expect = 1.307e-10
Identity = 23/54 (42.59%), Postives = 31/54 (57.41%), Query Frame = 1
Query:  118 ICTKPVERGNCKASMDRFSYSTEHGKCIPFKFTGCRGNENNFINEAACNKICSR 279
            +CT   E G C+ASM R+ +     KC+ F + GC GN NNF +E  C  +C R
Sbjct:  313 VCTLEAETGPCRASMPRWHFDLSQRKCVRFIYGGCAGNRNNFDSEEYCMAVCKR 366          
BLAST of Tissue factor pathway inhibitor vs. Ensembl Medaka
Match: aplp2 (amyloid beta precursor like protein 2 [Source:NCBI gene;Acc:101168561])

HSP 1 Score: 58.5362 bits (140), Expect = 1.310e-10
Identity = 23/54 (42.59%), Postives = 31/54 (57.41%), Query Frame = 1
Query:  118 ICTKPVERGNCKASMDRFSYSTEHGKCIPFKFTGCRGNENNFINEAACNKICSR 279
            +CT   E G C+ASM R+ +     KC+ F + GC GN NNF +E  C  +C R
Sbjct:  313 VCTLEAETGPCRASMPRWHFDLSQRKCVRFIYGGCAGNRNNFDSEEYCMAVCKR 366          
BLAST of Tissue factor pathway inhibitor vs. Ensembl Medaka
Match: aplp2 (amyloid beta precursor like protein 2 [Source:NCBI gene;Acc:101168561])

HSP 1 Score: 58.5362 bits (140), Expect = 1.312e-10
Identity = 23/54 (42.59%), Postives = 31/54 (57.41%), Query Frame = 1
Query:  118 ICTKPVERGNCKASMDRFSYSTEHGKCIPFKFTGCRGNENNFINEAACNKICSR 279
            +CT   E G C+ASM R+ +     KC+ F + GC GN NNF +E  C  +C R
Sbjct:  313 VCTLEAETGPCRASMPRWHFDLSQRKCVRFIYGGCAGNRNNFDSEEYCMAVCKR 366          
BLAST of Tissue factor pathway inhibitor vs. Ensembl Medaka
Match: appb (amyloid-beta A4 protein [Source:NCBI gene;Acc:101172288])

HSP 1 Score: 56.6102 bits (135), Expect = 6.302e-10
Identity = 22/58 (37.93%), Postives = 31/58 (53.45%), Query Frame = 1
Query:  103 DCLNKICTKPVERGNCKASMDRFSYSTEHGKCIPFKFTGCRGNENNFINEAACNKICS 276
            + +  +C    E G C   ++R+ +  E G+C PF F GC GN NNF  E  C  +CS
Sbjct:  280 EVVRAVCWARAESGPCHGMLERWYFEPESGRCAPFLFGGCGGNRNNFETEEYCLAVCS 337          
BLAST of Tissue factor pathway inhibitor vs. Ensembl Medaka
Match: APP (amyloid-beta A4 protein [Source:NCBI gene;Acc:101162104])

HSP 1 Score: 55.4546 bits (132), Expect = 1.617e-9
Identity = 21/58 (36.21%), Postives = 33/58 (56.90%), Query Frame = 1
Query:  103 DCLNKICTKPVERGNCKASMDRFSYSTEHGKCIPFKFTGCRGNENNFINEAACNKICS 276
            + +  +C    E G C+A + R+ +  E G+C+ F + GC GN NNF +E  C  +CS
Sbjct:  324 EVVRDVCWADAETGPCRALLPRWFFDREEGRCVQFIYGGCGGNRNNFESEEYCMSVCS 381          
BLAST of Tissue factor pathway inhibitor vs. Planmine SMEST
Match: SMESG000044323.1 (SMESG000044323.1)

HSP 1 Score: 156.762 bits (395), Expect = 6.210e-51
Identity = 76/76 (100.00%), Postives = 76/76 (100.00%), Query Frame = 1
Query:   58 LVLAICFVICFIQTLDCLNKICTKPVERGNCKASMDRFSYSTEHGKCIPFKFTGCRGNENNFINEAACNKICSRGV 285
            LVLAICFVICFIQTLDCLNKICTKPVERGNCKASMDRFSYSTEHGKCIPFKFTGCRGNENNFINEAACNKICSRGV
Sbjct:    3 LVLAICFVICFIQTLDCLNKICTKPVERGNCKASMDRFSYSTEHGKCIPFKFTGCRGNENNFINEAACNKICSRGV 78          
BLAST of Tissue factor pathway inhibitor vs. Planmine SMEST
Match: SMESG000037999.1 (SMESG000037999.1)

HSP 1 Score: 53.1434 bits (126), Expect = 3.535e-10
Identity = 28/72 (38.89%), Postives = 40/72 (55.56%), Query Frame = 1
Query:   58 LVLAICFVICFIQTLDCLNKICTKPVERGNCKASMDRFSYSTEHGKCIPFKFTGCRGNENNFINEAACNKIC 273
            LVL + F +   Q L+   K C +P + G C+A   RF +++E GKC  F + GC  N NNF  E  C ++C
Sbjct:    8 LVLVVLFSLS--QLLESRLKECNEPKQSGMCEAYFKRFYFNSETGKCETFIYGGCGKNGNNFQTEDECEELC 77          
BLAST of Tissue factor pathway inhibitor vs. Planmine SMEST
Match: SMESG000037999.1 (SMESG000037999.1)

HSP 1 Score: 52.7582 bits (125), Expect = 3.960e-10
Identity = 28/72 (38.89%), Postives = 40/72 (55.56%), Query Frame = 1
Query:   58 LVLAICFVICFIQTLDCLNKICTKPVERGNCKASMDRFSYSTEHGKCIPFKFTGCRGNENNFINEAACNKIC 273
            LVL + F +   Q L+   K C +P + G C+A   RF +++E GKC  F + GC  N NNF  E  C ++C
Sbjct:    6 LVLVVLFSLS--QLLESRLKECNEPKQSGMCEAYFKRFYFNSETGKCETFIYGGCGKNGNNFQTEDECEELC 75          
BLAST of Tissue factor pathway inhibitor vs. Planmine SMEST
Match: SMESG000005324.1 (SMESG000005324.1)

HSP 1 Score: 52.7582 bits (125), Expect = 4.771e-10
Identity = 27/68 (39.71%), Postives = 42/68 (61.76%), Query Frame = 1
Query:   79 VICFIQTLD-CLNKICTKPVERGNCKASMDRFSYSTEHGKCIPFKFTGCRGNENNFINEAACNKICSR 279
            VI  I+  D  L+K+C +P++ G CK ++ R  ++ + GKC  F + GC+GN+NNF   + C K C R
Sbjct:   12 VIFLIEGKDFLLDKLCFQPMDPGPCKGNLVRSYFNKDIGKCEIFSYGGCKGNKNNFPRISDCQKKCMR 79          
BLAST of Tissue factor pathway inhibitor vs. Planmine SMEST
Match: SMESG000037995.1 (SMESG000037995.1)

HSP 1 Score: 51.9878 bits (123), Expect = 8.321e-10
Identity = 28/72 (38.89%), Postives = 39/72 (54.17%), Query Frame = 1
Query:   58 LVLAICFVICFIQTLDCLNKICTKPVERGNCKASMDRFSYSTEHGKCIPFKFTGCRGNENNFINEAACNKIC 273
            LVL + F +   Q L+   K C +P + G C A   RF +++E GKC  F + GC  N NNF  E  C ++C
Sbjct:    8 LVLVVLFSLS--QLLESRLKECNEPKQSGMCMAYFKRFYFNSETGKCETFIYGGCGKNGNNFQTEDECEELC 77          
The following BLAST results are available for this feature:
BLAST of Tissue factor pathway inhibitor vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
WFDC81.188e-1140.30WAP four-disulfide core domain 8 [Source:HGNC Symb... [more]
WFDC81.188e-1140.30WAP four-disulfide core domain 8 [Source:HGNC Symb... [more]
TFPI3.244e-1148.15tissue factor pathway inhibitor [Source:HGNC Symbo... [more]
TFPI3.244e-1148.15tissue factor pathway inhibitor [Source:HGNC Symbo... [more]
SPINT35.693e-1040.35serine peptidase inhibitor, Kunitz type 3 [Source:... [more]
back to top
BLAST of Tissue factor pathway inhibitor vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mlt-111.888e-1043.40pep chromosome:WBcel235:V:20667211:20678513:1 gene... [more]
mlt-111.889e-1043.40pep chromosome:WBcel235:V:20667211:20678513:1 gene... [more]
mlt-112.379e-1043.40pep chromosome:WBcel235:V:20667209:20678513:1 gene... [more]
mlt-114.351e-1043.40pep chromosome:WBcel235:V:20667209:20678513:1 gene... [more]
mlt-115.762e-1043.40pep chromosome:WBcel235:V:20667211:20678513:1 gene... [more]
back to top
BLAST of Tissue factor pathway inhibitor vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG137483.806e-1041.82gene:FBgn0033355 transcript:FBtr0088656[more]
Ppn5.254e-942.59gene:FBgn0003137 transcript:FBtr0301837[more]
Ppn5.572e-942.59gene:FBgn0003137 transcript:FBtr0300337[more]
Acp24A49.363e-936.23gene:FBgn0051779 transcript:FBtr0305673[more]
Acp24A49.363e-936.23gene:FBgn0051779 transcript:FBtr0110767[more]
back to top
BLAST of Tissue factor pathway inhibitor vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
aplp24.972e-1138.71amyloid beta (A4) precursor-like protein 2 [Source... [more]
aplp24.980e-1138.71amyloid beta (A4) precursor-like protein 2 [Source... [more]
appb1.673e-1037.70amyloid beta (A4) precursor protein b [Source:ZFIN... [more]
appb1.674e-1037.70amyloid beta (A4) precursor protein b [Source:ZFIN... [more]
appb1.674e-1037.70amyloid beta (A4) precursor protein b [Source:ZFIN... [more]
back to top
BLAST of Tissue factor pathway inhibitor vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cmtr26.193e-835.09cap methyltransferase 2 [Source:Xenbase;Acc:XB-GEN... [more]
tfpi29.180e-838.18tissue factor pathway inhibitor 2 [Source:NCBI gen... [more]
rlbp11.523e-741.38retinaldehyde binding protein 1 [Source:Xenbase;Ac... [more]
cmtr22.087e-732.73cap methyltransferase 2 [Source:Xenbase;Acc:XB-GEN... [more]
APLP22.189e-734.55amyloid beta (A4) precursor-like protein 2 [Source... [more]
back to top
BLAST of Tissue factor pathway inhibitor vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Spint34.028e-1039.29serine peptidase inhibitor, Kunitz type, 3 [Source... [more]
Wfdc6b1.422e-938.81WAP four-disulfide core domain 6B [Source:MGI Symb... [more]
Wfdc6a6.642e-933.33WAP four-disulfide core domain 6A [Source:MGI Symb... [more]
Wfdc6a6.642e-933.33WAP four-disulfide core domain 6A [Source:MGI Symb... [more]
App7.363e-943.48amyloid beta (A4) precursor protein [Source:MGI Sy... [more]
back to top
BLAST of Tissue factor pathway inhibitor vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P0DN12|VKT8_ANEVI4.379e-1137.50U-actitoxin-Avd3k OS=Anemonia viridis OX=51769 PE=... [more]
sp|P0DN20|VKTG_ANEVI4.694e-1138.57U-actitoxin-Avd3s (Fragment) OS=Anemonia viridis O... [more]
sp|Q8IUA0|WFDC8_HUMAN5.706e-1140.30WAP four-disulfide core domain protein 8 OS=Homo s... [more]
sp|P10646|TFPI1_HUMAN1.558e-1048.15Tissue factor pathway inhibitor OS=Homo sapiens OX... [more]
sp|Q28864|TFPI1_MACMU1.653e-1048.15Tissue factor pathway inhibitor OS=Macaca mulatta ... [more]
back to top
BLAST of Tissue factor pathway inhibitor vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0N4VWW61.646e-1241.89BPTI/Kunitz inhibitor domain-containing protein OS... [more]
A0A5K3F6A21.064e-1142.25Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A2K5RB572.565e-1149.12Serine peptidase inhibitor, Kunitz type 3 OS=Cebus... [more]
A0A3S2LXI92.929e-1141.43BPTI/Kunitz inhibitor domain-containing protein OS... [more]
A0A0F7Z5793.551e-1146.58Tissue factor pathway inhibitor OS=Crotalus adaman... [more]
back to top
BLAST of Tissue factor pathway inhibitor vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
appb4.005e-1340.98amyloid beta A4 protein-like [Source:NCBI gene;Acc... [more]
appb4.020e-1340.98amyloid beta A4 protein-like [Source:NCBI gene;Acc... [more]
aplp22.449e-1138.71amyloid beta precursor like protein 2 [Source:NCBI... [more]
aplp22.454e-1138.71amyloid beta precursor like protein 2 [Source:NCBI... [more]
aplp22.458e-1138.71amyloid beta precursor like protein 2 [Source:NCBI... [more]
back to top
BLAST of Tissue factor pathway inhibitor vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000008261.16.480e-837.74pep scaffold:Pmarinus_7.0:GL478901:735:1448:1 gene... [more]
tfpi21.115e-737.74tissue factor pathway inhibitor 2 [Source:ZFIN;Acc... [more]
ENSPMAT00000005043.11.874e-736.84pep scaffold:Pmarinus_7.0:GL481015:31246:35903:1 g... [more]
WFIKKN11.912e-733.82WAP, follistatin/kazal, immunoglobulin, kunitz and... [more]
ENSPMAT00000009465.12.112e-743.48pep scaffold:Pmarinus_7.0:GL478507:22936:25713:-1 ... [more]
back to top
BLAST of Tissue factor pathway inhibitor vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tissue factor pathway inhibitor vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO403687.819e-1052.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO317601.683e-945.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO298195.531e-942.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO260725.271e-840.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO384665.800e-840.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Tissue factor pathway inhibitor vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
aplp21.307e-1042.59amyloid beta precursor like protein 2 [Source:NCBI... [more]
aplp21.310e-1042.59amyloid beta precursor like protein 2 [Source:NCBI... [more]
aplp21.312e-1042.59amyloid beta precursor like protein 2 [Source:NCBI... [more]
appb6.302e-1037.93amyloid-beta A4 protein [Source:NCBI gene;Acc:1011... [more]
APP1.617e-936.21amyloid-beta A4 protein [Source:NCBI gene;Acc:1011... [more]
back to top
BLAST of Tissue factor pathway inhibitor vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000044323.16.210e-51100.00SMESG000044323.1[more]
SMESG000037999.13.535e-1038.89SMESG000037999.1[more]
SMESG000037999.13.960e-1038.89SMESG000037999.1[more]
SMESG000005324.14.771e-1039.71SMESG000005324.1[more]
SMESG000037995.18.321e-1038.89SMESG000037995.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028151 ID=SMED30028151|Name=Tissue factor pathway inhibitor|organism=Schmidtea mediterranea sexual|type=transcript|length=404bp
AAAAACGATTCAGTAATTTAGTAAAATAAATTCAAAACAAAAACTAACAA
AATGAAATTGGTGCTCGCAATTTGCTTTGTAATCTGCTTCATTCAAACAT
TGGATTGTTTGAATAAAATCTGTACGAAACCAGTTGAACGTGGAAATTGT
AAAGCGAGTATGGATAGATTTTCTTATAGCACGGAGCATGGCAAATGCAT
ACCATTTAAATTTACCGGCTGCAGAGGAAACGAAAATAATTTCATCAATG
AAGCCGCTTGCAATAAGATTTGTTCTCGAGGAGTATGAATGTTAACAAAT
TATTAATAAATTTTTTGTTTTACTTTTCATGAATTGTTATAAATATTGAA
ATAAATTAAATAATTAAATTCAATAAATATATTTAATAAATTGGCTTGTC
CAGC
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005576extracellular region
Vocabulary: biological process
TermDefinition
GO:0007596blood coagulation
GO:0007599hemostasis
GO:0010466negative regulation of peptidase activity
GO:0010951negative regulation of endopeptidase activity
Vocabulary: molecular function
TermDefinition
GO:0030414peptidase inhibitor activity
GO:0004867serine-type endopeptidase inhibitor activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000419prepharyngeal region
PLANA:0002142parenchyma
Vocabulary: INTERPRO
TermDefinition
IPR036880Kunitz_BPTI_sf
IPR002223Kunitz_BPTI
IPR020901Prtase_inh_Kunz-CS
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002223Pancreatic trypsin inhibitor Kunitz domainPRINTSPR00759BASICPTASEcoord: 59..74
score: 43.71
coord: 49..59
score: 48.48
coord: 21..35
score: 32.34
IPR002223Pancreatic trypsin inhibitor Kunitz domainSMARTSM00131KU_2coord: 22..75
e-value: 7.9E-18
score: 75.2
IPR002223Pancreatic trypsin inhibitor Kunitz domainPFAMPF00014Kunitz_BPTIcoord: 23..74
e-value: 2.7E-16
score: 59.5
IPR002223Pancreatic trypsin inhibitor Kunitz domainPROSITEPS50279BPTI_KUNITZ_2coord: 24..74
score: 13.704
IPR002223Pancreatic trypsin inhibitor Kunitz domainCDDcd00109KUcoord: 23..74
e-value: 9.54001E-16
score: 62.2674
IPR036880Pancreatic trypsin inhibitor Kunitz domain superfamilyGENE3DG3DSA:4.10.410.10coord: 20..76
e-value: 1.1E-18
score: 68.9
IPR036880Pancreatic trypsin inhibitor Kunitz domain superfamilySUPERFAMILYSSF57362BPTI-likecoord: 12..75
NoneNo IPR availablePANTHERPTHR10083:SF333SERINE PEPTIDASE INHIBITOR, KUNITZ TYPE, 3coord: 22..74
NoneNo IPR availablePANTHERPTHR10083KUNITZ-TYPE PROTEASE INHIBITOR-RELATEDcoord: 22..74
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..19
score: 0.807
IPR020901Proteinase inhibitor I2, Kunitz, conserved sitePROSITEPS00280BPTI_KUNITZ_1coord: 52..70