RNA polymerase-associated protein CTR9 homolog

Overview
NameRNA polymerase-associated protein CTR9 homolog
Smed IDSMED30028145
Length (bp)3677
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of RNA polymerase-associated protein CTR9 homolog (SMED30028145) t-SNE clustered cells

Violin plots show distribution of expression levels for RNA polymerase-associated protein CTR9 homolog (SMED30028145) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of RNA polymerase-associated protein CTR9 homolog (SMED30028145) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for RNA polymerase-associated protein CTR9 homolog (SMED30028145) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028145

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30028145SMESG000059268.1 SmedASXL_015461SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30028145SMESG000059268.1 SmedASXL_015461SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30028145SMESG000059268.1 dd_Smed_v4_2695_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30028145SMESG000059268.1 dd_Smed_v4_2695_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30028145SMESG000059268.1 dd_Smed_v4_2695_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30028145SMESG000059268.1 dd_Smed_v4_2695_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30028145SMESG000059268.1 dd_Smed_v4_2695_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30028145SMESG000059268.1 dd_Smed_v4_2695_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30028145SMESG000059268.1 dd_Smed_v4_2695_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30028145SMESG000059268.1 SMESG000050099.1 SMESG000004174.1 Contig48890newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30028145SMESG000059268.1 SMESG000050099.1 SMESG000004174.1 Contig48890uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
neoblastSMED30028145SMESG000059268.1 dd_Smed_v6_2695_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of RNA polymerase-associated protein CTR9 homolog vs. Ensembl Human
Match: CTR9 (CTR9 homolog, Paf1/RNA polymerase II complex component [Source:HGNC Symbol;Acc:HGNC:16850])

HSP 1 Score: 1001.12 bits (2587), Expect = 0.000e+0
Identity = 501/856 (58.53%), Postives = 644/856 (75.23%), Query Frame = 3
Query:   27 TIEIPLRDTDEVIELDTDAFPDVDEVLNILKQEVAPMHVWILVALEYYRSKKYNDFVKVLNEANIHASVTYADSEKDQVKVLDMLANYYVKQASXXXXXXXXXXLFGQAAVHFTTADRIAMFDHNHLLSRAFFFLFEGDNWSQVDNQLNFVLNSSPNNVPALLGKSCIAFNKKEYRSALSFYRKALRNHPKCPASVRLGMGHCFFRLGNLEKAKFAFERALALDPECXXXXXXXXXXELNEKTLESVHHGVQKLSKAYMKDSNNPMVLNHLADHFFYAQQYKKVHTLALHAFHYTENELMRAQSCYQIARGFHKEENYDEAFQYYYQATQFASNNFVMPFYGLGQMYLCRKDIENAISSFEKVLKVYPNNYETLKILGSLYAQSDKEDRREQAKKMFQNVTEIEPDDLEAWIEYAQLL-KDDTASSLEAYTKAINLLRQE-NLDIPPEILNNVGVLHHMRKNYDETRKYYSEALERIEEVKTELSNNQDIKQDDVNYYIGLSVTINYNQGRLFEAEYQTDEADLLYKKILTQFPEYLDCHLRLGCMSRDRGQIYDASDWFKDALKVNQDHPDSWSLMGMLHLSKSEAGPAQKKFEFIVRQ--NPNDIFANVALGNIWLNTLFHPSRDKEKEKRHQERALTHYRNVLRVDPKNILAAHGIGAVLAHKGYINEARDVFAQVREATADFPDVWINIAHIYVEQKQYLAAIQMYENCIKKFNKQTNTELLLYLARAHFKCDQLKKCKQVLLKARHIAPWDPLIAYNLAFVQKRWALSVVPDEKSNFSSVLEGINDLNMAQCTFKYLSILKDQI--NIPQLPNEIKDCQDLLSQARYYLDRATKREQQERYMRQKQVEERE 2576
            +IEIPLRDTDEVIELD D  P+ DEV++ILKQE   +H+WI +ALEYY+  K  +FVK+L  A I  ++ Y D EKDQ+  LD LA YYV+QA KEK K+ K++L  QA + +T AD+I M+D NHLL RA F L EGD   Q D Q +FVLN SPNN+PALLGK+CI+FNKK+YR AL++Y+KALR +P CPA VRLGMGHCF +L  LEKA+ AF RAL L+ +CVGALVGLAVLELN K  +S+ +GVQ LS+AY  D +NPMVLNHLA+HFF+ + Y KV  LALHAFH TE E M+A+SCYQ+AR FH +E+YD+AFQYYYQATQFAS++FV+PF+GLGQMY+ R D ENA   FEKVLK YPNNYET+KILGSLYA S+ +++R+ AK   + VTE  PDD+EAWIE AQ+L + D   +L AY  A  +L+++   D+PPEILNNVG LH    N  E +KY+  +L+R    K E  +       D +YY  +SVT +YN  RL+EA  +  EA+ LYK IL + P Y+DC+LRLG M+RD+G  Y+ASDWFK+AL++NQDHPD+WSL+G LHL+K E GP QKKFE I++Q    +D ++ +ALGN+WL TL  P+RD+EKEKRHQ+RAL  Y+ VLR D KN+ AA+GIGAVLAHKGY  EARDVFAQVREATAD  DVW+N+AHIYVEQKQY++A+QMYENC++KF K  NTE++LYLARA FKC +L++CKQ LLKARH+AP D ++ +N+A V +R A SV+ DEKSN   VL  + +L +A   F YLS + D++  ++     E + C DLLSQA+Y++ RA K++++ER +R KQ +E+E
Sbjct:    5 SIEIPLRDTDEVIELDFDQLPEGDEVISILKQEHTQLHIWIALALEYYKQGKTEEFVKLLEAARIDGNLDYRDHEKDQMTCLDTLAAYYVQQARKEKNKDNKKDLITQATLLYTMADKIIMYDQNHLLGRACFCLLEGDKMDQADAQFHFVLNQSPNNIPALLGKACISFNKKDYRGALAYYKKALRTNPGCPAEVRLGMGHCFVKLNKLEKARLAFSRALELNSKCVGALVGLAVLELNNKEADSIKNGVQLLSRAYTIDPSNPMVLNHLANHFFFKKDYSKVQHLALHAFHNTEVEAMQAESCYQLARSFHVQEDYDQAFQYYYQATQFASSSFVLPFFGLGQMYIYRGDKENASQCFEKVLKAYPNNYETMKILGSLYAASEDQEKRDIAKGHLKKVTEQYPDDVEAWIELAQILEQTDIQGALSAYGTATRILQEKVQADVPPEILNNVGALHFRLGNLGEAKKYFLASLDR---AKAEAEH-------DEHYYNAISVTTSYNLARLYEAMCEFHEAEKLYKNILREHPNYVDCYLRLGAMARDKGNFYEASDWFKEALQINQDHPDAWSLIGNLHLAKQEWGPGQKKFERILKQPSTQSDTYSMLALGNVWLQTLHQPTRDREKEKRHQDRALAIYKQVLRNDAKNLYAANGIGAVLAHKGYFREARDVFAQVREATADISDVWLNLAHIYVEQKQYISAVQMYENCLRKFYKHQNTEVVLYLARALFKCGKLQECKQTLLKARHVAPSDTVLMFNVALVLQRLATSVLKDEKSNLKEVLNAVKELELAHRYFSYLSKVGDKMRFDLALAATEARQCSDLLSQAQYHVARARKQDEEERELRAKQEQEKE 850          
BLAST of RNA polymerase-associated protein CTR9 homolog vs. Ensembl Human
Match: CTR9 (CTR9 homolog, Paf1/RNA polymerase II complex component [Source:HGNC Symbol;Acc:HGNC:16850])

HSP 1 Score: 351.288 bits (900), Expect = 4.701e-111
Identity = 190/336 (56.55%), Postives = 234/336 (69.64%), Query Frame = 3
Query:   54 DEVIELDTDAFPDVDEVLNILKQEVAPMHVWILVALEYYRSKKYNDFVKVLNEANIHASVTYADSEKDQVKVLDMLANYYVKQASXXXXXXXXXXLFGQAAVHFTTADRIAMFDHNHLLSRAFFFLFEGDNWSQVDNQLNFVLNSSPNNVPALLGKSCIAFNKKEYRSALSFYRKALRNHPKCPASVRLGMGHCFFRLGNLEKAKFAFERALALDPECXXXXXXXXXXELNEKTLESVHHGVQKLSKAYMKDSNNPMVLNHLADHFFYAQQYKKVHTLALHAFHYTENELMRAQSCYQIARGFHKEENYDEAFQYYYQATQFASNNFVMPFYGLGQ 1061
            DEVIELD D  P+ DEV++ILKQE   +H+WI +ALEYY+  K  +FVK+L  A I  ++ Y D EKDQ+  LD LA YYV+QA KEK K+ K++L  QA + +T AD+I M+D NHLL RA F L EGD   Q D Q +FVLN SPNN+PALLGK+CI+FNKK+YR AL++Y+KALR +P CPA VRLGMGHCF +L  LEKA+ AF RAL L+ +CVGALVGLAVLELN K                                    + Y KV  LALHAFH TE E M+A+SCYQ+AR FH +E+YD+AFQYYYQATQFAS++FV+PF+GLGQ
Sbjct:    1 DEVIELDFDQLPEGDEVISILKQEHTQLHIWIALALEYYKQGKTEEFVKLLEAARIDGNLDYRDHEKDQMTCLDTLAAYYVQQARKEKNKDNKKDLITQATLLYTMADKIIMYDQNHLLGRACFCLLEGDKMDQADAQFHFVLNQSPNNIPALLGKACISFNKKDYRGALAYYKKALRTNPGCPAEVRLGMGHCFVKLNKLEKARLAFSRALELNSKCVGALVGLAVLELNNK------------------------------------EDYSKVQHLALHAFHNTEVEAMQAESCYQLARSFHVQEDYDQAFQYYYQATQFASSSFVLPFFGLGQ 300          
BLAST of RNA polymerase-associated protein CTR9 homolog vs. Ensembl Human
Match: TMTC3 (transmembrane O-mannosyltransferase targeting cadherins 3 [Source:HGNC Symbol;Acc:HGNC:26899])

HSP 1 Score: 63.929 bits (154), Expect = 1.768e-9
Identity = 91/433 (21.02%), Postives = 177/433 (40.88%), Query Frame = 3
Query:  765 VHHGVQKLS-KAYMKDSN----NPMVLNHLADHFFYAQQYKKVHTLALHAFHYTENELMRAQSCYQIARGFHKEENYDEAFQYYYQATQFASNNFVMPFYGLGQMY--------------LCRKDIENAISSFEKVLKVYPNNYETLKILGSLYAQSDKEDRREQAKKMFQNVTEIEPDDLEAWIEYAQLL--KDDTASSLEAYTKAINLLRQENLDIPPEILNNVGVLHHMRKNYDETRKYYSEALERIEEVKTELSNNQDIKQDDVNYYIGLSVTINYNQGRLFEAEYQTDEADLLYKKILTQFPEYLDCHLRLGCMSRDRGQIYDASDWFKDALKVNQDHPDSWSLMGMLHLSKSEAGPAQKKFEFIVRQNPNDIFANVALGNIWLNTLFHPSRDKEKEKRHQERALTHYRNVLRVDPKNILAAHGIGAV 2000
            V HG QK+S K+  K  +    + ++L H    F     ++  +TL + A    +N    A+    +      E+N++ A +Y+ QAT    ++ +     +G+ Y              + +  +   I   +   ++ PN+      L +L   +  E R E+A ++++    + PD  +A+I   +LL   +    + EAY KA+ L R        ++  N+ ++H   K  +E  K ++ ALE   + K  L N+  + Q+                    E + + +    L   I  + P   + +  LG ++ D  +  +A  W K A+K+  D   +   + +L+   ++   A    E ++R  P+ I   +  G+I +N      +D    K+  ER       +L +DP N+   H +  V
Sbjct:  389 VAHGWQKISTKSVFKKLSWICLSMVILTHSLKTFHRNWDWESEYTLFMSALKVNKNN---AKLWNNVGHALENEKNFERALKYFLQATHVQPDD-IGAHMNVGRTYKNLNRTKEAEESYMMAKSLMPQIIPGKKYAARIAPNHLNVYINLANLIRAN--ESRLEEADQLYRQAISMRPDFKQAYISRGELLLKMNKPLKAKEAYLKALELDRNN-----ADLWYNLAIVHIELKEPNEALKNFNRALELNPKHKLALFNSAIVMQES------------------GEVKLRPEARKRLLSYI-NEEPLDANGYFNLGMLAMDDKKDNEAEIWMKKAIKLQADFRSALFNLALLYSQTAKELKALPILEELLRYYPDHIKGLILKGDILMNQ----KKDILGAKKCFER-------ILEMDPSNVQGKHNLCVV 780          

HSP 2 Score: 55.4546 bits (132), Expect = 7.785e-7
Identity = 78/362 (21.55%), Postives = 147/362 (40.61%), Query Frame = 3
Query: 1080 DIENAISSFEKVLKVYPNNYETLKILGSLYAQSDKEDRREQAKKMFQNVTEIEPDDLEAWIEYAQLLKD--DTASSLEAYTKAINLLRQENLDIPPEILNNVGVLHHMRKNYDETRKYYSEALERIEEVKTELSNNQDIKQDDVNYYIGLSVTINYNQGRLFEAEYQTDEADLLYKKILTQFPEYLDCHLRLGCMSRDRGQIYDASDWFKDALKVNQDHPDSWSLMGMLHLSKSEAGPAQKKFEFIVRQNPNDIFANVALGNIWLNTLFHPSRDKEKEKRHQERALTHYRNVLRVDPKNILAAHGIGAVLAHKGYINEARDVFAQVREATADFPDVWINIAHIYVEQKQYLAAIQMYENCIK 2159
            D E+  + F   LKV  NN    K+  ++    + E   E+A K F   T ++PDD+ A +   +  K+   T  + E+Y  A +L+        P+I+                +KY +                  I  + +N YI L+  I  N+ RL       +EAD LY++ ++  P++   ++  G +     +   A + +  AL++++++ D W  + ++H+   E   A K F   +  NP      +AL N   + +      + K +    + L  Y N    +P +      +G +       NEA     +  +  ADF     N+A +Y +  + L A+ + E  ++
Sbjct:  427 DWESEYTLFMSALKVNKNNA---KLWNNVGHALENEKNFERALKYFLQATHVQPDDIGAHMNVGRTYKNLNRTKEAEESYMMAKSLM--------PQIIPG--------------KKYAAR-----------------IAPNHLNVYINLANLIRANESRL-------EEADQLYRQAISMRPDFKQAYISRGELLLKMNKPLKAKEAYLKALELDRNNADLWYNLAIVHIELKEPNEALKNFNRALELNPKH---KLALFN---SAIVMQESGEVKLRPEARKRLLSYIN---EEPLDANGYFNLGMLAMDDKKDNEAEIWMKKAIKLQADFRSALFNLALLYSQTAKELKALPILEELLR 730          
BLAST of RNA polymerase-associated protein CTR9 homolog vs. Ensembl Human
Match: OGT (O-linked N-acetylglucosamine (GlcNAc) transferase [Source:HGNC Symbol;Acc:HGNC:8127])

HSP 1 Score: 59.6918 bits (143), Expect = 3.723e-8
Identity = 81/397 (20.40%), Postives = 156/397 (39.29%), Query Frame = 3
Query:  984 EAFQYYYQATQFASNNFVMPFYGLGQMYLCRKDIENAISSFEKVLKVYPNNYETLKILGSLYAQSDKEDRREQAKKMFQNVTEIEPDDLEAWIEYAQLL--KDDTASSLEAYTKAINLLRQENLDIPPEILN---NVGVLHHMRKNYDETRKYYSEALERIEEVKTELSNNQDIKQDDVNYYIGLSVTINYNQGRLFEAEYQTDEADLLYKKILTQFPEYLDCHLRLGCMSRDRGQIYDASDWFKDALKVNQDHPDSWSLMGMLHLSKSEAGPAQKKFEFIVRQNPNDIFANVALGNIWLNTLFHPSRDKEKEKRHQERALTHYRNVLRVDPKNILAAHGIGAVLAHKGYINEARDVFAQVREATADFPDVWINIAHIYVEQKQYLAAIQMYENCIK 2159
            EA ++Y  A +   + F+  +  L    +   D+E A+ ++   L+  P+ Y     LG+L        R E+AK  +    E +P+   AW     +   + +   ++  + KA+ L         P  L+   N+G +    + +D     Y  AL         LS N  +   ++         + Y QG +       D A   Y++ +   P + D +  L    +++G + +A D +  AL++   H DS + +  +   K E G  ++       +   ++F   A  +  L ++       +++ + QE AL HY+  +R+ P    A   +G  L     +  A   + +  +    F D   N+A I+ +      AI  Y   +K
Sbjct:   97 EAIEHYRHALRLKPD-FIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLL---KALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTL--------DPNFLDAYINLGNVLKEARIFDRAVAAYLRAL--------SLSPNHAVVHGNL-------ACVYYEQGLI-------DLAIDTYRRAIELQPHFPDAYCNLANALKEKGSVAEAEDCYNTALRLCPTHADSLNNLANI---KREQGNIEEAVRLY--RKALEVFPEFAAAHSNLASVL------QQQGKLQE-ALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALK 447          

HSP 2 Score: 59.6918 bits (143), Expect = 4.228e-8
Identity = 87/394 (22.08%), Postives = 154/394 (39.09%), Query Frame = 3
Query: 1362 EILNNVGVLHHMRKNYDETRKYYSEALERIEEVKTELSNNQDIKQDDVNYYIGLSVTINYNQGRLFEAEYQTDEADLLYKKILTQFPEYLDCHLRLGCMSRDRGQIYDASDWFKDALKVNQDHPDSWSLMGMLHLSKSEAGPAQKKFEFIVRQNPNDIFANVALGNIWLNTLFHPSRDKEKEKRHQERALTHYRNVLRVDPKNILAAHGIGAVLAHKGYINEARDVFAQVREATADFPDVWINIAHIYVEQKQYLAAIQMYENCIKKFNKQTNTELLLYLARAHFKCDQLKKCKQVLLKARHIAPWDPLIAYNLAFVQK------------RWALSVVP---DEKSNFSSVLEGINDLNMA-QCTFKYL--------------SILKDQINIPQ 2453
            E  +N+G ++  R    E  ++Y  AL               +K D ++ YI L+  +         A    + A   Y   L   P+       LG + +  G++ +A   +  A++   +   +WS +G +  ++ E   A   FE  V  +PN + A + LGN+             KE R  +RA+  Y   L + P + +    +  V   +G I+ A D + +  E    FPD + N+A+   E+     A   Y   ++     T+ + L  LA    +   +++  ++  KA  + P       NLA V +            + A+ + P   D  SN  + L+ + D+  A QC  + +              SI KD  NIP+
Sbjct:   80 EAYSNLGNVYKERGQLQEAIEHYRHALR--------------LKPDFIDGYINLAAAL--------VAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVL------------KEARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANALKEKGSVAEAEDCYNTALRLC--PTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPE 437          

HSP 3 Score: 58.5362 bits (140), Expect = 8.473e-8
Identity = 84/378 (22.22%), Postives = 149/378 (39.42%), Query Frame = 3
Query:  981 DEAFQYYYQATQFASNNFVMPFYGLGQMYLCRKDIENAISSFEKVLKVYPNNYETLKILGSLYAQSDKEDRREQAKKMFQNVTEIEPDDLE-----AWIEYAQLLKDDTASSLEAYTKAINLLRQENLDIPPEILNNVGVLHHMRKNYDETRKYYSEALERIEEVKTELSNNQDIKQDDVNYYIGLSVTINYNQGRLFEAEYQTDEADLLYKKILTQFPEYLDCHLRLGCMSRDRGQIYDASDWFKDALKVNQDHPDSWSLMGMLHLSKSEAGPAQKKFEFIVRQNPNDIFANVALGNIWLNTLFHPSRDKEKEKRHQERALTHYRNVLRVDPKNILAAHGIGAVLAHKGYINEARDVFAQVREATADFPDVWINIAH 2099
            +EA   Y +A +    NF + +  LG ++  + +I  AI  FEK + + PN  +    LG++  ++   DR   A   +     + P+        A + Y Q L D    +++ Y +AI L  Q +    P+   N+      + +  E    Y+ AL         L+N  +IK++               QG +       +EA  LY+K L  FPE+   H  L  + + +G++ +A   +K+A++++    D++S MG                                      NTL        KE +  + AL  Y   ++++P    A   + ++    G I EA   +    +   DFPD + N+AH
Sbjct:  164 EEAKACYLKAIE-TQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDR---AVAAYLRALSLSPNHAVVHGNLACVYYEQGLID---LAIDTYRRAIEL--QPHF---PDAYCNLANALKEKGSVAEAEDCYNTALRLCPTHADSLNNLANIKRE---------------QGNI-------EEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMG--------------------------------------NTL--------KEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAH 461          

HSP 4 Score: 56.9954 bits (136), Expect = 2.729e-7
Identity = 88/431 (20.42%), Postives = 169/431 (39.21%), Query Frame = 3
Query:  492 PNNVPALLGKSCIAFNKKEYRSALSFYRKALRNHPKCPASVRLGMGHCFFRLGNLEKAKFAFERALALDPECXXXXXXXXXXELNEKTLESVHHGVQKLSKAYMKDSNNPMVLNHLADHFFYAQQYKKVHTLALHAFHYTENELMRAQSCYQIARGFHKEENYDEAFQYYYQATQFASNNFVMPFYGLGQMYLCRKDIENAISSFEKVLKVYPNNYETLKILGSLYAQSDKEDRREQAKKMFQNVTEIEPDDLEAWIEYAQLLKD--DTASSLEAYTKAINLLRQENLDIPPEILNNVGVLHHMRKNYDETRKYYSEALERIEEVKTELSNNQDIKQDD-------VNYYIGLSVTINY-----NQGRLFEAEYQTDEADLLYKKILTQFPEYLDCHLRLGCMSRDRGQIYDASDWFKDALKVNQDHPDSW 1742
            P+N   LL  S I F  +    +  F   A++ +P   A     +G+ +   G L++A   +  AL L P+ +   + LA   +    +E     VQ    A   + +   V + L +      + ++     L A     N    A +   +   F+ +     A  ++ +A      NF+  +  LG +    +  + A++++ + L + PN+      L  +Y +    D    A   ++   E++P   +A+   A  LK+    A + + Y  A+ L          + LNN+  +   + N +E  + Y +ALE   E     SN   + Q         ++Y   + ++  +     N G   +       A   Y + +   P + D H  L  + +D G I +A   ++ ALK+  D PD++
Sbjct:   42 PDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPLL-AEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDMEG---AVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPN---FAVAWSNLGCVFNAQGEIWLAIHHFEKAVTL-DPNFLDAYINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDL---AIDTYRRAIELQPHFPDAYCNLANALKEKGSVAEAEDCYNTALRLCPTH-----ADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAY 456          
BLAST of RNA polymerase-associated protein CTR9 homolog vs. Ensembl Human
Match: OGT (O-linked N-acetylglucosamine (GlcNAc) transferase [Source:HGNC Symbol;Acc:HGNC:8127])

HSP 1 Score: 59.6918 bits (143), Expect = 3.896e-8
Identity = 81/397 (20.40%), Postives = 156/397 (39.29%), Query Frame = 3
Query:  984 EAFQYYYQATQFASNNFVMPFYGLGQMYLCRKDIENAISSFEKVLKVYPNNYETLKILGSLYAQSDKEDRREQAKKMFQNVTEIEPDDLEAWIEYAQLL--KDDTASSLEAYTKAINLLRQENLDIPPEILN---NVGVLHHMRKNYDETRKYYSEALERIEEVKTELSNNQDIKQDDVNYYIGLSVTINYNQGRLFEAEYQTDEADLLYKKILTQFPEYLDCHLRLGCMSRDRGQIYDASDWFKDALKVNQDHPDSWSLMGMLHLSKSEAGPAQKKFEFIVRQNPNDIFANVALGNIWLNTLFHPSRDKEKEKRHQERALTHYRNVLRVDPKNILAAHGIGAVLAHKGYINEARDVFAQVREATADFPDVWINIAHIYVEQKQYLAAIQMYENCIK 2159
            EA ++Y  A +   + F+  +  L    +   D+E A+ ++   L+  P+ Y     LG+L        R E+AK  +    E +P+   AW     +   + +   ++  + KA+ L         P  L+   N+G +    + +D     Y  AL         LS N  +   ++         + Y QG +       D A   Y++ +   P + D +  L    +++G + +A D +  AL++   H DS + +  +   K E G  ++       +   ++F   A  +  L ++       +++ + QE AL HY+  +R+ P    A   +G  L     +  A   + +  +    F D   N+A I+ +      AI  Y   +K
Sbjct:  107 EAIEHYRHALRLKPD-FIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLL---KALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTL--------DPNFLDAYINLGNVLKEARIFDRAVAAYLRAL--------SLSPNHAVVHGNL-------ACVYYEQGLI-------DLAIDTYRRAIELQPHFPDAYCNLANALKEKGSVAEAEDCYNTALRLCPTHADSLNNLANI---KREQGNIEEAVRLY--RKALEVFPEFAAAHSNLASVL------QQQGKLQE-ALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALK 457          

HSP 2 Score: 59.6918 bits (143), Expect = 4.064e-8
Identity = 87/394 (22.08%), Postives = 154/394 (39.09%), Query Frame = 3
Query: 1362 EILNNVGVLHHMRKNYDETRKYYSEALERIEEVKTELSNNQDIKQDDVNYYIGLSVTINYNQGRLFEAEYQTDEADLLYKKILTQFPEYLDCHLRLGCMSRDRGQIYDASDWFKDALKVNQDHPDSWSLMGMLHLSKSEAGPAQKKFEFIVRQNPNDIFANVALGNIWLNTLFHPSRDKEKEKRHQERALTHYRNVLRVDPKNILAAHGIGAVLAHKGYINEARDVFAQVREATADFPDVWINIAHIYVEQKQYLAAIQMYENCIKKFNKQTNTELLLYLARAHFKCDQLKKCKQVLLKARHIAPWDPLIAYNLAFVQK------------RWALSVVP---DEKSNFSSVLEGINDLNMA-QCTFKYL--------------SILKDQINIPQ 2453
            E  +N+G ++  R    E  ++Y  AL               +K D ++ YI L+  +         A    + A   Y   L   P+       LG + +  G++ +A   +  A++   +   +WS +G +  ++ E   A   FE  V  +PN + A + LGN+             KE R  +RA+  Y   L + P + +    +  V   +G I+ A D + +  E    FPD + N+A+   E+     A   Y   ++     T+ + L  LA    +   +++  ++  KA  + P       NLA V +            + A+ + P   D  SN  + L+ + D+  A QC  + +              SI KD  NIP+
Sbjct:   90 EAYSNLGNVYKERGQLQEAIEHYRHALR--------------LKPDFIDGYINLAAAL--------VAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVL------------KEARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANALKEKGSVAEAEDCYNTALRLC--PTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPE 447          

HSP 3 Score: 58.5362 bits (140), Expect = 9.016e-8
Identity = 84/378 (22.22%), Postives = 149/378 (39.42%), Query Frame = 3
Query:  981 DEAFQYYYQATQFASNNFVMPFYGLGQMYLCRKDIENAISSFEKVLKVYPNNYETLKILGSLYAQSDKEDRREQAKKMFQNVTEIEPDDLE-----AWIEYAQLLKDDTASSLEAYTKAINLLRQENLDIPPEILNNVGVLHHMRKNYDETRKYYSEALERIEEVKTELSNNQDIKQDDVNYYIGLSVTINYNQGRLFEAEYQTDEADLLYKKILTQFPEYLDCHLRLGCMSRDRGQIYDASDWFKDALKVNQDHPDSWSLMGMLHLSKSEAGPAQKKFEFIVRQNPNDIFANVALGNIWLNTLFHPSRDKEKEKRHQERALTHYRNVLRVDPKNILAAHGIGAVLAHKGYINEARDVFAQVREATADFPDVWINIAH 2099
            +EA   Y +A +    NF + +  LG ++  + +I  AI  FEK + + PN  +    LG++  ++   DR   A   +     + P+        A + Y Q L D    +++ Y +AI L  Q +    P+   N+      + +  E    Y+ AL         L+N  +IK++               QG +       +EA  LY+K L  FPE+   H  L  + + +G++ +A   +K+A++++    D++S MG                                      NTL        KE +  + AL  Y   ++++P    A   + ++    G I EA   +    +   DFPD + N+AH
Sbjct:  174 EEAKACYLKAIE-TQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDR---AVAAYLRALSLSPNHAVVHGNLACVYYEQGLID---LAIDTYRRAIEL--QPHF---PDAYCNLANALKEKGSVAEAEDCYNTALRLCPTHADSLNNLANIKRE---------------QGNI-------EEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMG--------------------------------------NTL--------KEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAH 471          

HSP 4 Score: 56.6102 bits (135), Expect = 2.953e-7
Identity = 88/431 (20.42%), Postives = 169/431 (39.21%), Query Frame = 3
Query:  492 PNNVPALLGKSCIAFNKKEYRSALSFYRKALRNHPKCPASVRLGMGHCFFRLGNLEKAKFAFERALALDPECXXXXXXXXXXELNEKTLESVHHGVQKLSKAYMKDSNNPMVLNHLADHFFYAQQYKKVHTLALHAFHYTENELMRAQSCYQIARGFHKEENYDEAFQYYYQATQFASNNFVMPFYGLGQMYLCRKDIENAISSFEKVLKVYPNNYETLKILGSLYAQSDKEDRREQAKKMFQNVTEIEPDDLEAWIEYAQLLKD--DTASSLEAYTKAINLLRQENLDIPPEILNNVGVLHHMRKNYDETRKYYSEALERIEEVKTELSNNQDIKQDD-------VNYYIGLSVTINY-----NQGRLFEAEYQTDEADLLYKKILTQFPEYLDCHLRLGCMSRDRGQIYDASDWFKDALKVNQDHPDSW 1742
            P+N   LL  S I F  +    +  F   A++ +P   A     +G+ +   G L++A   +  AL L P+ +   + LA   +    +E     VQ    A   + +   V + L +      + ++     L A     N    A +   +   F+ +     A  ++ +A      NF+  +  LG +    +  + A++++ + L + PN+      L  +Y +    D    A   ++   E++P   +A+   A  LK+    A + + Y  A+ L          + LNN+  +   + N +E  + Y +ALE   E     SN   + Q         ++Y   + ++  +     N G   +       A   Y + +   P + D H  L  + +D G I +A   ++ ALK+  D PD++
Sbjct:   52 PDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPLL-AEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDMEG---AVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPN---FAVAWSNLGCVFNAQGEIWLAIHHFEKAVTL-DPNFLDAYINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDL---AIDTYRRAIELQPHFPDAYCNLANALKEKGSVAEAEDCYNTALRLCPTH-----ADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAY 466          
BLAST of RNA polymerase-associated protein CTR9 homolog vs. Ensembl Celegans
Match: ctr-9 (RNA polymerase-associated protein CTR9 [Source:UniProtKB/Swiss-Prot;Acc:Q03560])

HSP 1 Score: 627.476 bits (1617), Expect = 0.000e+0
Identity = 356/875 (40.69%), Postives = 548/875 (62.63%), Query Frame = 3
Query:   27 TIEIPLRDT--DEVIELDTDAFPDVDEVLNILKQEVAPMHVWILVALEYYRSKKYNDFVKVLNEANIHASVTYADSEKDQVKVLDMLANYYVKQASXXXXXXXXXXLFGQAAVHFTTADRIAMFDHNHLLSRAFFFLFEGDN----WSQVDNQLNFVLNSSPNNVPALLGKSCIAFNKKEYRSALSFYRKALRNHPKCPASVRLGMGHCFFRLGNLEKAKFAFERALALDPECXXXXXXXXXXELNEKTLESVHHGVQKLSKAYMKDSNNPMVLNHLADHFFYAQQYKKVHTLALHAFHYTENELMRAQSCYQIARGFHKEENYDEAFQYYYQATQFASNNFVMPFYGLGQMYLCRKDIENAISSFEKVLKVYPNNYETLKILGSLYAQSDKED------RREQAKKMFQNVTEIEPDDLEAWIEYAQLLK-DDTASSLEAYTKAINLL-RQENLDIPPEILNNVGVLHHMRKNYDETRKYYSEALERIEEVKTELSNNQDIKQDDVNYYIGLSVTINYNQGRLFEAEYQTDEADLLYKKILTQFPEYLDCHLRLGCMSRDRGQIYDASDWFKDALKVNQDHPDSWSLMGMLHLSKSEAGPAQKKFEFIVRQNPN----DIFANVALGNIWLNTLFHPSRDKEKEKRHQERALTHYRNVLRVDPKNILAAHGIGAVLAHKGYINEARDVFAQVREATADFPDVWINIAHIYVEQKQYLAAIQMYENCIKKFNKQTNTELLLYLARAHFKCDQLKKCKQVLLKARHIAPWDPLIAYNLAFVQKRWALSVVPDEKSNFSSVLEGINDLNMAQCTFKYLSILKD--------QINIPQLPNEIKDCQDLLSQARYYLDRATKREQQERYMRQKQVEER 2573
            TI IPL+D+  DEVIE++    PD +EVL IL+ E A +  WI VALEYYR  + + F+ +L  A   A + Y   ++DQ++ LD+LA Y++ Q  +EK K+KK + F +A V F TAD+IAM++ +HL  RA+F+LFE D     +   D Q N+V+ ++P NV  L+GK+ IAFNKK+Y++A+ ++RKA+R      A +R+G+GHCF ++G ++KAK AFERA+ ++P  V A+ GL ++ LN    +S+ H V    ++Y   +++P+ L HLA+HFF+ ++ ++  TLA HA  Y + + ++A++ YQ+ R  H +  +D A++YYYQA Q  +    +  YGLGQMY+ R +IE AI  F+ V K  PNN +T+KILGSLYA     D       R++ + +      +E DD EA I+ AQLL+  D   SLE Y  AI+LL   E++   PE+LNNVG L+   K Y++   ++  A ER+EE       +  +++        L +TI YN     E   +T EA+ +YK I+ + P Y+D +LRLGC++RDR Q+Y++S W K  ++ +Q  P  W+L+G LH +K+E  PAQKKFEFI+ +  N    D ++ VALGN+W   L +PSR KE EK++ +RAL  Y+  L++ PKN+ AA+GIG VLA+K   N+ARDVF+QVRE+T++F DVW+NIAH+ +E++Q++AA+QMY + +KKF K+ ++ L  YLA+A+++ + L + K+ L  A      +  + +N A V K+ A  V+   K     V   I+DL  A   F+Y+S   D        +I+      E K+C+DLL+QA++ L  A  ++++ER + +KQ +E+
Sbjct:   13 TIAIPLKDSHEDEVIEINCSELPDGEEVLQILEAEEAKLSYWIEVALEYYRQDRVDLFMMILESAGSRAGLEYEGVKQDQMRALDILAAYWMTQGYREKAKDKKSDFFSKATVLFNTADKIAMYEWSHLTVRAWFYLFERDKSTNKYELADQQFNYVVKTNPKNVLPLIGKAVIAFNKKDYKTAIYYFRKAIRQCRHTIADLRVGIGHCFAKMGMMDKAKTAFERAMEIEPYNVSAMCGLGIILLNTYDHDSLKHAVSLFGRSYNLQTDHPVALIHLANHFFFKKEIERAWTLAWHAATYNDCDSIKAEAFYQMGRCRHAQGQFDGAYKYYYQARQANNGEHTLAHYGLGQMYIHRNEIEEAIKCFDTVHKRLPNNTDTMKILGSLYAHVQLNDPAQTAEARQKGRDVLGKYLAVENDDYEACIDLAQLLEATDPKRSLELYENAIDLLVTNESIQPQPEMLNNVGALYMSMKQYEKAEHHFKRAKERLEEQLNTDEGSLLLERRSAPEKSHL-LTIRYNLALCLEHLCRTVEAEQMYKDIVKECPGYIDGYLRLGCITRDRHQVYESSLWLKQGVQFDQASPIVWTLIGNLHFAKNEWMPAQKKFEFILSKIFNNKIPDPYSLVALGNVWFEQLLNPSRKKEDEKKYIDRALQMYQKALKLQPKNMYAANGIGCVLAYKRNWNDARDVFSQVRESTSEFYDVWLNIAHVCMEREQWMAAVQMYSSAMKKFRKENDSTLQHYLAKAYYRANMLNEAKEALECAMLDQLDNTQLKFNYAIVLKKSAKEVLRGHKMTSEQVTAAIDDLKFADKIFQYISKNDDRQSSHTGMRISRTICAEEAKNCKDLLTQAKHKLAAAQTQDEEERRLMEKQEKEK 886          
BLAST of RNA polymerase-associated protein CTR9 homolog vs. Ensembl Celegans
Match: ogt-1 (UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase [Source:UniProtKB/Swiss-Prot;Acc:O18158])

HSP 1 Score: 58.151 bits (139), Expect = 4.541e-8
Identity = 87/409 (21.27%), Postives = 153/409 (37.41%), Query Frame = 3
Query: 1245 DLEAWIEYAQLLKDDTASSLEAYTKAINLLRQENLDIPPEILNNVGVLHHMRKNYDETRKYYSEALERIEEVKTELSNNQDIKQDDVNYYIGLSV-----TINYNQGRLFEAEYQTDEADLLYKKILTQFPEYLDCHLRLGCMSRDRGQIYDASDWFKDALKVNQDHPDSWSLMGMLHLSKSEAGPAQKKFEFIVRQNPNDIFANVALGNIWLNTLFHPSRDKEKEKRHQERALTHYRNVLRVDPKNILAAHGIGAVLAHKGYINEARDVFAQVREATADFPDVWINIAHIYVEQKQYLAAIQMY----ENCIKKFNKQTNTELLLYLARAHFKCDQLKKCKQVLLKARHIAPWDPLIAYNLAFVQK------------RWALSVVP---DEKSNFSSVLEGINDLNMA 2399
            +LE  ++Y+ L         EAY+   N  +++            G L    +NY    K   E ++    +   L +  D++Q    Y+  L +      +  + G L +A  + +EA + Y K +   P++      LGC+   +G+I     W                              A   FE  V  +PN + A + LGN+             KE R  +RA++ Y   L +   + +    +  V   +G I+ A D + +  +    FPD + N+A+   E+   + A QMY    E C    + Q N      LA    +  +++   ++ LKA  I P       NLA + +            + A+ + P   D  SN  + L+ + D + A
Sbjct:  174 NLEKSMQYSMLAIKVNNQCAEAYSNLGNYYKEK------------GQLQDALENYKLAVKLKPEFIDAYINLAAALVSGGDLEQAVTAYFNALQINPDLYCVRSDLGNLLKAMGRLEEAKVCYLKAIETQPQFAVAWSNLGCVFNSQGEI-----WL-----------------------------AIHHFEKAVTLDPNFLDAYINLGNVL------------KEARIFDRAVSAYLRALNLSGNHAVVHGNLACVYYEQGLIDLAIDTYKKAIDLQPHFPDAYCNLANALKEKGSVVEAEQMYMKALELCPTHADSQNN------LANIKREQGKIEDATRLYLKALEIYPEFAAAHSNLASILQQQGKLNDAILHYKEAIRIAPTFADAYSNMGNTLKEMGDSSAA 518          

HSP 2 Score: 55.4546 bits (132), Expect = 3.265e-7
Identity = 77/381 (20.21%), Postives = 147/381 (38.58%), Query Frame = 3
Query: 1032 FVMPFYGLGQMYLCRKDIENAISSFEKVLKVYPNNYETLKILGSLYAQSDKEDRREQAKKMFQNVTEIEPDDLEAWIEYAQLL--KDDTASSLEAYTKAINLLRQENLDIPPEILN---NVGVLHHMRKNYDETRKYYSEALERIEEVKTELSNNQDIKQDDVNYYIGLSVTINYNQGRLFEAEYQTDEADLLYKKILTQFPEYLDCHLRLGCMSRDRGQIYDASDWFKDALKVNQDHPDSWSLMGMLHLSKSEAGPAQKKFEFIVRQNPNDIFANVALGNIWLNTLFHPSRDKEKEKRHQERALTHYRNVLRVDPKNILAAHGIGAVLAHKGYINEARDVFAQVREATADFPDVWINIAHIYVEQKQYLAAIQMYENCIK 2159
            F+  +  L    +   D+E A++++   L++ P+ Y     LG+L        R E+AK  +    E +P    AW     +   + +   ++  + KA+ L         P  L+   N+G +    + +D     Y  AL         LS N  +   ++         + Y QG +       D A   YKK +   P + D +  L    +++G + +A   +  AL++   H DS + +  +   K E G  +      ++    +I+   A  +  L ++        +++     A+ HY+  +R+ P    A   +G  L   G  + A   + +  +    F D   N+A I+ +      AIQ Y   +K
Sbjct:  226 FIDAYINLAAALVSGGDLEQAVTAYFNALQINPDLYCVRSDLGNLL---KAMGRLEEAKVCYLKAIETQPQFAVAWSNLGCVFNSQGEIWLAIHHFEKAVTL--------DPNFLDAYINLGNVLKEARIFDRAVSAYLRALN--------LSGNHAVVHGNL-------ACVYYEQGLI-------DLAIDTYKKAIDLQPHFPDAYCNLANALKEKGSVVEAEQMYMKALELCPTHADSQNNLANI---KREQGKIEDATRLYLKAL--EIYPEFAAAHSNLASIL-------QQQGKLNDAILHYKEAIRIAPTFADAYSNMGNTLKEMGDSSAAIACYNRAIQINPAFADAHSNLASIHKDAGNMAEAIQSYSTALK 561          
BLAST of RNA polymerase-associated protein CTR9 homolog vs. Ensembl Celegans
Match: ogt-1 (UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase [Source:UniProtKB/Swiss-Prot;Acc:O18158])

HSP 1 Score: 58.151 bits (139), Expect = 4.541e-8
Identity = 87/409 (21.27%), Postives = 153/409 (37.41%), Query Frame = 3
Query: 1245 DLEAWIEYAQLLKDDTASSLEAYTKAINLLRQENLDIPPEILNNVGVLHHMRKNYDETRKYYSEALERIEEVKTELSNNQDIKQDDVNYYIGLSV-----TINYNQGRLFEAEYQTDEADLLYKKILTQFPEYLDCHLRLGCMSRDRGQIYDASDWFKDALKVNQDHPDSWSLMGMLHLSKSEAGPAQKKFEFIVRQNPNDIFANVALGNIWLNTLFHPSRDKEKEKRHQERALTHYRNVLRVDPKNILAAHGIGAVLAHKGYINEARDVFAQVREATADFPDVWINIAHIYVEQKQYLAAIQMY----ENCIKKFNKQTNTELLLYLARAHFKCDQLKKCKQVLLKARHIAPWDPLIAYNLAFVQK------------RWALSVVP---DEKSNFSSVLEGINDLNMA 2399
            +LE  ++Y+ L         EAY+   N  +++            G L    +NY    K   E ++    +   L +  D++Q    Y+  L +      +  + G L +A  + +EA + Y K +   P++      LGC+   +G+I     W                              A   FE  V  +PN + A + LGN+             KE R  +RA++ Y   L +   + +    +  V   +G I+ A D + +  +    FPD + N+A+   E+   + A QMY    E C    + Q N      LA    +  +++   ++ LKA  I P       NLA + +            + A+ + P   D  SN  + L+ + D + A
Sbjct:  174 NLEKSMQYSMLAIKVNNQCAEAYSNLGNYYKEK------------GQLQDALENYKLAVKLKPEFIDAYINLAAALVSGGDLEQAVTAYFNALQINPDLYCVRSDLGNLLKAMGRLEEAKVCYLKAIETQPQFAVAWSNLGCVFNSQGEI-----WL-----------------------------AIHHFEKAVTLDPNFLDAYINLGNVL------------KEARIFDRAVSAYLRALNLSGNHAVVHGNLACVYYEQGLIDLAIDTYKKAIDLQPHFPDAYCNLANALKEKGSVVEAEQMYMKALELCPTHADSQNN------LANIKREQGKIEDATRLYLKALEIYPEFAAAHSNLASILQQQGKLNDAILHYKEAIRIAPTFADAYSNMGNTLKEMGDSSAA 518          

HSP 2 Score: 55.4546 bits (132), Expect = 3.265e-7
Identity = 77/381 (20.21%), Postives = 147/381 (38.58%), Query Frame = 3
Query: 1032 FVMPFYGLGQMYLCRKDIENAISSFEKVLKVYPNNYETLKILGSLYAQSDKEDRREQAKKMFQNVTEIEPDDLEAWIEYAQLL--KDDTASSLEAYTKAINLLRQENLDIPPEILN---NVGVLHHMRKNYDETRKYYSEALERIEEVKTELSNNQDIKQDDVNYYIGLSVTINYNQGRLFEAEYQTDEADLLYKKILTQFPEYLDCHLRLGCMSRDRGQIYDASDWFKDALKVNQDHPDSWSLMGMLHLSKSEAGPAQKKFEFIVRQNPNDIFANVALGNIWLNTLFHPSRDKEKEKRHQERALTHYRNVLRVDPKNILAAHGIGAVLAHKGYINEARDVFAQVREATADFPDVWINIAHIYVEQKQYLAAIQMYENCIK 2159
            F+  +  L    +   D+E A++++   L++ P+ Y     LG+L        R E+AK  +    E +P    AW     +   + +   ++  + KA+ L         P  L+   N+G +    + +D     Y  AL         LS N  +   ++         + Y QG +       D A   YKK +   P + D +  L    +++G + +A   +  AL++   H DS + +  +   K E G  +      ++    +I+   A  +  L ++        +++     A+ HY+  +R+ P    A   +G  L   G  + A   + +  +    F D   N+A I+ +      AIQ Y   +K
Sbjct:  226 FIDAYINLAAALVSGGDLEQAVTAYFNALQINPDLYCVRSDLGNLL---KAMGRLEEAKVCYLKAIETQPQFAVAWSNLGCVFNSQGEIWLAIHHFEKAVTL--------DPNFLDAYINLGNVLKEARIFDRAVSAYLRALN--------LSGNHAVVHGNL-------ACVYYEQGLI-------DLAIDTYKKAIDLQPHFPDAYCNLANALKEKGSVVEAEQMYMKALELCPTHADSQNNLANI---KREQGKIEDATRLYLKAL--EIYPEFAAAHSNLASIL-------QQQGKLNDAILHYKEAIRIAPTFADAYSNMGNTLKEMGDSSAAIACYNRAIQINPAFADAHSNLASIHKDAGNMAEAIQSYSTALK 561          
BLAST of RNA polymerase-associated protein CTR9 homolog vs. Ensembl Celegans
Match: ogt-1 (UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase [Source:UniProtKB/Swiss-Prot;Acc:O18158])

HSP 1 Score: 57.3806 bits (137), Expect = 6.733e-8
Identity = 64/270 (23.70%), Postives = 113/270 (41.85%), Query Frame = 3
Query: 1647 LGCMSRDRGQIYDASDWFKDALKVNQDHPDSWSLMGMLHLSKSEAGPAQKKFEFIVRQNPNDIFANVALGNIWLNTLFHPSRDKEKEKRHQERALTHYRNVLRVDPKNILAAHGIGAVLAHKGYINEARDVFAQVREATADFPDVWINIAHIYVEQKQYLAAIQMY----ENCIKKFNKQTNTELLLYLARAHFKCDQLKKCKQVLLKARHIAPWDPLIAYNLAFVQK------------RWALSVVP---DEKSNFSSVLEGINDLNMA 2399
            LG + +  G++ +A   +  A++       +WS +G +  S+ E   A   FE  V  +PN + A + LGN+             KE R  +RA++ Y   L +   + +    +  V   +G I+ A D + +  +    FPD + N+A+   E+   + A QMY    E C    + Q N      LA    +  +++   ++ LKA  I P       NLA + +            + A+ + P   D  SN  + L+ + D + A
Sbjct:   89 LGNLLKAMGRLEEAKVCYLKAIETQPQFAVAWSNLGCVFNSQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVL------------KEARIFDRAVSAYLRALNLSGNHAVVHGNLACVYYEQGLIDLAIDTYKKAIDLQPHFPDAYCNLANALKEKGSVVEAEQMYMKALELCPTHADSQNN------LANIKREQGKIEDATRLYLKALEIYPEFAAAHSNLASILQQQGKLNDAILHYKEAIRIAPTFADAYSNMGNTLKEMGDSSAA 340          

HSP 2 Score: 55.4546 bits (132), Expect = 2.995e-7
Identity = 77/381 (20.21%), Postives = 147/381 (38.58%), Query Frame = 3
Query: 1032 FVMPFYGLGQMYLCRKDIENAISSFEKVLKVYPNNYETLKILGSLYAQSDKEDRREQAKKMFQNVTEIEPDDLEAWIEYAQLL--KDDTASSLEAYTKAINLLRQENLDIPPEILN---NVGVLHHMRKNYDETRKYYSEALERIEEVKTELSNNQDIKQDDVNYYIGLSVTINYNQGRLFEAEYQTDEADLLYKKILTQFPEYLDCHLRLGCMSRDRGQIYDASDWFKDALKVNQDHPDSWSLMGMLHLSKSEAGPAQKKFEFIVRQNPNDIFANVALGNIWLNTLFHPSRDKEKEKRHQERALTHYRNVLRVDPKNILAAHGIGAVLAHKGYINEARDVFAQVREATADFPDVWINIAHIYVEQKQYLAAIQMYENCIK 2159
            F+  +  L    +   D+E A++++   L++ P+ Y     LG+L        R E+AK  +    E +P    AW     +   + +   ++  + KA+ L         P  L+   N+G +    + +D     Y  AL         LS N  +   ++         + Y QG +       D A   YKK +   P + D +  L    +++G + +A   +  AL++   H DS + +  +   K E G  +      ++    +I+   A  +  L ++        +++     A+ HY+  +R+ P    A   +G  L   G  + A   + +  +    F D   N+A I+ +      AIQ Y   +K
Sbjct:   48 FIDAYINLAAALVSGGDLEQAVTAYFNALQINPDLYCVRSDLGNLL---KAMGRLEEAKVCYLKAIETQPQFAVAWSNLGCVFNSQGEIWLAIHHFEKAVTL--------DPNFLDAYINLGNVLKEARIFDRAVSAYLRALN--------LSGNHAVVHGNL-------ACVYYEQGLI-------DLAIDTYKKAIDLQPHFPDAYCNLANALKEKGSVVEAEQMYMKALELCPTHADSQNNLANI---KREQGKIEDATRLYLKAL--EIYPEFAAAHSNLASIL-------QQQGKLNDAILHYKEAIRIAPTFADAYSNMGNTLKEMGDSSAAIACYNRAIQINPAFADAHSNLASIHKDAGNMAEAIQSYSTALK 383          
BLAST of RNA polymerase-associated protein CTR9 homolog vs. Ensembl Fly
Match: Ctr9 (gene:FBgn0035205 transcript:FBtr0072668)

HSP 1 Score: 934.48 bits (2414), Expect = 0.000e+0
Identity = 483/858 (56.29%), Postives = 632/858 (73.66%), Query Frame = 3
Query:   30 IEIPLRDTDEVIELDTDAFPDVDEVLNILKQEVAPMHVWILVALEYYRSKKYNDFVKVLNEA-NIHASVTYADSEKDQVKVLDMLANYYVKQASXXXXXXXXXXLFGQAAVHFTTADRIAMFDHNHLLSRAFFFLFEGDNWSQVDNQLNFVLNSSPNNVPALLGKSCIAFNKKEYRSALSFYRKALRNHPKCPASVRLGMGHCFFRLGNLEKAKFAFERALALDPECXXXXXXXXXXELNEKTLESVHHGVQKLSKAYMKDSNNPMVLNHLADHFFYAQQYKKVHTLALHAFHYTENELMRAQSCYQIARGFHKEENYDEAFQYYYQATQFASNNFVMPFYGLGQMYLCRKDIENAISSFEKVLKVYPNNYETLKILGSLYAQSDKEDRREQAKKMFQNVTEIEPDDLEAWIEYAQLL-KDDTASSLEAYTKAINLLR-QENLDIPPEILNNVGVLHHMRKNYDETRKYYSEALERIEEVKTELSNNQDIKQDDVNYYIGLSVTINYNQGRLFEAEYQTDEADLLYKKILTQFPEYLDCHLRLGCMSRDRGQIYDASDWFKDALKVNQDHPDSWSLMGMLHLSKSEAGPAQKKFEFIVRQNPN---DIFANVALGNIWLNTLFHPSRDKEKEKRHQERALTHYRNVLRVDPKNILAAHGIGAVLAHKGYINEARDVFAQVREATADFPDVWINIAHIYVEQKQYLAAIQMYENCIKKFNKQTNTELLLYLARAHFKCDQLKKCKQVLLKARHIAPWDPLIAYNLAFVQKRWALSVVPDEKSNFSSVLEGINDLNMAQCTFKYLSIL--KDQINIPQLPNEIKDCQDLLSQARYYLDRATKREQQERYMRQKQVEERES 2579
            IEIPL+DTDEVIE+D D  PD  EVL+ILKQE AP+HVW+ VAL YY+ KK  DFV +L E+ +  A+  Y DS+KD ++ LDMLA +YV++A +EK+K+KKRELF +A   +T+AD+I M+D +HLL RA+F L EGD   Q D Q NFVLN SP+N+P+LLGK+CIAFN+K+YR A++FY+KALR +P CPA+VR+GM HCF ++GN EKAK AFERAL LD +CVGAL+GLAVL+LN+   ES   GVQ LSKAY  D+ NPMVLNHLA+HFF+ + Y+KVH LALHAFH TENE MRA+SCYQ+AR FH + +YD+AFQYYYQ+TQ A  NFV+P YGLGQMY+ R D ENA   FEKVLK+ P NYET+KILGSLYA S+ + +R+ AK   + VTE  P+D+EAWIE AQ+L ++D  +SL AY  A ++LR +   +IP EI NNV  LH+   N    +     AL+      +E+         DV YY  + VT+ YN  RL EA    D AD LYK+IL + P Y+DC+LRLGCM+RD+G I+ ASD+FKDAL +N D+PD+ SL+G LHL+K +    QK FE I++ NP+   D ++ +ALGN  L TL  PSRDKEKE++HQE+AL  ++ VLR DP+NI A +GIGAVLAHKG + EARD+FAQVREATADF DVW+NIAH+YVEQKQY++AIQMYENC+KKF K  N E++ YLARA+ + ++L   K VLLKAR +AP D ++ +N+A V  R A++++ DEKS    VL+ +++L +AQ  F+YLS+   K++ NI     E   CQDLLSQA+Y++ RA + +++ER +R+KQ EERE+
Sbjct:    5 IEIPLQDTDEVIEVDPDQLPDCPEVLSILKQERAPLHVWVNVALAYYKQKKTEDFVTLLEESRSDDATKEYRDSDKDLMRALDMLAAHYVQEAYREKSKDKKRELFMKATNLYTSADKIIMYDQSHLLGRAYFCLLEGDKMDQADAQFNFVLNQSPSNIPSLLGKACIAFNRKDYRGAMAFYKKALRTNPNCPANVRIGMAHCFLKMGNPEKAKLAFERALQLDQQCVGALIGLAVLKLNQLEPESNKLGVQMLSKAYTIDNANPMVLNHLANHFFFKKDYQKVHHLALHAFHNTENEAMRAESCYQLARSFHAQSDYDQAFQYYYQSTQIAPANFVLPHYGLGQMYIYRGDTENAAQCFEKVLKIQPGNYETMKILGSLYAHSNSQTKRDMAKTHLKKVTEQFPEDIEAWIELAQILEQNDLQASLSAYGTASSILRDKAKYEIPAEIQNNVASLHYRLGNLKMAKLTLESALKH---ATSEMDK-------DVKYYESIQVTMKYNLARLNEAMSSYDVADKLYKEILKEHPNYIDCYLRLGCMARDKGLIFVASDFFKDALNINNDNPDARSLLGNLHLAKMQFALGQKNFETILK-NPSTSTDAYSLIALGNFSLQTLHQPSRDKEKERKHQEKALAIFKQVLRNDPRNIWATNGIGAVLAHKGCVIEARDIFAQVREATADFCDVWLNIAHVYVEQKQYISAIQMYENCMKKFYKHNNVEVMQYLARAYLRANKLVDAKAVLLKARRVAPQDTVLLFNIAVVLSRLAMAILKDEKSTLEIVLQAVHELELAQKYFQYLSVHGDKNRFNIEVAGIEASTCQDLLSQAQYHVGRARRIDEEERSLRRKQEEEREA 851          
BLAST of RNA polymerase-associated protein CTR9 homolog vs. Ensembl Fly
Match: Ctr9 (gene:FBgn0035205 transcript:FBtr0072669)

HSP 1 Score: 934.48 bits (2414), Expect = 0.000e+0
Identity = 483/858 (56.29%), Postives = 632/858 (73.66%), Query Frame = 3
Query:   30 IEIPLRDTDEVIELDTDAFPDVDEVLNILKQEVAPMHVWILVALEYYRSKKYNDFVKVLNEA-NIHASVTYADSEKDQVKVLDMLANYYVKQASXXXXXXXXXXLFGQAAVHFTTADRIAMFDHNHLLSRAFFFLFEGDNWSQVDNQLNFVLNSSPNNVPALLGKSCIAFNKKEYRSALSFYRKALRNHPKCPASVRLGMGHCFFRLGNLEKAKFAFERALALDPECXXXXXXXXXXELNEKTLESVHHGVQKLSKAYMKDSNNPMVLNHLADHFFYAQQYKKVHTLALHAFHYTENELMRAQSCYQIARGFHKEENYDEAFQYYYQATQFASNNFVMPFYGLGQMYLCRKDIENAISSFEKVLKVYPNNYETLKILGSLYAQSDKEDRREQAKKMFQNVTEIEPDDLEAWIEYAQLL-KDDTASSLEAYTKAINLLR-QENLDIPPEILNNVGVLHHMRKNYDETRKYYSEALERIEEVKTELSNNQDIKQDDVNYYIGLSVTINYNQGRLFEAEYQTDEADLLYKKILTQFPEYLDCHLRLGCMSRDRGQIYDASDWFKDALKVNQDHPDSWSLMGMLHLSKSEAGPAQKKFEFIVRQNPN---DIFANVALGNIWLNTLFHPSRDKEKEKRHQERALTHYRNVLRVDPKNILAAHGIGAVLAHKGYINEARDVFAQVREATADFPDVWINIAHIYVEQKQYLAAIQMYENCIKKFNKQTNTELLLYLARAHFKCDQLKKCKQVLLKARHIAPWDPLIAYNLAFVQKRWALSVVPDEKSNFSSVLEGINDLNMAQCTFKYLSIL--KDQINIPQLPNEIKDCQDLLSQARYYLDRATKREQQERYMRQKQVEERES 2579
            IEIPL+DTDEVIE+D D  PD  EVL+ILKQE AP+HVW+ VAL YY+ KK  DFV +L E+ +  A+  Y DS+KD ++ LDMLA +YV++A +EK+K+KKRELF +A   +T+AD+I M+D +HLL RA+F L EGD   Q D Q NFVLN SP+N+P+LLGK+CIAFN+K+YR A++FY+KALR +P CPA+VR+GM HCF ++GN EKAK AFERAL LD +CVGAL+GLAVL+LN+   ES   GVQ LSKAY  D+ NPMVLNHLA+HFF+ + Y+KVH LALHAFH TENE MRA+SCYQ+AR FH + +YD+AFQYYYQ+TQ A  NFV+P YGLGQMY+ R D ENA   FEKVLK+ P NYET+KILGSLYA S+ + +R+ AK   + VTE  P+D+EAWIE AQ+L ++D  +SL AY  A ++LR +   +IP EI NNV  LH+   N    +     AL+      +E+         DV YY  + VT+ YN  RL EA    D AD LYK+IL + P Y+DC+LRLGCM+RD+G I+ ASD+FKDAL +N D+PD+ SL+G LHL+K +    QK FE I++ NP+   D ++ +ALGN  L TL  PSRDKEKE++HQE+AL  ++ VLR DP+NI A +GIGAVLAHKG + EARD+FAQVREATADF DVW+NIAH+YVEQKQY++AIQMYENC+KKF K  N E++ YLARA+ + ++L   K VLLKAR +AP D ++ +N+A V  R A++++ DEKS    VL+ +++L +AQ  F+YLS+   K++ NI     E   CQDLLSQA+Y++ RA + +++ER +R+KQ EERE+
Sbjct:    5 IEIPLQDTDEVIEVDPDQLPDCPEVLSILKQERAPLHVWVNVALAYYKQKKTEDFVTLLEESRSDDATKEYRDSDKDLMRALDMLAAHYVQEAYREKSKDKKRELFMKATNLYTSADKIIMYDQSHLLGRAYFCLLEGDKMDQADAQFNFVLNQSPSNIPSLLGKACIAFNRKDYRGAMAFYKKALRTNPNCPANVRIGMAHCFLKMGNPEKAKLAFERALQLDQQCVGALIGLAVLKLNQLEPESNKLGVQMLSKAYTIDNANPMVLNHLANHFFFKKDYQKVHHLALHAFHNTENEAMRAESCYQLARSFHAQSDYDQAFQYYYQSTQIAPANFVLPHYGLGQMYIYRGDTENAAQCFEKVLKIQPGNYETMKILGSLYAHSNSQTKRDMAKTHLKKVTEQFPEDIEAWIELAQILEQNDLQASLSAYGTASSILRDKAKYEIPAEIQNNVASLHYRLGNLKMAKLTLESALKH---ATSEMDK-------DVKYYESIQVTMKYNLARLNEAMSSYDVADKLYKEILKEHPNYIDCYLRLGCMARDKGLIFVASDFFKDALNINNDNPDARSLLGNLHLAKMQFALGQKNFETILK-NPSTSTDAYSLIALGNFSLQTLHQPSRDKEKERKHQEKALAIFKQVLRNDPRNIWATNGIGAVLAHKGCVIEARDIFAQVREATADFCDVWLNIAHVYVEQKQYISAIQMYENCMKKFYKHNNVEVMQYLARAYLRANKLVDAKAVLLKARRVAPQDTVLLFNIAVVLSRLAMAILKDEKSTLEIVLQAVHELELAQKYFQYLSVHGDKNRFNIEVAGIEASTCQDLLSQAQYHVGRARRIDEEERSLRRKQEEEREA 851          
BLAST of RNA polymerase-associated protein CTR9 homolog vs. Ensembl Fly
Match: CG9899 (gene:FBgn0034829 transcript:FBtr0071969)

HSP 1 Score: 281.952 bits (720), Expect = 2.032e-79
Identity = 207/802 (25.81%), Postives = 387/802 (48.25%), Query Frame = 3
Query:  135 MHVWILVALEYYRSKKYNDFVKVLNEANIHASVTYADSEKDQVKVLDMLANYYVKQASXXXXXXXXXXLFGQAAVH-FTTADRIAMFDHNHL-LSRAFFFLFEGDNWSQVDNQLNFVLNSSPNNVPALLGKSCIAFNKKEYRSALSFYRKALRNHPKCPASVRLGMGHCFFRLGNLEKAKFAFERALALDPECXXXXXXXXXXELNEKTLESVHHGVQKLSKAYMKDSNNPMVLNHLADHFFYAQQYKKVHTLALHAFHYTENELMRAQSCYQIARGFHKEENYDEAFQYYYQATQFASNNFVMPFYGLGQMYLCRKDIENAISSFEKVLKVYPNNYETLKILGSLYAQSDKEDRREQAKKMFQNVTEIEP--DDLEAWIE--YAQLLKDDTASSLEAYTKAINLLRQENLDIPPEILNNVGVLHHMRKNYDETRKYYSEALERIEEVKTELSNNQDIKQDDVNYYIGLSVTINYNQGRLFEAEYQTDEADLLYKKILTQFPEYLDCHLRLGCMSRDRGQIYDASDWFKDALKVNQDHPDSWSLMGMLHLSKSEAGPAQKKFE------FIVRQNP-NDIFANVALGNIWLNTL--FHPSRDKEKEKRHQERALTHYRNVLRVDPKNILAAHGIGAVLAHKGYINEARDVFAQVREATADFPDVWINIAHIYVEQKQYLAAIQMYENCIKKFNKQTNTELLLYLARAHFKCDQLKKCKQVLLKARHIAPWDPLIAYNLAFVQKRWALSVVPDEKSNFSSVLEGINDLNMAQCTFKYLSILKDQINIPQLPNEIKDCQDLLSQ 2495
            +  +I  A+E+Y   K  DF  ++ +       TY+  +++  K   +LA Y    A K          F   A++ F   D +      HL +++ F ++         D  L  VL + P N+ AL+G++C+A+N+++Y  AL +++  L   P+  A V +G+GHCF+++G LEKA+ +F+ AL  + +C+ A + LA+++      +S   G   L+ AY +++ NP +L+ LA  ++    +K V + A +A  +T N+ + +++ +QIA+ +H    ++ A +YY  + + A + +++P  G+ QMYL   ++  + +  E  L   P+    + +L  +Y +    ++ ++A +M   V E      +  +W+   +A   K   A  + AY KAI++   +   IP E LNN+     M K  ++      +AL +   +      N D K  ++       +++ YN+G + E  +    A   YK I  ++  Y DC+LRLG M+  +     A +  KD L       D+ ++    ++     G +  KF        + RQ+   + + ++A+GN  L  L  +    +    ++ QE+AL  +  +L  +PKN+ AA+GIGAVL+    ++    +F Q+ E         IN AHI +   QY  AIQ YE C+K    +   +++  LA+A +     +K K  LLK RH+ P DP + +NL    K+     +   +     ++     L +A   F ++++   +I++       +DCQ+L+++
Sbjct:    5 LSTYIEEAMEFYAIGKGADFKAIIEKGIASCMTTYSTYDRELYKAYALLATYLSNHAFKIIKSRPA---FQAMAINCFDQLDSLRQQHDPHLQVTKGFLWMLSSSRAQDADALLISVLRNHPKNILALIGRACLAYNRQDYIGALGYFKSVLLIQPQGMADVWVGIGHCFWKMGELEKAQLSFQIALEHNGQCLNAALALALVKFEHNDEQSYQDGKMLLTAAYKENNKNPDLLSILAGMYYADGNHKLVWSFAGNAIKFTANKHIESRNYFQIAKSYHATGQFESAKKYYLLSAKSAPDGYILPLVGVAQMYLHEGELNRSKAFLESFLTSEPDEPVVMDLLAKIYLEYKCPEKIDKAIEMLVKVVESASYHQNTNSWLNLAFAYEQKRLWAHGVNAYQKAIDIYLSQGHQIPIEWLNNLASSQLMAKMPEKALNTLDDALSKCRVM------NSDNKTTNL-------LSLQYNRGLVLEELHMFTLAAENYKSITKEYSSYHDCYLRLGVMAIQKNNHTQAIEHLKDILV-----EDNLNMTARTYMGDCFKGLSLDKFATFNYNMILARQSKFTNTYVSMAMGNFCLEKLQNWIAEGNFRAARKQQEKALQCFGKILDCNPKNLWAANGIGAVLSSCNNLSAGGAIFKQIIECGNKCIPAIINSAHIALVSGQYRLAIQTYERCLKDHLPKNRVDVMHCLAKALYDNGDARKAKMWLLKVRHLVPHDPFVIFNLGLAIKKETEQALALPRPQLDELMGLDGLLKVAFKLFCHINLNHPKISVRVSAKYAEDCQNLMTE 785          
BLAST of RNA polymerase-associated protein CTR9 homolog vs. Ensembl Fly
Match: sxc (gene:FBgn0261403 transcript:FBtr0086085)

HSP 1 Score: 64.6994 bits (156), Expect = 5.372e-10
Identity = 96/459 (20.92%), Postives = 184/459 (40.09%), Query Frame = 3
Query:  798 YMKDSNNPMVLNHLADHFFYAQQYKKVHTLALHAFHYTENELMRAQSCYQIARGFHKEENYDEAFQYYYQATQFASNNFVMPFYGLGQMYLCRKDIENAISSFEKVLKVYPNNYETLKILGSLYAQSDKEDRREQAKKMFQNVTEIEPDDLEAWIEYAQLL--KDDTASSLEAYTKAINLLRQENLDIPPEILN---NVGVLHHMRKNYDETRKYYSEALERIEEVKTELSNNQDIKQDDVNYYIGLSVTINYNQGRLFEAEYQTDEADLLYKKILTQFPEYLDCHLRLGCMSRDRGQIYDASDWFKDALKVNQDHPDSWSLMGMLHLSKSEAGPAQKKFEFIVRQNPNDIFANVALGNIWLNTLFHPSRDKEKEKRHQERALTHYRNVLRVDPKNILAAHGIGAVLAHKGYINEARDVFAQVREATADFPDVWINIAHIYVEQKQYLAAIQMYENCIK 2159
            + +DS N  VL  L+   F  ++  K    +  A    +N ++ A++   +   F +     EA   Y +A +   + F+  +  L    +  +D+E+A+ ++   L+  P+ Y     LG+L        R E+AK  +    E  P    AW     +   + +   ++  + KA+ L         P  L+   N+G +    + +D     Y  AL         LS N  +   ++         + Y QG +       D A   Y++ +   P + D +  L    +++GQ+ +A D +  AL++  +H DS + +  +   K E G  ++     ++    ++F + A  +  L ++    + K KE      AL HY+  +R+ P    A   +G  L     ++ A   + +  +    F D   N+A I+ +      AIQ Y   +K
Sbjct:   77 WRQDSTNTGVLLLLSSIHFQCRRLDKSAQFSTLAI--KQNPVL-AEAYSNLGNVFKERGQLQEALDNYRRAVRLKPD-FIDGYINLAAALVAARDMESAVQAYITALQYNPDLYCVRSDLGNLL---KALGRLEEAKACYLKAIETCPGFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTL--------DPNFLDAYINLGNVLKEARIFDRAVAAYLRALN--------LSPNNAVVHGNL-------ACVYYEQGLI-------DLAIDTYRRAIELQPNFPDAYCNLANALKEKGQVKEAEDCYNTALRLCSNHADSLNNLANI---KREQGYIEEATRLYLKAL--EVFPDFAAAHSNLASVLQ-QQGKLKE------ALMHYKEAIRIQPTFADAYSNMGNTLKELQDVSGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIQSYRTALK 486          

HSP 2 Score: 62.7734 bits (151), Expect = 2.050e-9
Identity = 82/352 (23.30%), Postives = 144/352 (40.91%), Query Frame = 3
Query: 1488 IKQDDVNYYIGLSVTINYNQGRLFEAEYQTDEADLLYKKILTQFPEYLDCHLRLGCMSRDRGQIYDASDWFKDALKVNQDHPDSWSLMGMLHLSKSEAGPAQKKFEFIVRQNPNDIFANVALGNIWLNTLFHPSRDKEKEKRHQERALTHYRNVLRVDPKNILAAHGIGAVLAHKGYINEARDVFAQVREATADFPDVWINIAHIYVEQKQYLAAIQMYENCIKKFNKQTNTELLLYLARAHFKCDQLKKCKQVLLKARHIAPWDPLIAYNLAFVQK------------RWALSVVP---DEKSNFSSVLEGINDLNMA-QCTFKYL--------------SILKDQINIPQ 2453
            +K D ++ YI L+  +     R  E+  Q       Y   L   P+       LG + +  G++ +A   +  A++       +WS +G +  ++ E   A   FE  V  +PN + A + LGN+             KE R  +RA+  Y   L + P N +    +  V   +G I+ A D + +  E   +FPD + N+A+   E+ Q   A   Y   ++  +   ++  L  LA    +   +++  ++ LKA  + P       NLA V +            + A+ + P   D  SN  + L+ + D++ A QC  + +              SI KD  NIP+
Sbjct:  147 LKPDFIDGYINLAAALV--AARDMESAVQA------YITALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETCPGFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVL------------KEARIFDRAVAAYLRALNLSPNNAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPNFPDAYCNLANALKEKGQVKEAEDCYNTALRLCSNHADS--LNNLANIKREQGYIEEATRLYLKALEVFPDFAAAHSNLASVLQQQGKLKEALMHYKEAIRIQPTFADAYSNMGNTLKELQDVSGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPE 476          

HSP 3 Score: 51.9878 bits (123), Expect = 4.499e-6
Identity = 86/430 (20.00%), Postives = 167/430 (38.84%), Query Frame = 3
Query:  495 NNVPALLGKSCIAFNKKEYRSALSFYRKALRNHPKCPASVRLGMGHCFFRLGNLEKAKFAFERALALDPECXXXXXXXXXXELNEKTLESVHHGVQKLSKAYMKDSNNPMVLNHLADHFFYAQQYKKVHTLALHAFHYTENELMRAQSCYQIARGFHKEENYDEAFQYYYQATQFASNNFVMPFYGLGQMYLCRKDIENAISSFEKVLKVYPNNYETLKILGSLYAQSDKEDRREQAKKMFQNVTEIEPDDLEAWIEYAQLLKD--DTASSLEAYTKAINLLRQENLDIPPEILNNVGVLHHMRKNYDETRKYYSEALERIEEVKTELSNNQDIKQDD-------VNYYIGLSVTINY-----NQGRLFEAEYQTDEADLLYKKILTQFPEYLDCHLRLGCMSRDRGQIYDASDWFKDALKVNQDHPDSW 1742
             N   LL  S I F  +    +  F   A++ +P   A     +G+ F   G L++A   + RA+ L P+ +   + LA   +  + +ES    VQ    A   + +   V + L +      + ++     L A          A +   +   F+ +     A  ++ +A      NF+  +  LG +    +  + A++++ + L + PNN      L  +Y +    D    A   ++   E++P+  +A+   A  LK+      + + Y  A+ L          + LNN+  +   +   +E  + Y +ALE   +     SN   + Q         ++Y   + +   +     N G   +       A   Y + +   P + D H  L  + +D G I +A   ++ ALK+  D PD++
Sbjct:   82 TNTGVLLLLSSIHFQCRRLDKSAQFSTLAIKQNPVL-AEAYSNLGNVFKERGQLQEALDNYRRAVRLKPDFIDGYINLAAALVAARDMES---AVQAYITALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETCPG---FAVAWSNLGCVFNAQGEIWLAIHHFEKAVTL-DPNFLDAYINLGNVLKEARIFDRAVAAYLRALNLSPNNAVVHGNLACVYYEQGLIDL---AIDTYRRAIELQPNFPDAYCNLANALKEKGQVKEAEDCYNTALRLCSNH-----ADSLNNLANIKREQGYIEEATRLYLKALEVFPDFAAAHSNLASVLQQQGKLKEALMHYKEAIRIQPTFADAYSNMGNTLKELQDVSGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIQSYRTALKLKPDFPDAY 495          
BLAST of RNA polymerase-associated protein CTR9 homolog vs. Ensembl Fly
Match: sxc (gene:FBgn0261403 transcript:FBtr0086084)

HSP 1 Score: 64.6994 bits (156), Expect = 5.372e-10
Identity = 96/459 (20.92%), Postives = 184/459 (40.09%), Query Frame = 3
Query:  798 YMKDSNNPMVLNHLADHFFYAQQYKKVHTLALHAFHYTENELMRAQSCYQIARGFHKEENYDEAFQYYYQATQFASNNFVMPFYGLGQMYLCRKDIENAISSFEKVLKVYPNNYETLKILGSLYAQSDKEDRREQAKKMFQNVTEIEPDDLEAWIEYAQLL--KDDTASSLEAYTKAINLLRQENLDIPPEILN---NVGVLHHMRKNYDETRKYYSEALERIEEVKTELSNNQDIKQDDVNYYIGLSVTINYNQGRLFEAEYQTDEADLLYKKILTQFPEYLDCHLRLGCMSRDRGQIYDASDWFKDALKVNQDHPDSWSLMGMLHLSKSEAGPAQKKFEFIVRQNPNDIFANVALGNIWLNTLFHPSRDKEKEKRHQERALTHYRNVLRVDPKNILAAHGIGAVLAHKGYINEARDVFAQVREATADFPDVWINIAHIYVEQKQYLAAIQMYENCIK 2159
            + +DS N  VL  L+   F  ++  K    +  A    +N ++ A++   +   F +     EA   Y +A +   + F+  +  L    +  +D+E+A+ ++   L+  P+ Y     LG+L        R E+AK  +    E  P    AW     +   + +   ++  + KA+ L         P  L+   N+G +    + +D     Y  AL         LS N  +   ++         + Y QG +       D A   Y++ +   P + D +  L    +++GQ+ +A D +  AL++  +H DS + +  +   K E G  ++     ++    ++F + A  +  L ++    + K KE      AL HY+  +R+ P    A   +G  L     ++ A   + +  +    F D   N+A I+ +      AIQ Y   +K
Sbjct:   77 WRQDSTNTGVLLLLSSIHFQCRRLDKSAQFSTLAI--KQNPVL-AEAYSNLGNVFKERGQLQEALDNYRRAVRLKPD-FIDGYINLAAALVAARDMESAVQAYITALQYNPDLYCVRSDLGNLL---KALGRLEEAKACYLKAIETCPGFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTL--------DPNFLDAYINLGNVLKEARIFDRAVAAYLRALN--------LSPNNAVVHGNL-------ACVYYEQGLI-------DLAIDTYRRAIELQPNFPDAYCNLANALKEKGQVKEAEDCYNTALRLCSNHADSLNNLANI---KREQGYIEEATRLYLKAL--EVFPDFAAAHSNLASVLQ-QQGKLKE------ALMHYKEAIRIQPTFADAYSNMGNTLKELQDVSGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIQSYRTALK 486          

HSP 2 Score: 62.7734 bits (151), Expect = 2.050e-9
Identity = 82/352 (23.30%), Postives = 144/352 (40.91%), Query Frame = 3
Query: 1488 IKQDDVNYYIGLSVTINYNQGRLFEAEYQTDEADLLYKKILTQFPEYLDCHLRLGCMSRDRGQIYDASDWFKDALKVNQDHPDSWSLMGMLHLSKSEAGPAQKKFEFIVRQNPNDIFANVALGNIWLNTLFHPSRDKEKEKRHQERALTHYRNVLRVDPKNILAAHGIGAVLAHKGYINEARDVFAQVREATADFPDVWINIAHIYVEQKQYLAAIQMYENCIKKFNKQTNTELLLYLARAHFKCDQLKKCKQVLLKARHIAPWDPLIAYNLAFVQK------------RWALSVVP---DEKSNFSSVLEGINDLNMA-QCTFKYL--------------SILKDQINIPQ 2453
            +K D ++ YI L+  +     R  E+  Q       Y   L   P+       LG + +  G++ +A   +  A++       +WS +G +  ++ E   A   FE  V  +PN + A + LGN+             KE R  +RA+  Y   L + P N +    +  V   +G I+ A D + +  E   +FPD + N+A+   E+ Q   A   Y   ++  +   ++  L  LA    +   +++  ++ LKA  + P       NLA V +            + A+ + P   D  SN  + L+ + D++ A QC  + +              SI KD  NIP+
Sbjct:  147 LKPDFIDGYINLAAALV--AARDMESAVQA------YITALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETCPGFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVL------------KEARIFDRAVAAYLRALNLSPNNAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPNFPDAYCNLANALKEKGQVKEAEDCYNTALRLCSNHADS--LNNLANIKREQGYIEEATRLYLKALEVFPDFAAAHSNLASVLQQQGKLKEALMHYKEAIRIQPTFADAYSNMGNTLKELQDVSGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPE 476          

HSP 3 Score: 51.9878 bits (123), Expect = 4.499e-6
Identity = 86/430 (20.00%), Postives = 167/430 (38.84%), Query Frame = 3
Query:  495 NNVPALLGKSCIAFNKKEYRSALSFYRKALRNHPKCPASVRLGMGHCFFRLGNLEKAKFAFERALALDPECXXXXXXXXXXELNEKTLESVHHGVQKLSKAYMKDSNNPMVLNHLADHFFYAQQYKKVHTLALHAFHYTENELMRAQSCYQIARGFHKEENYDEAFQYYYQATQFASNNFVMPFYGLGQMYLCRKDIENAISSFEKVLKVYPNNYETLKILGSLYAQSDKEDRREQAKKMFQNVTEIEPDDLEAWIEYAQLLKD--DTASSLEAYTKAINLLRQENLDIPPEILNNVGVLHHMRKNYDETRKYYSEALERIEEVKTELSNNQDIKQDD-------VNYYIGLSVTINY-----NQGRLFEAEYQTDEADLLYKKILTQFPEYLDCHLRLGCMSRDRGQIYDASDWFKDALKVNQDHPDSW 1742
             N   LL  S I F  +    +  F   A++ +P   A     +G+ F   G L++A   + RA+ L P+ +   + LA   +  + +ES    VQ    A   + +   V + L +      + ++     L A          A +   +   F+ +     A  ++ +A      NF+  +  LG +    +  + A++++ + L + PNN      L  +Y +    D    A   ++   E++P+  +A+   A  LK+      + + Y  A+ L          + LNN+  +   +   +E  + Y +ALE   +     SN   + Q         ++Y   + +   +     N G   +       A   Y + +   P + D H  L  + +D G I +A   ++ ALK+  D PD++
Sbjct:   82 TNTGVLLLLSSIHFQCRRLDKSAQFSTLAIKQNPVL-AEAYSNLGNVFKERGQLQEALDNYRRAVRLKPDFIDGYINLAAALVAARDMES---AVQAYITALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETCPG---FAVAWSNLGCVFNAQGEIWLAIHHFEKAVTL-DPNFLDAYINLGNVLKEARIFDRAVAAYLRALNLSPNNAVVHGNLACVYYEQGLIDL---AIDTYRRAIELQPNFPDAYCNLANALKEKGQVKEAEDCYNTALRLCSNH-----ADSLNNLANIKREQGYIEEATRLYLKALEVFPDFAAAHSNLASVLQQQGKLKEALMHYKEAIRIQPTFADAYSNMGNTLKELQDVSGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIQSYRTALKLKPDFPDAY 495          
BLAST of RNA polymerase-associated protein CTR9 homolog vs. Ensembl Zebrafish
Match: ctr9 (CTR9 homolog, Paf1/RNA polymerase II complex component [Source:ZFIN;Acc:ZDB-GENE-030131-3782])

HSP 1 Score: 991.104 bits (2561), Expect = 0.000e+0
Identity = 498/856 (58.18%), Postives = 640/856 (74.77%), Query Frame = 3
Query:   27 TIEIPLRDTDEVIELDTDAFPDVDEVLNILKQEVAPMHVWILVALEYYRSKKYNDFVKVLNEANIHASVTYADSEKDQVKVLDMLANYYVKQASXXXXXXXXXXLFGQAAVHFTTADRIAMFDHNHLLSRAFFFLFEGDNWSQVDNQLNFVLNSSPNNVPALLGKSCIAFNKKEYRSALSFYRKALRNHPKCPASVRLGMGHCFFRLGNLEKAKFAFERALALDPECXXXXXXXXXXELNEKTLESVHHGVQKLSKAYMKDSNNPMVLNHLADHFFYAQQYKKVHTLALHAFHYTENELMRAQSCYQIARGFHKEENYDEAFQYYYQATQFASNNFVMPFYGLGQMYLCRKDIENAISSFEKVLKVYPNNYETLKILGSLYAQSDKEDRREQAKKMFQNVTEIEPDDLEAWIEYAQLL-KDDTASSLEAYTKAINLLRQE-NLDIPPEILNNVGVLHHMRKNYDETRKYYSEALERIEEVKTELSNNQDIKQDDVNYYIGLSVTINYNQGRLFEAEYQTDEADLLYKKILTQFPEYLDCHLRLGCMSRDRGQIYDASDWFKDALKVNQDHPDSWSLMGMLHLSKSEAGPAQKKFEFIVRQ--NPNDIFANVALGNIWLNTLFHPSRDKEKEKRHQERALTHYRNVLRVDPKNILAAHGIGAVLAHKGYINEARDVFAQVREATADFPDVWINIAHIYVEQKQYLAAIQMYENCIKKFNKQTNTELLLYLARAHFKCDQLKKCKQVLLKARHIAPWDPLIAYNLAFVQKRWALSVVPDEKSNFSSVLEGINDLNMAQCTFKYLSILKDQI--NIPQLPNEIKDCQDLLSQARYYLDRATKREQQERYMRQKQVEERE 2576
            +IEIPLRDTDEVIELD D  P+ DEV++ILKQE   +H+WI +ALEYY+  K  DFVK+L  A I  ++ Y D EKDQ+  LD LA YYV+QA KEK K+ K++L  Q+ + +T AD+I M+D NHLL RA F L EGD   Q D Q  FVLN S NN+PALLGK+CI+FNKK+YR AL++Y+KALR +P CPA VRLGMGHCF +L  LEKA+ AF RAL L+ +CVGALVGLAVLELN K  +S+ +GVQ LS+AY  D +NPMVLNHLA+HFF+ + Y KV  LALHAFH TE E M+A+SCYQ+AR FH +E+YD+AFQYYYQATQFAS+ FV+PF+GLGQMY+ R+D ENA   FEKVLK YPNNYET+KILGSLYA SD +++R+ AK+  + VT    DD+EAWIE AQ+L + D   +L AY  A  +L+++   D+PPEILNN+G LH    N  E +KY+  +LER    K E        + D +YY  +SVT +YN  RL+EA  +  EA+ LYK IL + P Y+DC+LRLG M+RD+G  Y+ASDWFK+AL++NQDHPD+WSL+G LHL+K E GP QKKFE I++Q    ND ++ +ALGN+WL TL  P+RD+EKEKRHQ+RAL  Y+ VLR D KN+ AA+GIGAVLAHKGY  EARDVFAQVREATA+  DVW+N+AHIYVEQKQY++A+QMYENC+KKF K  NTE+LLYLARA FKC +L++CKQ LL+ARH+AP D ++ +N+A V +R A  V+ DEKSN  +VL  + +L +A   F YLS   D++  ++    +E + C DLLSQA+Y++ RA K++++E+  R KQ +ER+
Sbjct:    5 SIEIPLRDTDEVIELDFDQLPEGDEVISILKQEHTQLHIWIALALEYYKQGKTEDFVKLLEAARIDGNLDYRDHEKDQMTCLDTLAAYYVQQARKEKNKDAKKDLINQSTLLYTMADKIIMYDQNHLLGRACFCLLEGDKMDQADAQFQFVLNQSTNNIPALLGKACISFNKKDYRGALAYYKKALRTNPGCPAEVRLGMGHCFVKLNKLEKARLAFGRALELNSKCVGALVGLAVLELNNKEADSIKNGVQLLSRAYTIDPSNPMVLNHLANHFFFKKDYSKVQHLALHAFHNTEVEAMQAESCYQLARSFHVQEDYDQAFQYYYQATQFASSTFVLPFFGLGQMYVYRRDKENAAQCFEKVLKAYPNNYETMKILGSLYATSDDQEKRDIAKEHLKKVTVQYSDDVEAWIELAQILEQTDIQGALSAYGTATRILQEKVQADVPPEILNNLGALHFRLGNLGEAKKYFLASLER---AKAE-------GEHDEHYYNAISVTTSYNLARLYEAMCEFHEAEKLYKNILREHPNYVDCYLRLGAMARDKGNFYEASDWFKEALQINQDHPDAWSLIGNLHLAKQEWGPGQKKFERILKQPSTQNDTYSMLALGNVWLQTLHQPTRDREKEKRHQDRALAIYKQVLRNDSKNLYAANGIGAVLAHKGYFREARDVFAQVREATAEISDVWLNLAHIYVEQKQYISAVQMYENCLKKFYKYQNTEVLLYLARALFKCGKLQECKQTLLRARHVAPNDTVLMFNVALVLQRLATLVLKDEKSNLKAVLSAVKELELAHRYFSYLSKSGDKMRFDLALAASEARQCSDLLSQAQYHVARARKQDEEEKEHRAKQEQERD 850          
BLAST of RNA polymerase-associated protein CTR9 homolog vs. Ensembl Zebrafish
Match: ogt.1 (O-linked N-acetylglucosamine (GlcNAc) transferase, tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GENE-030131-9631])

HSP 1 Score: 62.003 bits (149), Expect = 4.545e-9
Identity = 88/394 (22.34%), Postives = 155/394 (39.34%), Query Frame = 3
Query: 1362 EILNNVGVLHHMRKNYDETRKYYSEALERIEEVKTELSNNQDIKQDDVNYYIGLSVTINYNQGRLFEAEYQTDEADLLYKKILTQFPEYLDCHLRLGCMSRDRGQIYDASDWFKDALKVNQDHPDSWSLMGMLHLSKSEAGPAQKKFEFIVRQNPNDIFANVALGNIWLNTLFHPSRDKEKEKRHQERALTHYRNVLRVDPKNILAAHGIGAVLAHKGYINEARDVFAQVREATADFPDVWINIAHIYVEQKQYLAAIQMYENCIKKFNKQTNTELLLYLARAHFKCDQLKKCKQVLLKARHIAPWDPLIAYNLAFVQK------------RWALSVVP---DEKSNFSSVLEGINDLNMA-QCTFKYL--------------SILKDQINIPQ 2453
            E  +N+G ++  R    E  ++Y  AL               +K D ++ YI L+  +         A    + A   Y   L   P+       LG + +  G++ +A   +  A++   +   +WS +G +  ++ E   A   FE  V  +PN + A + LGN+             KE R  +RA+  Y   L + P + +    +  V   +G I+ A D + +  E    FPD + N+A+   E+     A + Y   ++     T+ + L  LA    +   +++  Q+  KA  + P       NLA V +            + A+ + P   D  SN  + L+ + D+  A QC  + +              SI KD  NIP+
Sbjct:  147 EAYSNLGNVYKERGQLQEAIEHYRHALR--------------LKPDFIDGYINLAAAL--------VAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVL------------KEARIFDRAVAGYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANALKEKGNVSEAEECYNTALRLC--PTHADSLNNLANIKREQGNIEEAVQLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPE 504          

HSP 2 Score: 61.6178 bits (148), Expect = 6.011e-9
Identity = 85/378 (22.49%), Postives = 150/378 (39.68%), Query Frame = 3
Query:  981 DEAFQYYYQATQFASNNFVMPFYGLGQMYLCRKDIENAISSFEKVLKVYPNNYETLKILGSLYAQSDKEDRREQAKKMFQNVTEIEPDDLE-----AWIEYAQLLKDDTASSLEAYTKAINLLRQENLDIPPEILNNVGVLHHMRKNYDETRKYYSEALERIEEVKTELSNNQDIKQDDVNYYIGLSVTINYNQGRLFEAEYQTDEADLLYKKILTQFPEYLDCHLRLGCMSRDRGQIYDASDWFKDALKVNQDHPDSWSLMGMLHLSKSEAGPAQKKFEFIVRQNPNDIFANVALGNIWLNTLFHPSRDKEKEKRHQERALTHYRNVLRVDPKNILAAHGIGAVLAHKGYINEARDVFAQVREATADFPDVWINIAH 2099
            +EA   Y +A +    NF + +  LG ++  + +I  AI  FEK + + PN  +    LG++  ++   DR   A   +     + P+        A + Y Q L D    +++ Y +AI L  Q +    P+   N+      + N  E  + Y+ AL         L+N  +IK++               QG +       +EA  LY+K L  FPE+   H  L  + + +G++ +A   +K+A++++    D++S MG                                      NTL        KE +  + AL  Y   ++++P    A   + ++    G I EA   +    +   DFPD + N+AH
Sbjct:  231 EEAKACYLKAIE-TQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDR---AVAGYLRALSLSPNHAVVHGNLACVYYEQGLID---LAIDTYRRAIEL--QPHF---PDAYCNLANALKEKGNVSEAEECYNTALRLCPTHADSLNNLANIKRE---------------QGNI-------EEAVQLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMG--------------------------------------NTL--------KEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAH 528          

HSP 3 Score: 60.077 bits (144), Expect = 2.142e-8
Identity = 82/417 (19.66%), Postives = 164/417 (39.33%), Query Frame = 3
Query:  924 MRAQSCYQIARGFHKEENYDEAFQYYYQATQFASNNFVMPFYGLGQMYLCRKDIENAISSFEKVLKVYPNNYETLKILGSLYAQSDKEDRREQAKKMFQNVTEIEPDDLEAWIEYAQLL--KDDTASSLEAYTKAINLLRQENLDIPPEILN---NVGVLHHMRKNYDETRKYYSEALERIEEVKTELSNNQDIKQDDVNYYIGLSVTINYNQGRLFEAEYQTDEADLLYKKILTQFPEYLDCHLRLGCMSRDRGQIYDASDWFKDALKVNQDHPDSWSLMGMLHLSKSEAGPAQKKFEFIVRQNPNDIFANVALGNIWLNTLFHPSRDKEKEKRHQERALTHYRNVLRVDPKNILAAHGIGAVLAHKGYINEARDVFAQVREATADFPDVWINIAHIYVEQKQYLAAIQMYENCIK 2159
            M A++   +   + +     EA ++Y  A +   + F+  +  L    +   D+E A+ ++   L+  P+ Y     LG+L        R E+AK  +    E +P+   AW     +   + +   ++  + KA+ L         P  L+   N+G +    + +D     Y  AL         LS N  +   ++         + Y QG +       D A   Y++ +   P + D +  L    +++G + +A + +  AL++   H DS + +  +   K E G  ++  +    +   ++F   A  +  L ++       +++ + QE AL HY+  +R+ P    A   +G  L     +  A   + +  +    F D   N+A I+ +      AI  Y   +K
Sbjct:  144 MLAEAYSNLGNVYKERGQLQEAIEHYRHALRLKPD-FIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLL---KALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTL--------DPNFLDAYINLGNVLKEARIFDRAVAGYLRAL--------SLSPNHAVVHGNL-------ACVYYEQGLI-------DLAIDTYRRAIELQPHFPDAYCNLANALKEKGNVSEAEECYNTALRLCPTHADSLNNLANI---KREQGNIEEAVQLY--RKALEVFPEFAAAHSNLASVL------QQQGKLQE-ALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALK 514          

HSP 4 Score: 57.3806 bits (137), Expect = 1.099e-7
Identity = 88/431 (20.42%), Postives = 169/431 (39.21%), Query Frame = 3
Query:  492 PNNVPALLGKSCIAFNKKEYRSALSFYRKALRNHPKCPASVRLGMGHCFFRLGNLEKAKFAFERALALDPECXXXXXXXXXXELNEKTLESVHHGVQKLSKAYMKDSNNPMVLNHLADHFFYAQQYKKVHTLALHAFHYTENELMRAQSCYQIARGFHKEENYDEAFQYYYQATQFASNNFVMPFYGLGQMYLCRKDIENAISSFEKVLKVYPNNYETLKILGSLYAQSDKEDRREQAKKMFQNVTEIEPDDLEAWIEYAQLLKD--DTASSLEAYTKAINLLRQENLDIPPEILNNVGVLHHMRKNYDETRKYYSEALERIEEVKTELSNNQDIKQDD-------VNYYIGLSVTINY-----NQGRLFEAEYQTDEADLLYKKILTQFPEYLDCHLRLGCMSRDRGQIYDASDWFKDALKVNQDHPDSW 1742
            P+N   LL  S I F  +    +  F   A++ +P   A     +G+ +   G L++A   +  AL L P+ +   + LA   +    +E     VQ    A   + +   V + L +      + ++     L A     N    A +   +   F+ +     A  ++ +A      NF+  +  LG +    +  + A++ + + L + PN+      L  +Y +    D    A   ++   E++P   +A+   A  LK+  + + + E Y  A+ L          + LNN+  +   + N +E  + Y +ALE   E     SN   + Q         ++Y   + ++  +     N G   +       A   Y + +   P + D H  L  + +D G I +A   ++ ALK+  D PD++
Sbjct:  109 PDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPML-AEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDMEG---AVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPN---FAVAWSNLGCVFNAQGEIWLAIHHFEKAVTL-DPNFLDAYINLGNVLKEARIFDRAVAGYLRALSLSPNHAVVHGNLACVYYEQGLIDL---AIDTYRRAIELQPHFPDAYCNLANALKEKGNVSEAEECYNTALRLCPTH-----ADSLNNLANIKREQGNIEEAVQLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAY 523          
BLAST of RNA polymerase-associated protein CTR9 homolog vs. Ensembl Zebrafish
Match: ogt.1 (O-linked N-acetylglucosamine (GlcNAc) transferase, tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GENE-030131-9631])

HSP 1 Score: 62.003 bits (149), Expect = 4.706e-9
Identity = 88/394 (22.34%), Postives = 155/394 (39.34%), Query Frame = 3
Query: 1362 EILNNVGVLHHMRKNYDETRKYYSEALERIEEVKTELSNNQDIKQDDVNYYIGLSVTINYNQGRLFEAEYQTDEADLLYKKILTQFPEYLDCHLRLGCMSRDRGQIYDASDWFKDALKVNQDHPDSWSLMGMLHLSKSEAGPAQKKFEFIVRQNPNDIFANVALGNIWLNTLFHPSRDKEKEKRHQERALTHYRNVLRVDPKNILAAHGIGAVLAHKGYINEARDVFAQVREATADFPDVWINIAHIYVEQKQYLAAIQMYENCIKKFNKQTNTELLLYLARAHFKCDQLKKCKQVLLKARHIAPWDPLIAYNLAFVQK------------RWALSVVP---DEKSNFSSVLEGINDLNMA-QCTFKYL--------------SILKDQINIPQ 2453
            E  +N+G ++  R    E  ++Y  AL               +K D ++ YI L+  +         A    + A   Y   L   P+       LG + +  G++ +A   +  A++   +   +WS +G +  ++ E   A   FE  V  +PN + A + LGN+             KE R  +RA+  Y   L + P + +    +  V   +G I+ A D + +  E    FPD + N+A+   E+     A + Y   ++     T+ + L  LA    +   +++  Q+  KA  + P       NLA V +            + A+ + P   D  SN  + L+ + D+  A QC  + +              SI KD  NIP+
Sbjct:   90 EAYSNLGNVYKERGQLQEAIEHYRHALR--------------LKPDFIDGYINLAAAL--------VAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVL------------KEARIFDRAVAGYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANALKEKGNVSEAEECYNTALRLC--PTHADSLNNLANIKREQGNIEEAVQLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPE 447          

HSP 2 Score: 61.6178 bits (148), Expect = 6.068e-9
Identity = 85/378 (22.49%), Postives = 150/378 (39.68%), Query Frame = 3
Query:  981 DEAFQYYYQATQFASNNFVMPFYGLGQMYLCRKDIENAISSFEKVLKVYPNNYETLKILGSLYAQSDKEDRREQAKKMFQNVTEIEPDDLE-----AWIEYAQLLKDDTASSLEAYTKAINLLRQENLDIPPEILNNVGVLHHMRKNYDETRKYYSEALERIEEVKTELSNNQDIKQDDVNYYIGLSVTINYNQGRLFEAEYQTDEADLLYKKILTQFPEYLDCHLRLGCMSRDRGQIYDASDWFKDALKVNQDHPDSWSLMGMLHLSKSEAGPAQKKFEFIVRQNPNDIFANVALGNIWLNTLFHPSRDKEKEKRHQERALTHYRNVLRVDPKNILAAHGIGAVLAHKGYINEARDVFAQVREATADFPDVWINIAH 2099
            +EA   Y +A +    NF + +  LG ++  + +I  AI  FEK + + PN  +    LG++  ++   DR   A   +     + P+        A + Y Q L D    +++ Y +AI L  Q +    P+   N+      + N  E  + Y+ AL         L+N  +IK++               QG +       +EA  LY+K L  FPE+   H  L  + + +G++ +A   +K+A++++    D++S MG                                      NTL        KE +  + AL  Y   ++++P    A   + ++    G I EA   +    +   DFPD + N+AH
Sbjct:  174 EEAKACYLKAIE-TQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDR---AVAGYLRALSLSPNHAVVHGNLACVYYEQGLID---LAIDTYRRAIEL--QPHF---PDAYCNLANALKEKGNVSEAEECYNTALRLCPTHADSLNNLANIKRE---------------QGNI-------EEAVQLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMG--------------------------------------NTL--------KEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAH 471          

HSP 3 Score: 59.6918 bits (143), Expect = 2.336e-8
Identity = 82/417 (19.66%), Postives = 164/417 (39.33%), Query Frame = 3
Query:  924 MRAQSCYQIARGFHKEENYDEAFQYYYQATQFASNNFVMPFYGLGQMYLCRKDIENAISSFEKVLKVYPNNYETLKILGSLYAQSDKEDRREQAKKMFQNVTEIEPDDLEAWIEYAQLL--KDDTASSLEAYTKAINLLRQENLDIPPEILN---NVGVLHHMRKNYDETRKYYSEALERIEEVKTELSNNQDIKQDDVNYYIGLSVTINYNQGRLFEAEYQTDEADLLYKKILTQFPEYLDCHLRLGCMSRDRGQIYDASDWFKDALKVNQDHPDSWSLMGMLHLSKSEAGPAQKKFEFIVRQNPNDIFANVALGNIWLNTLFHPSRDKEKEKRHQERALTHYRNVLRVDPKNILAAHGIGAVLAHKGYINEARDVFAQVREATADFPDVWINIAHIYVEQKQYLAAIQMYENCIK 2159
            M A++   +   + +     EA ++Y  A +   + F+  +  L    +   D+E A+ ++   L+  P+ Y     LG+L        R E+AK  +    E +P+   AW     +   + +   ++  + KA+ L         P  L+   N+G +    + +D     Y  AL         LS N  +   ++         + Y QG +       D A   Y++ +   P + D +  L    +++G + +A + +  AL++   H DS + +  +   K E G  ++  +    +   ++F   A  +  L ++       +++ + QE AL HY+  +R+ P    A   +G  L     +  A   + +  +    F D   N+A I+ +      AI  Y   +K
Sbjct:   87 MLAEAYSNLGNVYKERGQLQEAIEHYRHALRLKPD-FIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLL---KALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTL--------DPNFLDAYINLGNVLKEARIFDRAVAGYLRAL--------SLSPNHAVVHGNL-------ACVYYEQGLI-------DLAIDTYRRAIELQPHFPDAYCNLANALKEKGNVSEAEECYNTALRLCPTHADSLNNLANI---KREQGNIEEAVQLY--RKALEVFPEFAAAHSNLASVL------QQQGKLQE-ALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALK 457          

HSP 4 Score: 57.3806 bits (137), Expect = 1.396e-7
Identity = 88/431 (20.42%), Postives = 169/431 (39.21%), Query Frame = 3
Query:  492 PNNVPALLGKSCIAFNKKEYRSALSFYRKALRNHPKCPASVRLGMGHCFFRLGNLEKAKFAFERALALDPECXXXXXXXXXXELNEKTLESVHHGVQKLSKAYMKDSNNPMVLNHLADHFFYAQQYKKVHTLALHAFHYTENELMRAQSCYQIARGFHKEENYDEAFQYYYQATQFASNNFVMPFYGLGQMYLCRKDIENAISSFEKVLKVYPNNYETLKILGSLYAQSDKEDRREQAKKMFQNVTEIEPDDLEAWIEYAQLLKD--DTASSLEAYTKAINLLRQENLDIPPEILNNVGVLHHMRKNYDETRKYYSEALERIEEVKTELSNNQDIKQDD-------VNYYIGLSVTINY-----NQGRLFEAEYQTDEADLLYKKILTQFPEYLDCHLRLGCMSRDRGQIYDASDWFKDALKVNQDHPDSW 1742
            P+N   LL  S I F  +    +  F   A++ +P   A     +G+ +   G L++A   +  AL L P+ +   + LA   +    +E     VQ    A   + +   V + L +      + ++     L A     N    A +   +   F+ +     A  ++ +A      NF+  +  LG +    +  + A++ + + L + PN+      L  +Y +    D    A   ++   E++P   +A+   A  LK+  + + + E Y  A+ L          + LNN+  +   + N +E  + Y +ALE   E     SN   + Q         ++Y   + ++  +     N G   +       A   Y + +   P + D H  L  + +D G I +A   ++ ALK+  D PD++
Sbjct:   52 PDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPML-AEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDMEG---AVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPN---FAVAWSNLGCVFNAQGEIWLAIHHFEKAVTL-DPNFLDAYINLGNVLKEARIFDRAVAGYLRALSLSPNHAVVHGNLACVYYEQGLIDL---AIDTYRRAIELQPHFPDAYCNLANALKEKGNVSEAEECYNTALRLCPTH-----ADSLNNLANIKREQGNIEEAVQLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAY 466          
BLAST of RNA polymerase-associated protein CTR9 homolog vs. Ensembl Zebrafish
Match: ogt.1 (O-linked N-acetylglucosamine (GlcNAc) transferase, tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GENE-030131-9631])

HSP 1 Score: 62.003 bits (149), Expect = 5.139e-9
Identity = 88/394 (22.34%), Postives = 155/394 (39.34%), Query Frame = 3
Query: 1362 EILNNVGVLHHMRKNYDETRKYYSEALERIEEVKTELSNNQDIKQDDVNYYIGLSVTINYNQGRLFEAEYQTDEADLLYKKILTQFPEYLDCHLRLGCMSRDRGQIYDASDWFKDALKVNQDHPDSWSLMGMLHLSKSEAGPAQKKFEFIVRQNPNDIFANVALGNIWLNTLFHPSRDKEKEKRHQERALTHYRNVLRVDPKNILAAHGIGAVLAHKGYINEARDVFAQVREATADFPDVWINIAHIYVEQKQYLAAIQMYENCIKKFNKQTNTELLLYLARAHFKCDQLKKCKQVLLKARHIAPWDPLIAYNLAFVQK------------RWALSVVP---DEKSNFSSVLEGINDLNMA-QCTFKYL--------------SILKDQINIPQ 2453
            E  +N+G ++  R    E  ++Y  AL               +K D ++ YI L+  +         A    + A   Y   L   P+       LG + +  G++ +A   +  A++   +   +WS +G +  ++ E   A   FE  V  +PN + A + LGN+             KE R  +RA+  Y   L + P + +    +  V   +G I+ A D + +  E    FPD + N+A+   E+     A + Y   ++     T+ + L  LA    +   +++  Q+  KA  + P       NLA V +            + A+ + P   D  SN  + L+ + D+  A QC  + +              SI KD  NIP+
Sbjct:  147 EAYSNLGNVYKERGQLQEAIEHYRHALR--------------LKPDFIDGYINLAAAL--------VAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVL------------KEARIFDRAVAGYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANALKEKGNVSEAEECYNTALRLC--PTHADSLNNLANIKREQGNIEEAVQLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPE 504          

HSP 2 Score: 61.6178 bits (148), Expect = 6.460e-9
Identity = 85/378 (22.49%), Postives = 150/378 (39.68%), Query Frame = 3
Query:  981 DEAFQYYYQATQFASNNFVMPFYGLGQMYLCRKDIENAISSFEKVLKVYPNNYETLKILGSLYAQSDKEDRREQAKKMFQNVTEIEPDDLE-----AWIEYAQLLKDDTASSLEAYTKAINLLRQENLDIPPEILNNVGVLHHMRKNYDETRKYYSEALERIEEVKTELSNNQDIKQDDVNYYIGLSVTINYNQGRLFEAEYQTDEADLLYKKILTQFPEYLDCHLRLGCMSRDRGQIYDASDWFKDALKVNQDHPDSWSLMGMLHLSKSEAGPAQKKFEFIVRQNPNDIFANVALGNIWLNTLFHPSRDKEKEKRHQERALTHYRNVLRVDPKNILAAHGIGAVLAHKGYINEARDVFAQVREATADFPDVWINIAH 2099
            +EA   Y +A +    NF + +  LG ++  + +I  AI  FEK + + PN  +    LG++  ++   DR   A   +     + P+        A + Y Q L D    +++ Y +AI L  Q +    P+   N+      + N  E  + Y+ AL         L+N  +IK++               QG +       +EA  LY+K L  FPE+   H  L  + + +G++ +A   +K+A++++    D++S MG                                      NTL        KE +  + AL  Y   ++++P    A   + ++    G I EA   +    +   DFPD + N+AH
Sbjct:  231 EEAKACYLKAIE-TQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDR---AVAGYLRALSLSPNHAVVHGNLACVYYEQGLID---LAIDTYRRAIEL--QPHF---PDAYCNLANALKEKGNVSEAEECYNTALRLCPTHADSLNNLANIKRE---------------QGNI-------EEAVQLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMG--------------------------------------NTL--------KEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAH 528          

HSP 3 Score: 59.6918 bits (143), Expect = 2.591e-8
Identity = 82/417 (19.66%), Postives = 164/417 (39.33%), Query Frame = 3
Query:  924 MRAQSCYQIARGFHKEENYDEAFQYYYQATQFASNNFVMPFYGLGQMYLCRKDIENAISSFEKVLKVYPNNYETLKILGSLYAQSDKEDRREQAKKMFQNVTEIEPDDLEAWIEYAQLL--KDDTASSLEAYTKAINLLRQENLDIPPEILN---NVGVLHHMRKNYDETRKYYSEALERIEEVKTELSNNQDIKQDDVNYYIGLSVTINYNQGRLFEAEYQTDEADLLYKKILTQFPEYLDCHLRLGCMSRDRGQIYDASDWFKDALKVNQDHPDSWSLMGMLHLSKSEAGPAQKKFEFIVRQNPNDIFANVALGNIWLNTLFHPSRDKEKEKRHQERALTHYRNVLRVDPKNILAAHGIGAVLAHKGYINEARDVFAQVREATADFPDVWINIAHIYVEQKQYLAAIQMYENCIK 2159
            M A++   +   + +     EA ++Y  A +   + F+  +  L    +   D+E A+ ++   L+  P+ Y     LG+L        R E+AK  +    E +P+   AW     +   + +   ++  + KA+ L         P  L+   N+G +    + +D     Y  AL         LS N  +   ++         + Y QG +       D A   Y++ +   P + D +  L    +++G + +A + +  AL++   H DS + +  +   K E G  ++  +    +   ++F   A  +  L ++       +++ + QE AL HY+  +R+ P    A   +G  L     +  A   + +  +    F D   N+A I+ +      AI  Y   +K
Sbjct:  144 MLAEAYSNLGNVYKERGQLQEAIEHYRHALRLKPD-FIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLL---KALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTL--------DPNFLDAYINLGNVLKEARIFDRAVAGYLRAL--------SLSPNHAVVHGNL-------ACVYYEQGLI-------DLAIDTYRRAIELQPHFPDAYCNLANALKEKGNVSEAEECYNTALRLCPTHADSLNNLANI---KREQGNIEEAVQLY--RKALEVFPEFAAAHSNLASVL------QQQGKLQE-ALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALK 514          

HSP 4 Score: 57.3806 bits (137), Expect = 1.263e-7
Identity = 88/431 (20.42%), Postives = 169/431 (39.21%), Query Frame = 3
Query:  492 PNNVPALLGKSCIAFNKKEYRSALSFYRKALRNHPKCPASVRLGMGHCFFRLGNLEKAKFAFERALALDPECXXXXXXXXXXELNEKTLESVHHGVQKLSKAYMKDSNNPMVLNHLADHFFYAQQYKKVHTLALHAFHYTENELMRAQSCYQIARGFHKEENYDEAFQYYYQATQFASNNFVMPFYGLGQMYLCRKDIENAISSFEKVLKVYPNNYETLKILGSLYAQSDKEDRREQAKKMFQNVTEIEPDDLEAWIEYAQLLKD--DTASSLEAYTKAINLLRQENLDIPPEILNNVGVLHHMRKNYDETRKYYSEALERIEEVKTELSNNQDIKQDD-------VNYYIGLSVTINY-----NQGRLFEAEYQTDEADLLYKKILTQFPEYLDCHLRLGCMSRDRGQIYDASDWFKDALKVNQDHPDSW 1742
            P+N   LL  S I F  +    +  F   A++ +P   A     +G+ +   G L++A   +  AL L P+ +   + LA   +    +E     VQ    A   + +   V + L +      + ++     L A     N    A +   +   F+ +     A  ++ +A      NF+  +  LG +    +  + A++ + + L + PN+      L  +Y +    D    A   ++   E++P   +A+   A  LK+  + + + E Y  A+ L          + LNN+  +   + N +E  + Y +ALE   E     SN   + Q         ++Y   + ++  +     N G   +       A   Y + +   P + D H  L  + +D G I +A   ++ ALK+  D PD++
Sbjct:  109 PDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPML-AEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDMEG---AVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPN---FAVAWSNLGCVFNAQGEIWLAIHHFEKAVTL-DPNFLDAYINLGNVLKEARIFDRAVAGYLRALSLSPNHAVVHGNLACVYYEQGLIDL---AIDTYRRAIELQPHFPDAYCNLANALKEKGNVSEAEECYNTALRLCPTH-----ADSLNNLANIKREQGNIEEAVQLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAY 523          
BLAST of RNA polymerase-associated protein CTR9 homolog vs. Ensembl Zebrafish
Match: ogt.1 (O-linked N-acetylglucosamine (GlcNAc) transferase, tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GENE-030131-9631])

HSP 1 Score: 61.6178 bits (148), Expect = 5.653e-9
Identity = 88/394 (22.34%), Postives = 155/394 (39.34%), Query Frame = 3
Query: 1362 EILNNVGVLHHMRKNYDETRKYYSEALERIEEVKTELSNNQDIKQDDVNYYIGLSVTINYNQGRLFEAEYQTDEADLLYKKILTQFPEYLDCHLRLGCMSRDRGQIYDASDWFKDALKVNQDHPDSWSLMGMLHLSKSEAGPAQKKFEFIVRQNPNDIFANVALGNIWLNTLFHPSRDKEKEKRHQERALTHYRNVLRVDPKNILAAHGIGAVLAHKGYINEARDVFAQVREATADFPDVWINIAHIYVEQKQYLAAIQMYENCIKKFNKQTNTELLLYLARAHFKCDQLKKCKQVLLKARHIAPWDPLIAYNLAFVQK------------RWALSVVP---DEKSNFSSVLEGINDLNMA-QCTFKYL--------------SILKDQINIPQ 2453
            E  +N+G ++  R    E  ++Y  AL               +K D ++ YI L+  +         A    + A   Y   L   P+       LG + +  G++ +A   +  A++   +   +WS +G +  ++ E   A   FE  V  +PN + A + LGN+             KE R  +RA+  Y   L + P + +    +  V   +G I+ A D + +  E    FPD + N+A+   E+     A + Y   ++     T+ + L  LA    +   +++  Q+  KA  + P       NLA V +            + A+ + P   D  SN  + L+ + D+  A QC  + +              SI KD  NIP+
Sbjct:   80 EAYSNLGNVYKERGQLQEAIEHYRHALR--------------LKPDFIDGYINLAAAL--------VAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVL------------KEARIFDRAVAGYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANALKEKGNVSEAEECYNTALRLC--PTHADSLNNLANIKREQGNIEEAVQLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPE 437          

HSP 2 Score: 61.6178 bits (148), Expect = 6.698e-9
Identity = 85/378 (22.49%), Postives = 150/378 (39.68%), Query Frame = 3
Query:  981 DEAFQYYYQATQFASNNFVMPFYGLGQMYLCRKDIENAISSFEKVLKVYPNNYETLKILGSLYAQSDKEDRREQAKKMFQNVTEIEPDDLE-----AWIEYAQLLKDDTASSLEAYTKAINLLRQENLDIPPEILNNVGVLHHMRKNYDETRKYYSEALERIEEVKTELSNNQDIKQDDVNYYIGLSVTINYNQGRLFEAEYQTDEADLLYKKILTQFPEYLDCHLRLGCMSRDRGQIYDASDWFKDALKVNQDHPDSWSLMGMLHLSKSEAGPAQKKFEFIVRQNPNDIFANVALGNIWLNTLFHPSRDKEKEKRHQERALTHYRNVLRVDPKNILAAHGIGAVLAHKGYINEARDVFAQVREATADFPDVWINIAH 2099
            +EA   Y +A +    NF + +  LG ++  + +I  AI  FEK + + PN  +    LG++  ++   DR   A   +     + P+        A + Y Q L D    +++ Y +AI L  Q +    P+   N+      + N  E  + Y+ AL         L+N  +IK++               QG +       +EA  LY+K L  FPE+   H  L  + + +G++ +A   +K+A++++    D++S MG                                      NTL        KE +  + AL  Y   ++++P    A   + ++    G I EA   +    +   DFPD + N+AH
Sbjct:  164 EEAKACYLKAIE-TQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDR---AVAGYLRALSLSPNHAVVHGNLACVYYEQGLID---LAIDTYRRAIEL--QPHF---PDAYCNLANALKEKGNVSEAEECYNTALRLCPTHADSLNNLANIKRE---------------QGNI-------EEAVQLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMG--------------------------------------NTL--------KEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAH 461          

HSP 3 Score: 59.3066 bits (142), Expect = 2.783e-8
Identity = 82/417 (19.66%), Postives = 164/417 (39.33%), Query Frame = 3
Query:  924 MRAQSCYQIARGFHKEENYDEAFQYYYQATQFASNNFVMPFYGLGQMYLCRKDIENAISSFEKVLKVYPNNYETLKILGSLYAQSDKEDRREQAKKMFQNVTEIEPDDLEAWIEYAQLL--KDDTASSLEAYTKAINLLRQENLDIPPEILN---NVGVLHHMRKNYDETRKYYSEALERIEEVKTELSNNQDIKQDDVNYYIGLSVTINYNQGRLFEAEYQTDEADLLYKKILTQFPEYLDCHLRLGCMSRDRGQIYDASDWFKDALKVNQDHPDSWSLMGMLHLSKSEAGPAQKKFEFIVRQNPNDIFANVALGNIWLNTLFHPSRDKEKEKRHQERALTHYRNVLRVDPKNILAAHGIGAVLAHKGYINEARDVFAQVREATADFPDVWINIAHIYVEQKQYLAAIQMYENCIK 2159
            M A++   +   + +     EA ++Y  A +   + F+  +  L    +   D+E A+ ++   L+  P+ Y     LG+L        R E+AK  +    E +P+   AW     +   + +   ++  + KA+ L         P  L+   N+G +    + +D     Y  AL         LS N  +   ++         + Y QG +       D A   Y++ +   P + D +  L    +++G + +A + +  AL++   H DS + +  +   K E G  ++  +    +   ++F   A  +  L ++       +++ + QE AL HY+  +R+ P    A   +G  L     +  A   + +  +    F D   N+A I+ +      AI  Y   +K
Sbjct:   77 MLAEAYSNLGNVYKERGQLQEAIEHYRHALRLKPD-FIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLL---KALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTL--------DPNFLDAYINLGNVLKEARIFDRAVAGYLRAL--------SLSPNHAVVHGNL-------ACVYYEQGLI-------DLAIDTYRRAIELQPHFPDAYCNLANALKEKGNVSEAEECYNTALRLCPTHADSLNNLANI---KREQGNIEEAVQLY--RKALEVFPEFAAAHSNLASVL------QQQGKLQE-ALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALK 447          

HSP 4 Score: 56.9954 bits (136), Expect = 1.441e-7
Identity = 88/431 (20.42%), Postives = 169/431 (39.21%), Query Frame = 3
Query:  492 PNNVPALLGKSCIAFNKKEYRSALSFYRKALRNHPKCPASVRLGMGHCFFRLGNLEKAKFAFERALALDPECXXXXXXXXXXELNEKTLESVHHGVQKLSKAYMKDSNNPMVLNHLADHFFYAQQYKKVHTLALHAFHYTENELMRAQSCYQIARGFHKEENYDEAFQYYYQATQFASNNFVMPFYGLGQMYLCRKDIENAISSFEKVLKVYPNNYETLKILGSLYAQSDKEDRREQAKKMFQNVTEIEPDDLEAWIEYAQLLKD--DTASSLEAYTKAINLLRQENLDIPPEILNNVGVLHHMRKNYDETRKYYSEALERIEEVKTELSNNQDIKQDD-------VNYYIGLSVTINY-----NQGRLFEAEYQTDEADLLYKKILTQFPEYLDCHLRLGCMSRDRGQIYDASDWFKDALKVNQDHPDSW 1742
            P+N   LL  S I F  +    +  F   A++ +P   A     +G+ +   G L++A   +  AL L P+ +   + LA   +    +E     VQ    A   + +   V + L +      + ++     L A     N    A +   +   F+ +     A  ++ +A      NF+  +  LG +    +  + A++ + + L + PN+      L  +Y +    D    A   ++   E++P   +A+   A  LK+  + + + E Y  A+ L          + LNN+  +   + N +E  + Y +ALE   E     SN   + Q         ++Y   + ++  +     N G   +       A   Y + +   P + D H  L  + +D G I +A   ++ ALK+  D PD++
Sbjct:   42 PDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPML-AEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDMEG---AVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPN---FAVAWSNLGCVFNAQGEIWLAIHHFEKAVTL-DPNFLDAYINLGNVLKEARIFDRAVAGYLRALSLSPNHAVVHGNLACVYYEQGLIDL---AIDTYRRAIELQPHFPDAYCNLANALKEKGNVSEAEECYNTALRLCPTH-----ADSLNNLANIKREQGNIEEAVQLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAY 456          
BLAST of RNA polymerase-associated protein CTR9 homolog vs. Ensembl Xenopus
Match: ctr9 (CTR9 homolog, Paf1/RNA polymerase II complex component [Source:NCBI gene;Acc:448648])

HSP 1 Score: 937.947 bits (2423), Expect = 0.000e+0
Identity = 474/821 (57.73%), Postives = 611/821 (74.42%), Query Frame = 3
Query:  132 PMHVWILVALEYYRSKKYNDFVKVLNEANIHASVTYADSEKDQVKVLDMLANYYVKQASXXXXXXXXXXLFGQAAVHFTTADRIAMFDHNHLLSRAFFFLFEGDNWSQVDNQLNFVLNSSPNNVPALLGKSCIAFNKKEYRSALSFYRKALRNHPKCPASVRLGMGHCFFRLGNLEKAKFAFERALALDPECXXXXXXXXXXELNEKTLESVHHGVQKLSKAYMKDSNNPMVLNHLADHFFYAQQYKKVHTLALHAFHYTENELMRAQSCYQIARGFHKEENYDEAFQYYYQATQFASNNFVMPFYGLGQMYLCRKDIENAISSFEKVLKVYPNNYETLKILGSLYAQSDKEDRREQAKKMFQNVTEIEPDDLEAWIEYAQLL-KDDTASSLEAYTKAINLLRQE-NLDIPPEILNNVGVLHHMRKNYDETRKYYSEALERIEEVKTELSNNQDIKQDDVNYYIGLSVTINYNQGRLFEAEYQTDEADLLYKKILTQFPEYLDCHLRLGCMSRDRGQIYDASDWFKDALKVNQDHPDSWSLMGMLHLSKSEAGPAQKKFEFIVRQ--NPNDIFANVALGNIWLNTLFHPSRDKEKEKRHQERALTHYRNVLRVDPKNILAAHGIGAVLAHKGYINEARDVFAQVREATADFPDVWINIAHIYVEQKQYLAAIQMYENCIKKFNKQTNTELLLYLARAHFKCDQLKKCKQVLLKARHIAPWDPLIAYNLAFVQKRWALSVVPDEKSNFSSVLEGINDLNMAQCTFKYLSILKDQI--NIPQLPNEIKDCQDLLSQARYYLDRATKREQQERYMRQKQVEERE 2576
            P      + LEYY+  K  DFVK+L  A I  ++ Y D EKDQ+  LD LA YYV+QA KEK K+ K+EL  QA + +T AD+I M+D NHLL RA F L EGD   Q D Q +FVLN SPNN+PALLGK+CI+FNKK+YR AL++Y+KALR +P CPA VRLGMGHCF +L  L+KA+ AF RAL L+P CVGALVGLAVLELN K  +S+ +GVQ LSKAY  D +NPMVLNHLA+HFF+ + Y KV  LALHAFH TE E M+A+SCYQ+AR FH +E+YD+AFQYYYQATQFA+ +FV+PF+GLGQMY+ R D ENA   FEKVLK YPNNYET+KILGSLYA SD +++R+ AK   + VTE  PDD+EAWIE AQ+L + D  ++L AY  A  +L+++   D+PPEILNNVG LH    N  E +KY+  +L+R    K E  +       D +YY  +SVT  YN  RL+E   +  E++ LYK IL + P Y+DC+LRLG M+RD+G  Y+ASDWFK+AL++NQDHPD+WSL+G LHL+K E GP QKKFE I++Q    ND ++ +ALGN+WL TL  P+RD+EKEKRHQ+RAL  Y+ VLR D KN+ AA+GIGAVLAHKGY+ EARDVFAQVREATAD  DVW+N+AHIYVEQKQY++A+QMYENC++KF K  NTE+LLYLARA FKC +L++CKQ+LLKARH+AP D ++ +N+A V +R A  V+ DEKSN  +VL  + +L +A   F YLS + D++  ++    +E + C DLLSQA+Y++ RA K++++E+ +R KQ +E+E
Sbjct:   19 PCAPCCPLQLEYYKQVKTEDFVKLLEAARIDGNLDYRDHEKDQMTCLDTLAAYYVQQARKEKNKDNKKELITQATLLYTMADKIIMYDQNHLLGRACFCLLEGDKMDQADAQFHFVLNQSPNNIPALLGKACISFNKKDYRGALAYYKKALRTNPGCPAGVRLGMGHCFVKLNKLDKARLAFGRALDLNPTCVGALVGLAVLELNNKEADSIKNGVQLLSKAYTIDPSNPMVLNHLANHFFFKKDYSKVQHLALHAFHNTEVEAMQAESCYQLARSFHVQEDYDQAFQYYYQATQFAAASFVLPFFGLGQMYIYRGDKENASQCFEKVLKAYPNNYETMKILGSLYAASDDQEKRDIAKSHLKKVTEQYPDDVEAWIELAQILEQTDIQNALSAYGTATRILQEKVQADVPPEILNNVGALHFRLGNLGEAKKYFLASLDR---AKAEAEH-------DEHYYNAISVTTTYNLARLYEGLCEFHESEKLYKNILREHPNYVDCYLRLGAMARDKGNFYEASDWFKEALQINQDHPDAWSLIGNLHLAKQEWGPGQKKFERILKQPSTQNDTYSMLALGNVWLQTLHQPTRDREKEKRHQDRALAIYKQVLRNDSKNLYAANGIGAVLAHKGYVREARDVFAQVREATADISDVWLNLAHIYVEQKQYISAVQMYENCLRKFYKHQNTEVLLYLARALFKCGKLQECKQILLKARHVAPNDTVLMFNVALVLQRLATLVLKDEKSNLKAVLNAVKELELAHRYFNYLSKVGDKMRFDLALAASEARQCSDLLSQAQYHVARARKQDEEEKELRAKQEQEKE 829          
BLAST of RNA polymerase-associated protein CTR9 homolog vs. Ensembl Xenopus
Match: ctr9 (CTR9 homolog, Paf1/RNA polymerase II complex component [Source:NCBI gene;Acc:448648])

HSP 1 Score: 937.947 bits (2423), Expect = 0.000e+0
Identity = 474/821 (57.73%), Postives = 611/821 (74.42%), Query Frame = 3
Query:  132 PMHVWILVALEYYRSKKYNDFVKVLNEANIHASVTYADSEKDQVKVLDMLANYYVKQASXXXXXXXXXXLFGQAAVHFTTADRIAMFDHNHLLSRAFFFLFEGDNWSQVDNQLNFVLNSSPNNVPALLGKSCIAFNKKEYRSALSFYRKALRNHPKCPASVRLGMGHCFFRLGNLEKAKFAFERALALDPECXXXXXXXXXXELNEKTLESVHHGVQKLSKAYMKDSNNPMVLNHLADHFFYAQQYKKVHTLALHAFHYTENELMRAQSCYQIARGFHKEENYDEAFQYYYQATQFASNNFVMPFYGLGQMYLCRKDIENAISSFEKVLKVYPNNYETLKILGSLYAQSDKEDRREQAKKMFQNVTEIEPDDLEAWIEYAQLL-KDDTASSLEAYTKAINLLRQE-NLDIPPEILNNVGVLHHMRKNYDETRKYYSEALERIEEVKTELSNNQDIKQDDVNYYIGLSVTINYNQGRLFEAEYQTDEADLLYKKILTQFPEYLDCHLRLGCMSRDRGQIYDASDWFKDALKVNQDHPDSWSLMGMLHLSKSEAGPAQKKFEFIVRQ--NPNDIFANVALGNIWLNTLFHPSRDKEKEKRHQERALTHYRNVLRVDPKNILAAHGIGAVLAHKGYINEARDVFAQVREATADFPDVWINIAHIYVEQKQYLAAIQMYENCIKKFNKQTNTELLLYLARAHFKCDQLKKCKQVLLKARHIAPWDPLIAYNLAFVQKRWALSVVPDEKSNFSSVLEGINDLNMAQCTFKYLSILKDQI--NIPQLPNEIKDCQDLLSQARYYLDRATKREQQERYMRQKQVEERE 2576
            P      + LEYY+  K  DFVK+L  A I  ++ Y D EKDQ+  LD LA YYV+QA KEK K+ K+EL  QA + +T AD+I M+D NHLL RA F L EGD   Q D Q +FVLN SPNN+PALLGK+CI+FNKK+YR AL++Y+KALR +P CPA VRLGMGHCF +L  L+KA+ AF RAL L+P CVGALVGLAVLELN K  +S+ +GVQ LSKAY  D +NPMVLNHLA+HFF+ + Y KV  LALHAFH TE E M+A+SCYQ+AR FH +E+YD+AFQYYYQATQFA+ +FV+PF+GLGQMY+ R D ENA   FEKVLK YPNNYET+KILGSLYA SD +++R+ AK   + VTE  PDD+EAWIE AQ+L + D  ++L AY  A  +L+++   D+PPEILNNVG LH    N  E +KY+  +L+R    K E        + D +YY  +SVT  YN  RL+E   +  E++ LYK IL + P Y+DC+LRLG M+RD+G  Y+ASDWFK+AL++NQDHPD+WSL+G LHL+K E GP QKKFE I++Q    ND ++ +ALGN+WL TL  P+RD+EKEKRHQ+RAL  Y+ VLR D KN+ AA+GIGAVLAHKGY+ EARDVFAQVREATAD  DVW+N+AHIYVEQKQY++A+QMYENC++KF K  NTE+LLYLARA FKC +L++CKQ+LLKARH+AP D ++ +N+A V +R A  V+ DEKSN  +VL  + +L +A   F YLS + D++  ++    +E + C DLLSQA+Y++ RA K++++E+ +R KQ +E+E
Sbjct:   19 PCAPCCPLQLEYYKQVKTEDFVKLLEAARIDGNLDYRDHEKDQMTCLDTLAAYYVQQARKEKNKDNKKELITQATLLYTMADKIIMYDQNHLLGRACFCLLEGDKMDQADAQFHFVLNQSPNNIPALLGKACISFNKKDYRGALAYYKKALRTNPGCPAGVRLGMGHCFVKLNKLDKARLAFGRALDLNPTCVGALVGLAVLELNNKEADSIKNGVQLLSKAYTIDPSNPMVLNHLANHFFFKKDYSKVQHLALHAFHNTEVEAMQAESCYQLARSFHVQEDYDQAFQYYYQATQFAAASFVLPFFGLGQMYIYRGDKENASQCFEKVLKAYPNNYETMKILGSLYAASDDQEKRDIAKSHLKKVTEQYPDDVEAWIELAQILEQTDIQNALSAYGTATRILQEKVQADVPPEILNNVGALHFRLGNLGEAKKYFLASLDR---AKAE-------AEHDEHYYNAISVTTTYNLARLYEGLCEFHESEKLYKNILREHPNYVDCYLRLGAMARDKGNFYEASDWFKEALQINQDHPDAWSLIGNLHLAKQEWGPGQKKFERILKQPSTQNDTYSMLALGNVWLQTLHQPTRDREKEKRHQDRALAIYKQVLRNDSKNLYAANGIGAVLAHKGYVREARDVFAQVREATADISDVWLNLAHIYVEQKQYISAVQMYENCLRKFYKHQNTEVLLYLARALFKCGKLQECKQILLKARHVAPNDTVLMFNVALVLQRLATLVLKDEKSNLKAVLNAVKELELAHRYFNYLSKVGDKMRFDLALAASEARQCSDLLSQAQYHVARARKQDEEEKELRAKQEQEKE 829          
BLAST of RNA polymerase-associated protein CTR9 homolog vs. Ensembl Xenopus
Match: ctr9 (CTR9 homolog, Paf1/RNA polymerase II complex component [Source:NCBI gene;Acc:448648])

HSP 1 Score: 937.562 bits (2422), Expect = 0.000e+0
Identity = 474/821 (57.73%), Postives = 611/821 (74.42%), Query Frame = 3
Query:  132 PMHVWILVALEYYRSKKYNDFVKVLNEANIHASVTYADSEKDQVKVLDMLANYYVKQASXXXXXXXXXXLFGQAAVHFTTADRIAMFDHNHLLSRAFFFLFEGDNWSQVDNQLNFVLNSSPNNVPALLGKSCIAFNKKEYRSALSFYRKALRNHPKCPASVRLGMGHCFFRLGNLEKAKFAFERALALDPECXXXXXXXXXXELNEKTLESVHHGVQKLSKAYMKDSNNPMVLNHLADHFFYAQQYKKVHTLALHAFHYTENELMRAQSCYQIARGFHKEENYDEAFQYYYQATQFASNNFVMPFYGLGQMYLCRKDIENAISSFEKVLKVYPNNYETLKILGSLYAQSDKEDRREQAKKMFQNVTEIEPDDLEAWIEYAQLL-KDDTASSLEAYTKAINLLRQE-NLDIPPEILNNVGVLHHMRKNYDETRKYYSEALERIEEVKTELSNNQDIKQDDVNYYIGLSVTINYNQGRLFEAEYQTDEADLLYKKILTQFPEYLDCHLRLGCMSRDRGQIYDASDWFKDALKVNQDHPDSWSLMGMLHLSKSEAGPAQKKFEFIVRQ--NPNDIFANVALGNIWLNTLFHPSRDKEKEKRHQERALTHYRNVLRVDPKNILAAHGIGAVLAHKGYINEARDVFAQVREATADFPDVWINIAHIYVEQKQYLAAIQMYENCIKKFNKQTNTELLLYLARAHFKCDQLKKCKQVLLKARHIAPWDPLIAYNLAFVQKRWALSVVPDEKSNFSSVLEGINDLNMAQCTFKYLSILKDQI--NIPQLPNEIKDCQDLLSQARYYLDRATKREQQERYMRQKQVEERE 2576
            P      + LEYY+  K  DFVK+L  A I  ++ Y D EKDQ+  LD LA YYV+QA KEK K+ K+EL  QA + +T AD+I M+D NHLL RA F L EGD   Q D Q +FVLN SPNN+PALLGK+CI+FNKK+YR AL++Y+KALR +P CPA VRLGMGHCF +L  L+KA+ AF RAL L+P CVGALVGLAVLELN K  +S+ +GVQ LSKAY  D +NPMVLNHLA+HFF+ + Y KV  LALHAFH TE E M+A+SCYQ+AR FH +E+YD+AFQYYYQATQFA+ +FV+PF+GLGQMY+ R D ENA   FEKVLK YPNNYET+KILGSLYA SD +++R+ AK   + VTE  PDD+EAWIE AQ+L + D  ++L AY  A  +L+++   D+PPEILNNVG LH    N  E +KY+  +L+R    K E        + D +YY  +SVT  YN  RL+E   +  E++ LYK IL + P Y+DC+LRLG M+RD+G  Y+ASDWFK+AL++NQDHPD+WSL+G LHL+K E GP QKKFE I++Q    ND ++ +ALGN+WL TL  P+RD+EKEKRHQ+RAL  Y+ VLR D KN+ AA+GIGAVLAHKGY+ EARDVFAQVREATAD  DVW+N+AHIYVEQKQY++A+QMYENC++KF K  NTE+LLYLARA FKC +L++CKQ+LLKARH+AP D ++ +N+A V +R A  V+ DEKSN  +VL  + +L +A   F YLS + D++  ++    +E + C DLLSQA+Y++ RA K++++E+ +R KQ +E+E
Sbjct:   19 PCAPCCPLQLEYYKQVKTEDFVKLLEAARIDGNLDYRDHEKDQMTCLDTLAAYYVQQARKEKNKDNKKELITQATLLYTMADKIIMYDQNHLLGRACFCLLEGDKMDQADAQFHFVLNQSPNNIPALLGKACISFNKKDYRGALAYYKKALRTNPGCPAGVRLGMGHCFVKLNKLDKARLAFGRALDLNPTCVGALVGLAVLELNNKEADSIKNGVQLLSKAYTIDPSNPMVLNHLANHFFFKKDYSKVQHLALHAFHNTEVEAMQAESCYQLARSFHVQEDYDQAFQYYYQATQFAAASFVLPFFGLGQMYIYRGDKENASQCFEKVLKAYPNNYETMKILGSLYAASDDQEKRDIAKSHLKKVTEQYPDDVEAWIELAQILEQTDIQNALSAYGTATRILQEKVQADVPPEILNNVGALHFRLGNLGEAKKYFLASLDR---AKAE-------AEHDEHYYNAISVTTTYNLARLYEGLCEFHESEKLYKNILREHPNYVDCYLRLGAMARDKGNFYEASDWFKEALQINQDHPDAWSLIGNLHLAKQEWGPGQKKFERILKQPSTQNDTYSMLALGNVWLQTLHQPTRDREKEKRHQDRALAIYKQVLRNDSKNLYAANGIGAVLAHKGYVREARDVFAQVREATADISDVWLNLAHIYVEQKQYISAVQMYENCLRKFYKHQNTEVLLYLARALFKCGKLQECKQILLKARHVAPNDTVLMFNVALVLQRLATLVLKDEKSNLKAVLNAVKELELAHRYFNYLSKVGDKMRFDLALAASEARQCSDLLSQAQYHVARARKQDEEEKELRAKQEQEKE 829          
BLAST of RNA polymerase-associated protein CTR9 homolog vs. Ensembl Xenopus
Match: ctr9 (CTR9 homolog, Paf1/RNA polymerase II complex component [Source:NCBI gene;Acc:448648])

HSP 1 Score: 937.562 bits (2422), Expect = 0.000e+0
Identity = 474/821 (57.73%), Postives = 611/821 (74.42%), Query Frame = 3
Query:  132 PMHVWILVALEYYRSKKYNDFVKVLNEANIHASVTYADSEKDQVKVLDMLANYYVKQASXXXXXXXXXXLFGQAAVHFTTADRIAMFDHNHLLSRAFFFLFEGDNWSQVDNQLNFVLNSSPNNVPALLGKSCIAFNKKEYRSALSFYRKALRNHPKCPASVRLGMGHCFFRLGNLEKAKFAFERALALDPECXXXXXXXXXXELNEKTLESVHHGVQKLSKAYMKDSNNPMVLNHLADHFFYAQQYKKVHTLALHAFHYTENELMRAQSCYQIARGFHKEENYDEAFQYYYQATQFASNNFVMPFYGLGQMYLCRKDIENAISSFEKVLKVYPNNYETLKILGSLYAQSDKEDRREQAKKMFQNVTEIEPDDLEAWIEYAQLL-KDDTASSLEAYTKAINLLRQE-NLDIPPEILNNVGVLHHMRKNYDETRKYYSEALERIEEVKTELSNNQDIKQDDVNYYIGLSVTINYNQGRLFEAEYQTDEADLLYKKILTQFPEYLDCHLRLGCMSRDRGQIYDASDWFKDALKVNQDHPDSWSLMGMLHLSKSEAGPAQKKFEFIVRQ--NPNDIFANVALGNIWLNTLFHPSRDKEKEKRHQERALTHYRNVLRVDPKNILAAHGIGAVLAHKGYINEARDVFAQVREATADFPDVWINIAHIYVEQKQYLAAIQMYENCIKKFNKQTNTELLLYLARAHFKCDQLKKCKQVLLKARHIAPWDPLIAYNLAFVQKRWALSVVPDEKSNFSSVLEGINDLNMAQCTFKYLSILKDQI--NIPQLPNEIKDCQDLLSQARYYLDRATKREQQERYMRQKQVEERE 2576
            P      + LEYY+  K  DFVK+L  A I  ++ Y D EKDQ+  LD LA YYV+QA KEK K+ K+EL  QA + +T AD+I M+D NHLL RA F L EGD   Q D Q +FVLN SPNN+PALLGK+CI+FNKK+YR AL++Y+KALR +P CPA VRLGMGHCF +L  L+KA+ AF RAL L+P CVGALVGLAVLELN K  +S+ +GVQ LSKAY  D +NPMVLNHLA+HFF+ + Y KV  LALHAFH TE E M+A+SCYQ+AR FH +E+YD+AFQYYYQATQFA+ +FV+PF+GLGQMY+ R D ENA   FEKVLK YPNNYET+KILGSLYA SD +++R+ AK   + VTE  PDD+EAWIE AQ+L + D  ++L AY  A  +L+++   D+PPEILNNVG LH    N  E +KY+  +L+R    K E        + D +YY  +SVT  YN  RL+E   +  E++ LYK IL + P Y+DC+LRLG M+RD+G  Y+ASDWFK+AL++NQDHPD+WSL+G LHL+K E GP QKKFE I++Q    ND ++ +ALGN+WL TL  P+RD+EKEKRHQ+RAL  Y+ VLR D KN+ AA+GIGAVLAHKGY+ EARDVFAQVREATAD  DVW+N+AHIYVEQKQY++A+QMYENC++KF K  NTE+LLYLARA FKC +L++CKQ+LLKARH+AP D ++ +N+A V +R A  V+ DEKSN  +VL  + +L +A   F YLS + D++  ++    +E + C DLLSQA+Y++ RA K++++E+ +R KQ +E+E
Sbjct:   19 PCAPCCPLQLEYYKQVKTEDFVKLLEAARIDGNLDYRDHEKDQMTCLDTLAAYYVQQARKEKNKDNKKELITQATLLYTMADKIIMYDQNHLLGRACFCLLEGDKMDQADAQFHFVLNQSPNNIPALLGKACISFNKKDYRGALAYYKKALRTNPGCPAGVRLGMGHCFVKLNKLDKARLAFGRALDLNPTCVGALVGLAVLELNNKEADSIKNGVQLLSKAYTIDPSNPMVLNHLANHFFFKKDYSKVQHLALHAFHNTEVEAMQAESCYQLARSFHVQEDYDQAFQYYYQATQFAAASFVLPFFGLGQMYIYRGDKENASQCFEKVLKAYPNNYETMKILGSLYAASDDQEKRDIAKSHLKKVTEQYPDDVEAWIELAQILEQTDIQNALSAYGTATRILQEKVQADVPPEILNNVGALHFRLGNLGEAKKYFLASLDR---AKAE-------AEHDEHYYNAISVTTTYNLARLYEGLCEFHESEKLYKNILREHPNYVDCYLRLGAMARDKGNFYEASDWFKEALQINQDHPDAWSLIGNLHLAKQEWGPGQKKFERILKQPSTQNDTYSMLALGNVWLQTLHQPTRDREKEKRHQDRALAIYKQVLRNDSKNLYAANGIGAVLAHKGYVREARDVFAQVREATADISDVWLNLAHIYVEQKQYISAVQMYENCLRKFYKHQNTEVLLYLARALFKCGKLQECKQILLKARHVAPNDTVLMFNVALVLQRLATLVLKDEKSNLKAVLNAVKELELAHRYFNYLSKVGDKMRFDLALAASEARQCSDLLSQAQYHVARARKQDEEEKELRAKQEQEKE 829          
BLAST of RNA polymerase-associated protein CTR9 homolog vs. Ensembl Xenopus
Match: ctr9 (CTR9 homolog, Paf1/RNA polymerase II complex component [Source:NCBI gene;Acc:448648])

HSP 1 Score: 937.562 bits (2422), Expect = 0.000e+0
Identity = 474/822 (57.66%), Postives = 611/822 (74.33%), Query Frame = 3
Query:  129 APMHVWILVALEYYRSKKYNDFVKVLNEANIHASVTYADSEKDQVKVLDMLANYYVKQASXXXXXXXXXXLFGQAAVHFTTADRIAMFDHNHLLSRAFFFLFEGDNWSQVDNQLNFVLNSSPNNVPALLGKSCIAFNKKEYRSALSFYRKALRNHPKCPASVRLGMGHCFFRLGNLEKAKFAFERALALDPECXXXXXXXXXXELNEKTLESVHHGVQKLSKAYMKDSNNPMVLNHLADHFFYAQQYKKVHTLALHAFHYTENELMRAQSCYQIARGFHKEENYDEAFQYYYQATQFASNNFVMPFYGLGQMYLCRKDIENAISSFEKVLKVYPNNYETLKILGSLYAQSDKEDRREQAKKMFQNVTEIEPDDLEAWIEYAQLL-KDDTASSLEAYTKAINLLRQE-NLDIPPEILNNVGVLHHMRKNYDETRKYYSEALERIEEVKTELSNNQDIKQDDVNYYIGLSVTINYNQGRLFEAEYQTDEADLLYKKILTQFPEYLDCHLRLGCMSRDRGQIYDASDWFKDALKVNQDHPDSWSLMGMLHLSKSEAGPAQKKFEFIVRQ--NPNDIFANVALGNIWLNTLFHPSRDKEKEKRHQERALTHYRNVLRVDPKNILAAHGIGAVLAHKGYINEARDVFAQVREATADFPDVWINIAHIYVEQKQYLAAIQMYENCIKKFNKQTNTELLLYLARAHFKCDQLKKCKQVLLKARHIAPWDPLIAYNLAFVQKRWALSVVPDEKSNFSSVLEGINDLNMAQCTFKYLSILKDQI--NIPQLPNEIKDCQDLLSQARYYLDRATKREQQERYMRQKQVEERE 2576
             P      + LEYY+  K  DFVK+L  A I  ++ Y D EKDQ+  LD LA YYV+QA KEK K+ K+EL  QA + +T AD+I M+D NHLL RA F L EGD   Q D Q +FVLN SPNN+PALLGK+CI+FNKK+YR AL++Y+KALR +P CPA VRLGMGHCF +L  L+KA+ AF RAL L+P CVGALVGLAVLELN K  +S+ +GVQ LSKAY  D +NPMVLNHLA+HFF+ + Y KV  LALHAFH TE E M+A+SCYQ+AR FH +E+YD+AFQYYYQATQFA+ +FV+PF+GLGQMY+ R D ENA   FEKVLK YPNNYET+KILGSLYA SD +++R+ AK   + VTE  PDD+EAWIE AQ+L + D  ++L AY  A  +L+++   D+PPEILNNVG LH    N  E +KY+  +L+R    K E        + D +YY  +SVT  YN  RL+E   +  E++ LYK IL + P Y+DC+LRLG M+RD+G  Y+ASDWFK+AL++NQDHPD+WSL+G LHL+K E GP QKKFE I++Q    ND ++ +ALGN+WL TL  P+RD+EKEKRHQ+RAL  Y+ VLR D KN+ AA+GIGAVLAHKGY+ EARDVFAQVREATAD  DVW+N+AHIYVEQKQY++A+QMYENC++KF K  NTE+LLYLARA FKC +L++CKQ+LLKARH+AP D ++ +N+A V +R A  V+ DEKSN  +VL  + +L +A   F YLS + D++  ++    +E + C DLLSQA+Y++ RA K++++E+ +R KQ +E+E
Sbjct:   18 CPCAPCCPLQLEYYKQVKTEDFVKLLEAARIDGNLDYRDHEKDQMTCLDTLAAYYVQQARKEKNKDNKKELITQATLLYTMADKIIMYDQNHLLGRACFCLLEGDKMDQADAQFHFVLNQSPNNIPALLGKACISFNKKDYRGALAYYKKALRTNPGCPAGVRLGMGHCFVKLNKLDKARLAFGRALDLNPTCVGALVGLAVLELNNKEADSIKNGVQLLSKAYTIDPSNPMVLNHLANHFFFKKDYSKVQHLALHAFHNTEVEAMQAESCYQLARSFHVQEDYDQAFQYYYQATQFAAASFVLPFFGLGQMYIYRGDKENASQCFEKVLKAYPNNYETMKILGSLYAASDDQEKRDIAKSHLKKVTEQYPDDVEAWIELAQILEQTDIQNALSAYGTATRILQEKVQADVPPEILNNVGALHFRLGNLGEAKKYFLASLDR---AKAE-------AEHDEHYYNAISVTTTYNLARLYEGLCEFHESEKLYKNILREHPNYVDCYLRLGAMARDKGNFYEASDWFKEALQINQDHPDAWSLIGNLHLAKQEWGPGQKKFERILKQPSTQNDTYSMLALGNVWLQTLHQPTRDREKEKRHQDRALAIYKQVLRNDSKNLYAANGIGAVLAHKGYVREARDVFAQVREATADISDVWLNLAHIYVEQKQYISAVQMYENCLRKFYKHQNTEVLLYLARALFKCGKLQECKQILLKARHVAPNDTVLMFNVALVLQRLATLVLKDEKSNLKAVLNAVKELELAHRYFNYLSKVGDKMRFDLALAASEARQCSDLLSQAQYHVARARKQDEEEKELRAKQEQEKE 829          
BLAST of RNA polymerase-associated protein CTR9 homolog vs. Ensembl Mouse
Match: Ctr9 (CTR9 homolog, Paf1/RNA polymerase II complex component [Source:MGI Symbol;Acc:MGI:109345])

HSP 1 Score: 1002.66 bits (2591), Expect = 0.000e+0
Identity = 501/856 (58.53%), Postives = 645/856 (75.35%), Query Frame = 3
Query:   27 TIEIPLRDTDEVIELDTDAFPDVDEVLNILKQEVAPMHVWILVALEYYRSKKYNDFVKVLNEANIHASVTYADSEKDQVKVLDMLANYYVKQASXXXXXXXXXXLFGQAAVHFTTADRIAMFDHNHLLSRAFFFLFEGDNWSQVDNQLNFVLNSSPNNVPALLGKSCIAFNKKEYRSALSFYRKALRNHPKCPASVRLGMGHCFFRLGNLEKAKFAFERALALDPECXXXXXXXXXXELNEKTLESVHHGVQKLSKAYMKDSNNPMVLNHLADHFFYAQQYKKVHTLALHAFHYTENELMRAQSCYQIARGFHKEENYDEAFQYYYQATQFASNNFVMPFYGLGQMYLCRKDIENAISSFEKVLKVYPNNYETLKILGSLYAQSDKEDRREQAKKMFQNVTEIEPDDLEAWIEYAQLL-KDDTASSLEAYTKAINLLRQE-NLDIPPEILNNVGVLHHMRKNYDETRKYYSEALERIEEVKTELSNNQDIKQDDVNYYIGLSVTINYNQGRLFEAEYQTDEADLLYKKILTQFPEYLDCHLRLGCMSRDRGQIYDASDWFKDALKVNQDHPDSWSLMGMLHLSKSEAGPAQKKFEFIVRQ--NPNDIFANVALGNIWLNTLFHPSRDKEKEKRHQERALTHYRNVLRVDPKNILAAHGIGAVLAHKGYINEARDVFAQVREATADFPDVWINIAHIYVEQKQYLAAIQMYENCIKKFNKQTNTELLLYLARAHFKCDQLKKCKQVLLKARHIAPWDPLIAYNLAFVQKRWALSVVPDEKSNFSSVLEGINDLNMAQCTFKYLSILKDQI--NIPQLPNEIKDCQDLLSQARYYLDRATKREQQERYMRQKQVEERE 2576
            +IEIPLRDTDEVIELD D  P+ DEV++ILKQE   +H+WI +ALEYY+  K  +FVK+L  A I  ++ Y D EKDQ+  LD LA YYV+QA KEK K+ K++L  QA + +T AD+I M+D NHLL RA F L EGD   Q D Q +FVLN SPNN+PALLGK+CI+FNKK+YR AL++Y+KALR +P CPA VRLGMGHCF +L  LEKA+ AF RAL L+ +CVGALVGLAVLELN K  +S+ +GVQ LS+AY  D +NPMVLNHLA+HFF+ + Y KV  LALHAFH TE E M+A+SCYQ+AR FH +E+YD+AFQYYYQATQFAS++FV+PF+GLGQMY+ R D ENA   FEKVLK YPNNYET+KILGSLYA S+ +++R+ AK   + VTE  PDD+EAWIE AQ+L + D   +L AY  A  +L+++   D+PPEILNNVG LH    N  E +KY+  +L+R    K E  +       D +YY  +SVT +YN  RL+EA  +  EA+ LYK IL + P Y+DC+LRLG M+RD+G  Y+ASDWFK+AL++NQDHPD+WSL+G LHL+K E GP QKKFE I++Q    +D ++ +ALGN+WL TL  P+RD+EKEKRHQ+RAL  Y+ VLR D KN+ AA+GIGAVLAHKGY  EARDVFAQVREATAD  DVW+N+AHIYVEQKQY++A+QMYENC++KF K  NTE++LYLARA FKC +L++CKQ LLKARH+AP D ++ +N+A V +R A SV+ DEKSN   VL  + +L +A   F YLS + D++  ++    +E + C DLLSQA+Y++ RA K++++ER +R KQ +E+E
Sbjct:    5 SIEIPLRDTDEVIELDFDQLPEGDEVISILKQEHTQLHIWIALALEYYKQGKTEEFVKLLEAARIDGNLDYRDHEKDQMTCLDTLAAYYVQQARKEKNKDNKKDLITQATLLYTMADKIIMYDQNHLLGRACFCLLEGDKMDQADAQFHFVLNQSPNNIPALLGKACISFNKKDYRGALAYYKKALRTNPGCPAEVRLGMGHCFVKLNKLEKARLAFSRALELNSKCVGALVGLAVLELNNKEADSIKNGVQLLSRAYTIDPSNPMVLNHLANHFFFKKDYSKVQHLALHAFHNTEVEAMQAESCYQLARSFHVQEDYDQAFQYYYQATQFASSSFVLPFFGLGQMYIYRGDKENASQCFEKVLKAYPNNYETMKILGSLYAASEDQEKRDIAKGHLKKVTEQYPDDVEAWIELAQILEQTDIQGALSAYGTATRILQEKVQADVPPEILNNVGALHFRLGNLGEAKKYFLASLDR---AKAEAEH-------DEHYYNAISVTTSYNLARLYEAMCEFHEAEKLYKNILREHPNYVDCYLRLGAMARDKGNFYEASDWFKEALQINQDHPDAWSLIGNLHLAKQEWGPGQKKFERILKQPATQSDTYSMLALGNVWLQTLHQPTRDREKEKRHQDRALAIYKQVLRNDAKNLYAANGIGAVLAHKGYFREARDVFAQVREATADISDVWLNLAHIYVEQKQYISAVQMYENCLRKFYKHQNTEVVLYLARALFKCGKLQECKQTLLKARHVAPSDTVLMFNVALVLQRLATSVLKDEKSNLKEVLNAVKELELAHRYFSYLSKVGDKMRFDLALAASEARQCSDLLSQAQYHVARARKQDEEERELRAKQEQEKE 850          
BLAST of RNA polymerase-associated protein CTR9 homolog vs. Ensembl Mouse
Match: Ogt (O-linked N-acetylglucosamine (GlcNAc) transferase (UDP-N-acetylglucosamine:polypeptide-N-acetylglucosaminyl transferase) [Source:MGI Symbol;Acc:MGI:1339639])

HSP 1 Score: 59.6918 bits (143), Expect = 2.396e-8
Identity = 81/397 (20.40%), Postives = 156/397 (39.29%), Query Frame = 3
Query:  984 EAFQYYYQATQFASNNFVMPFYGLGQMYLCRKDIENAISSFEKVLKVYPNNYETLKILGSLYAQSDKEDRREQAKKMFQNVTEIEPDDLEAWIEYAQLL--KDDTASSLEAYTKAINLLRQENLDIPPEILN---NVGVLHHMRKNYDETRKYYSEALERIEEVKTELSNNQDIKQDDVNYYIGLSVTINYNQGRLFEAEYQTDEADLLYKKILTQFPEYLDCHLRLGCMSRDRGQIYDASDWFKDALKVNQDHPDSWSLMGMLHLSKSEAGPAQKKFEFIVRQNPNDIFANVALGNIWLNTLFHPSRDKEKEKRHQERALTHYRNVLRVDPKNILAAHGIGAVLAHKGYINEARDVFAQVREATADFPDVWINIAHIYVEQKQYLAAIQMYENCIK 2159
            EA ++Y  A +   + F+  +  L    +   D+E A+ ++   L+  P+ Y     LG+L        R E+AK  +    E +P+   AW     +   + +   ++  + KA+ L         P  L+   N+G +    + +D     Y  AL         LS N  +   ++         + Y QG +       D A   Y++ +   P + D +  L    +++G + +A D +  AL++   H DS + +  +   K E G  ++       +   ++F   A  +  L ++       +++ + QE AL HY+  +R+ P    A   +G  L     +  A   + +  +    F D   N+A I+ +      AI  Y   +K
Sbjct:  107 EAIEHYRHALRLKPD-FIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLL---KALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTL--------DPNFLDAYINLGNVLKEARIFDRAVAAYLRAL--------SLSPNHAVVHGNL-------ACVYYEQGLI-------DLAIDTYRRAIELQPHFPDAYCNLANALKEKGSVAEAEDCYNTALRLCPTHADSLNNLANI---KREQGNIEEAVRLY--RKALEVFPEFAAAHSNLASVL------QQQGKLQE-ALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALK 457          

HSP 2 Score: 59.6918 bits (143), Expect = 2.814e-8
Identity = 87/394 (22.08%), Postives = 154/394 (39.09%), Query Frame = 3
Query: 1362 EILNNVGVLHHMRKNYDETRKYYSEALERIEEVKTELSNNQDIKQDDVNYYIGLSVTINYNQGRLFEAEYQTDEADLLYKKILTQFPEYLDCHLRLGCMSRDRGQIYDASDWFKDALKVNQDHPDSWSLMGMLHLSKSEAGPAQKKFEFIVRQNPNDIFANVALGNIWLNTLFHPSRDKEKEKRHQERALTHYRNVLRVDPKNILAAHGIGAVLAHKGYINEARDVFAQVREATADFPDVWINIAHIYVEQKQYLAAIQMYENCIKKFNKQTNTELLLYLARAHFKCDQLKKCKQVLLKARHIAPWDPLIAYNLAFVQK------------RWALSVVP---DEKSNFSSVLEGINDLNMA-QCTFKYL--------------SILKDQINIPQ 2453
            E  +N+G ++  R    E  ++Y  AL               +K D ++ YI L+  +         A    + A   Y   L   P+       LG + +  G++ +A   +  A++   +   +WS +G +  ++ E   A   FE  V  +PN + A + LGN+             KE R  +RA+  Y   L + P + +    +  V   +G I+ A D + +  E    FPD + N+A+   E+     A   Y   ++     T+ + L  LA    +   +++  ++  KA  + P       NLA V +            + A+ + P   D  SN  + L+ + D+  A QC  + +              SI KD  NIP+
Sbjct:   90 EAYSNLGNVYKERGQLQEAIEHYRHALR--------------LKPDFIDGYINLAAAL--------VAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVL------------KEARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANALKEKGSVAEAEDCYNTALRLC--PTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPE 447          

HSP 3 Score: 58.5362 bits (140), Expect = 5.405e-8
Identity = 84/378 (22.22%), Postives = 149/378 (39.42%), Query Frame = 3
Query:  981 DEAFQYYYQATQFASNNFVMPFYGLGQMYLCRKDIENAISSFEKVLKVYPNNYETLKILGSLYAQSDKEDRREQAKKMFQNVTEIEPDDLE-----AWIEYAQLLKDDTASSLEAYTKAINLLRQENLDIPPEILNNVGVLHHMRKNYDETRKYYSEALERIEEVKTELSNNQDIKQDDVNYYIGLSVTINYNQGRLFEAEYQTDEADLLYKKILTQFPEYLDCHLRLGCMSRDRGQIYDASDWFKDALKVNQDHPDSWSLMGMLHLSKSEAGPAQKKFEFIVRQNPNDIFANVALGNIWLNTLFHPSRDKEKEKRHQERALTHYRNVLRVDPKNILAAHGIGAVLAHKGYINEARDVFAQVREATADFPDVWINIAH 2099
            +EA   Y +A +    NF + +  LG ++  + +I  AI  FEK + + PN  +    LG++  ++   DR   A   +     + P+        A + Y Q L D    +++ Y +AI L  Q +    P+   N+      + +  E    Y+ AL         L+N  +IK++               QG +       +EA  LY+K L  FPE+   H  L  + + +G++ +A   +K+A++++    D++S MG                                      NTL        KE +  + AL  Y   ++++P    A   + ++    G I EA   +    +   DFPD + N+AH
Sbjct:  174 EEAKACYLKAIE-TQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDR---AVAAYLRALSLSPNHAVVHGNLACVYYEQGLID---LAIDTYRRAIEL--QPHF---PDAYCNLANALKEKGSVAEAEDCYNTALRLCPTHADSLNNLANIKRE---------------QGNI-------EEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMG--------------------------------------NTL--------KEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAH 471          

HSP 4 Score: 56.9954 bits (136), Expect = 1.878e-7
Identity = 88/431 (20.42%), Postives = 169/431 (39.21%), Query Frame = 3
Query:  492 PNNVPALLGKSCIAFNKKEYRSALSFYRKALRNHPKCPASVRLGMGHCFFRLGNLEKAKFAFERALALDPECXXXXXXXXXXELNEKTLESVHHGVQKLSKAYMKDSNNPMVLNHLADHFFYAQQYKKVHTLALHAFHYTENELMRAQSCYQIARGFHKEENYDEAFQYYYQATQFASNNFVMPFYGLGQMYLCRKDIENAISSFEKVLKVYPNNYETLKILGSLYAQSDKEDRREQAKKMFQNVTEIEPDDLEAWIEYAQLLKD--DTASSLEAYTKAINLLRQENLDIPPEILNNVGVLHHMRKNYDETRKYYSEALERIEEVKTELSNNQDIKQDD-------VNYYIGLSVTINY-----NQGRLFEAEYQTDEADLLYKKILTQFPEYLDCHLRLGCMSRDRGQIYDASDWFKDALKVNQDHPDSW 1742
            P+N   LL  S I F  +    +  F   A++ +P   A     +G+ +   G L++A   +  AL L P+ +   + LA   +    +E     VQ    A   + +   V + L +      + ++     L A     N    A +   +   F+ +     A  ++ +A      NF+  +  LG +    +  + A++++ + L + PN+      L  +Y +    D    A   ++   E++P   +A+   A  LK+    A + + Y  A+ L          + LNN+  +   + N +E  + Y +ALE   E     SN   + Q         ++Y   + ++  +     N G   +       A   Y + +   P + D H  L  + +D G I +A   ++ ALK+  D PD++
Sbjct:   52 PDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPLL-AEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDMEG---AVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPN---FAVAWSNLGCVFNAQGEIWLAIHHFEKAVTL-DPNFLDAYINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDL---AIDTYRRAIELQPHFPDAYCNLANALKEKGSVAEAEDCYNTALRLCPTH-----ADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAY 466          
BLAST of RNA polymerase-associated protein CTR9 homolog vs. Ensembl Mouse
Match: Ogt (O-linked N-acetylglucosamine (GlcNAc) transferase (UDP-N-acetylglucosamine:polypeptide-N-acetylglucosaminyl transferase) [Source:MGI Symbol;Acc:MGI:1339639])

HSP 1 Score: 59.6918 bits (143), Expect = 2.492e-8
Identity = 81/397 (20.40%), Postives = 156/397 (39.29%), Query Frame = 3
Query:  984 EAFQYYYQATQFASNNFVMPFYGLGQMYLCRKDIENAISSFEKVLKVYPNNYETLKILGSLYAQSDKEDRREQAKKMFQNVTEIEPDDLEAWIEYAQLL--KDDTASSLEAYTKAINLLRQENLDIPPEILN---NVGVLHHMRKNYDETRKYYSEALERIEEVKTELSNNQDIKQDDVNYYIGLSVTINYNQGRLFEAEYQTDEADLLYKKILTQFPEYLDCHLRLGCMSRDRGQIYDASDWFKDALKVNQDHPDSWSLMGMLHLSKSEAGPAQKKFEFIVRQNPNDIFANVALGNIWLNTLFHPSRDKEKEKRHQERALTHYRNVLRVDPKNILAAHGIGAVLAHKGYINEARDVFAQVREATADFPDVWINIAHIYVEQKQYLAAIQMYENCIK 2159
            EA ++Y  A +   + F+  +  L    +   D+E A+ ++   L+  P+ Y     LG+L        R E+AK  +    E +P+   AW     +   + +   ++  + KA+ L         P  L+   N+G +    + +D     Y  AL         LS N  +   ++         + Y QG +       D A   Y++ +   P + D +  L    +++G + +A D +  AL++   H DS + +  +   K E G  ++       +   ++F   A  +  L ++       +++ + QE AL HY+  +R+ P    A   +G  L     +  A   + +  +    F D   N+A I+ +      AI  Y   +K
Sbjct:   97 EAIEHYRHALRLKPD-FIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLL---KALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTL--------DPNFLDAYINLGNVLKEARIFDRAVAAYLRAL--------SLSPNHAVVHGNL-------ACVYYEQGLI-------DLAIDTYRRAIELQPHFPDAYCNLANALKEKGSVAEAEDCYNTALRLCPTHADSLNNLANI---KREQGNIEEAVRLY--RKALEVFPEFAAAHSNLASVL------QQQGKLQE-ALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALK 447          

HSP 2 Score: 59.6918 bits (143), Expect = 2.978e-8
Identity = 87/394 (22.08%), Postives = 154/394 (39.09%), Query Frame = 3
Query: 1362 EILNNVGVLHHMRKNYDETRKYYSEALERIEEVKTELSNNQDIKQDDVNYYIGLSVTINYNQGRLFEAEYQTDEADLLYKKILTQFPEYLDCHLRLGCMSRDRGQIYDASDWFKDALKVNQDHPDSWSLMGMLHLSKSEAGPAQKKFEFIVRQNPNDIFANVALGNIWLNTLFHPSRDKEKEKRHQERALTHYRNVLRVDPKNILAAHGIGAVLAHKGYINEARDVFAQVREATADFPDVWINIAHIYVEQKQYLAAIQMYENCIKKFNKQTNTELLLYLARAHFKCDQLKKCKQVLLKARHIAPWDPLIAYNLAFVQK------------RWALSVVP---DEKSNFSSVLEGINDLNMA-QCTFKYL--------------SILKDQINIPQ 2453
            E  +N+G ++  R    E  ++Y  AL               +K D ++ YI L+  +         A    + A   Y   L   P+       LG + +  G++ +A   +  A++   +   +WS +G +  ++ E   A   FE  V  +PN + A + LGN+             KE R  +RA+  Y   L + P + +    +  V   +G I+ A D + +  E    FPD + N+A+   E+     A   Y   ++     T+ + L  LA    +   +++  ++  KA  + P       NLA V +            + A+ + P   D  SN  + L+ + D+  A QC  + +              SI KD  NIP+
Sbjct:   80 EAYSNLGNVYKERGQLQEAIEHYRHALR--------------LKPDFIDGYINLAAAL--------VAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVL------------KEARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANALKEKGSVAEAEDCYNTALRLC--PTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPE 437          

HSP 3 Score: 58.5362 bits (140), Expect = 5.623e-8
Identity = 84/378 (22.22%), Postives = 149/378 (39.42%), Query Frame = 3
Query:  981 DEAFQYYYQATQFASNNFVMPFYGLGQMYLCRKDIENAISSFEKVLKVYPNNYETLKILGSLYAQSDKEDRREQAKKMFQNVTEIEPDDLE-----AWIEYAQLLKDDTASSLEAYTKAINLLRQENLDIPPEILNNVGVLHHMRKNYDETRKYYSEALERIEEVKTELSNNQDIKQDDVNYYIGLSVTINYNQGRLFEAEYQTDEADLLYKKILTQFPEYLDCHLRLGCMSRDRGQIYDASDWFKDALKVNQDHPDSWSLMGMLHLSKSEAGPAQKKFEFIVRQNPNDIFANVALGNIWLNTLFHPSRDKEKEKRHQERALTHYRNVLRVDPKNILAAHGIGAVLAHKGYINEARDVFAQVREATADFPDVWINIAH 2099
            +EA   Y +A +    NF + +  LG ++  + +I  AI  FEK + + PN  +    LG++  ++   DR   A   +     + P+        A + Y Q L D    +++ Y +AI L  Q +    P+   N+      + +  E    Y+ AL         L+N  +IK++               QG +       +EA  LY+K L  FPE+   H  L  + + +G++ +A   +K+A++++    D++S MG                                      NTL        KE +  + AL  Y   ++++P    A   + ++    G I EA   +    +   DFPD + N+AH
Sbjct:  164 EEAKACYLKAIE-TQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDR---AVAAYLRALSLSPNHAVVHGNLACVYYEQGLID---LAIDTYRRAIEL--QPHF---PDAYCNLANALKEKGSVAEAEDCYNTALRLCPTHADSLNNLANIKRE---------------QGNI-------EEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMG--------------------------------------NTL--------KEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAH 461          

HSP 4 Score: 56.6102 bits (135), Expect = 2.022e-7
Identity = 88/431 (20.42%), Postives = 169/431 (39.21%), Query Frame = 3
Query:  492 PNNVPALLGKSCIAFNKKEYRSALSFYRKALRNHPKCPASVRLGMGHCFFRLGNLEKAKFAFERALALDPECXXXXXXXXXXELNEKTLESVHHGVQKLSKAYMKDSNNPMVLNHLADHFFYAQQYKKVHTLALHAFHYTENELMRAQSCYQIARGFHKEENYDEAFQYYYQATQFASNNFVMPFYGLGQMYLCRKDIENAISSFEKVLKVYPNNYETLKILGSLYAQSDKEDRREQAKKMFQNVTEIEPDDLEAWIEYAQLLKD--DTASSLEAYTKAINLLRQENLDIPPEILNNVGVLHHMRKNYDETRKYYSEALERIEEVKTELSNNQDIKQDD-------VNYYIGLSVTINY-----NQGRLFEAEYQTDEADLLYKKILTQFPEYLDCHLRLGCMSRDRGQIYDASDWFKDALKVNQDHPDSW 1742
            P+N   LL  S I F  +    +  F   A++ +P   A     +G+ +   G L++A   +  AL L P+ +   + LA   +    +E     VQ    A   + +   V + L +      + ++     L A     N    A +   +   F+ +     A  ++ +A      NF+  +  LG +    +  + A++++ + L + PN+      L  +Y +    D    A   ++   E++P   +A+   A  LK+    A + + Y  A+ L          + LNN+  +   + N +E  + Y +ALE   E     SN   + Q         ++Y   + ++  +     N G   +       A   Y + +   P + D H  L  + +D G I +A   ++ ALK+  D PD++
Sbjct:   42 PDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPLL-AEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDMEG---AVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPN---FAVAWSNLGCVFNAQGEIWLAIHHFEKAVTL-DPNFLDAYINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDL---AIDTYRRAIELQPHFPDAYCNLANALKEKGSVAEAEDCYNTALRLCPTH-----ADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAY 456          
BLAST of RNA polymerase-associated protein CTR9 homolog vs. Ensembl Mouse
Match: Tmtc3 (transmembrane and tetratricopeptide repeat containing 3 [Source:MGI Symbol;Acc:MGI:3036255])

HSP 1 Score: 58.5362 bits (140), Expect = 5.017e-8
Identity = 86/394 (21.83%), Postives = 165/394 (41.88%), Query Frame = 3
Query:  765 VHHGVQKLS-KAYMKDSN----NPMVLNHLADHFFYAQQYKKVHTLALHAFHYTENELMRAQSCYQIARGFHKEENYDEAFQYYYQATQFASNNFVMPFYGLGQMY--------------LCRKDIENAISSFEKVLKVYPNNYETLKILGSLYAQSDKEDRREQAKKMFQNVTEIEPDDLEAWIEYAQLL--KDDTASSLEAYTKAINLLRQENLDIPPEILNNVGVLHHMRKNYDETRKYYSEALERIEEVKTELSNNQDIKQDD-------------VNYYIGLSVTIN--YNQGRLFEAEYQTDEADLLYKKILTQFPEYLDCHLRLGCMSRDRGQIYDASDWFKDALKVNQDHPDSWSLMGMLHLSKSEAGPAQKK-FEFIVRQNPNDI 1835
            V HG QK+S K+ +K  +    + ++L H          ++  +TL + A    +N    A+    +      E+N+++A +Y+ QAT    ++ +     +G+ Y              L +  +   I   +   ++ PN+      L +L   +  E R E+A ++++    + PD  +A+I   +LL   +    + EAY KA+ L R  N D+      N+ +++   K  +E  K ++ ALE   + K  L N+  + Q+              +NY        N  +N G L   + +  EA+   KK +   P++      L  +     +   A    ++ LK   DH     L G + +++ +  P  KK FE I+  +P+++
Sbjct:  394 VAHGWQKISNKSVLKKLSWVCLSMVILTHALKTLHRNWDWESEYTLFMSALKVNKN---NAKLWNNVGHALENEKNFEKALKYFLQATHVQPDD-IGAHMNVGRTYKNLNRTREAEASYMLAKSLMPQIIPGKKYAARIAPNHLNVYINLANLIRAN--ESRLEEADQLYRQAISMRPDFKQAYISRGELLLKMNKPLKAKEAYLKALELDRN-NADL----WYNLAIVYIELKEPNEALKNFNRALELNPKHKLALFNSAILMQESGEVKLRPEARKRLLNYVNEEPQDANGYFNLGMLAMDDKKDSEAESWMKKAIKLQPDFRSALFNLALLYSQTAKELKALPILEELLKYYPDHTKGLILKGDILMNQKKDIPGAKKCFEKILEMDPSNV 776          

HSP 2 Score: 52.373 bits (124), Expect = 4.660e-6
Identity = 77/373 (20.64%), Postives = 151/373 (40.48%), Query Frame = 3
Query: 1080 DIENAISSFEKVLKVYPNNYETLKILGSLYAQSDKEDRREQAKKMFQNVTEIEPDDLEAWIEYAQLLKD--DTASSLEAYTKAINLLRQENLDIPPEILNNVGVLHHMRKNYDETRKYYSEALERIEEVKTELSNNQDIKQDDVNYYIGLSVTINYNQGRLFEAEYQTDEADLLYKKILTQFPEYLDCHLRLGCMSRDRGQIYDASDWFKDALKVNQDHPDSWSLMGMLHLSKSEAGPAQKKFEFIVRQNPNDIFANVALGNIWLNTLFHPSRDKEKEKRHQERALTHYRNVLRVDPKNILAAHGIGAVLAHKGYINEARDVFAQVREATADFPDVWINIAHIYVEQKQYLAAIQMYENCIKKFNKQTNTELL 2192
            D E+  + F   LKV  NN    K+  ++    + E   E+A K F   T ++PDD+ A +   +  K+   T  +  +Y  A +L+        P+I+                +KY +                  I  + +N YI L+  I  N+ RL       +EAD LY++ ++  P++   ++  G +     +   A + +  AL++++++ D W  + ++++   E   A K F   +  NP      +AL N   + +      + K +    + L +Y N    +P++      +G +       +EA     +  +   DF     N+A +Y +  + L A+ + E  +K +   T   +L
Sbjct:  432 DWESEYTLFMSALKVNKNNA---KLWNNVGHALENEKNFEKALKYFLQATHVQPDDIGAHMNVGRTYKNLNRTREAEASYMLAKSLM--------PQIIPG--------------KKYAAR-----------------IAPNHLNVYINLANLIRANESRL-------EEADQLYRQAISMRPDFKQAYISRGELLLKMNKPLKAKEAYLKALELDRNNADLWYNLAIVYIELKEPNEALKNFNRALELNPKH---KLALFN---SAILMQESGEVKLRPEARKRLLNYVN---EEPQDANGYFNLGMLAMDDKKDSEAESWMKKAIKLQPDFRSALFNLALLYSQTAKELKALPILEELLKYYPDHTKGLIL 746          
BLAST of RNA polymerase-associated protein CTR9 homolog vs. UniProt/SwissProt
Match: sp|Q4QR29|CTR9_XENLA (RNA polymerase-associated protein CTR9 homolog OS=Xenopus laevis OX=8355 GN=ctr9 PE=2 SV=1)

HSP 1 Score: 1005.36 bits (2598), Expect = 0.000e+0
Identity = 502/858 (58.51%), Postives = 647/858 (75.41%), Query Frame = 3
Query:   27 TIEIPLRDTDEVIELDTDAFPDVDEVLNILKQEVAPMHVWILVALEYYRSKKYNDFVKVLNEANIHASVTYADSEKDQVKVLDMLANYYVKQASXXXXXXXXXXLFGQAAVHFTTADRIAMFDHNHLLSRAFFFLFEGDNWSQVDNQLNFVLNSSPNNVPALLGKSCIAFNKKEYRSALSFYRKALRNHPKCPASVRLGMGHCFFRLGNLEKAKFAFERALALDPECXXXXXXXXXXELNEKTLESVHHGVQKLSKAYMKDSNNPMVLNHLADHFFYAQQYKKVHTLALHAFHYTENELMRAQSCYQIARGFHKEENYDEAFQYYYQATQFASNNFVMPFYGLGQMYLCRKDIENAISSFEKVLKVYPNNYETLKILGSLYAQSDKEDRREQAKKMFQNVTEIEPDDLEAWIEYAQLL-KDDTASSLEAYTKAINLLRQE-NLDIPPEILNNVGVLHHMRKNYDETRKYYSEALERIEEVKTELSNNQDIKQDDVNYYIGLSVTINYNQGRLFEAEYQTDEADLLYKKILTQFPEYLDCHLRLGCMSRDRGQIYDASDWFKDALKVNQDHPDSWSLMGMLHLSKSEAGPAQKKFEFIVRQ--NPNDIFANVALGNIWLNTLFHPSRDKEKEKRHQERALTHYRNVLRVDPKNILAAHGIGAVLAHKGYINEARDVFAQVREATADFPDVWINIAHIYVEQKQYLAAIQMYENCIKKFNKQTNTELLLYLARAHFKCDQLKKCKQVLLKARHIAPWDPLIAYNLAFVQKRWALSVVPDEKSNFSSVLEGINDLNMAQCTFKYLSILKDQI--NIPQLPNEIKDCQDLLSQARYYLDRATKREQQERYMRQKQVEERESI 2582
            +IEIPLRDTDEVIELD D  P+ DEV++ILKQE   +H+WI +ALEY++  K  DFVK+L  A I  ++ Y D EKDQ+  LD LA YYV+QA KEK K+ K+EL  QA + +T AD+I M+D NHLL RA F L EGD   Q D Q +FVLN SPNN+PALLGK+CI+FNKK+YR AL++Y+KALR +P CPA VRLGMGHCF +L  L+KA+ AF RAL L+P CVGALVGLAVLELN K  +S+ +GVQ LSKAY  D +NPMVLNHLA+HFF+ + Y KV  LALHAFH TE E M+A+SCYQ+AR FH +E+YD+AFQYYYQATQFA+ +FV+PF+GLGQMY+ R D ENA   FEKVLK YPNNYET+KILGSLYA SD +++R+ AK   + VTE  PDD+EAWIE AQ+L + D  ++L AY  A  +L+++   D+PPEILNNVG LH    N  E +KY+  +L+R    K E  +       D +YY  +SVT +YN  RL+E   +  E++ LYK IL + P Y+DC+LRLG M+RD+G  Y+ASDWFK+AL++NQDHPD+WSL+G LHL+K E GP QKKFE I++Q    ND ++ +ALGN+WL TL  P+RD+EKEKRHQ+RAL  Y+ VLR D KN+ AA+GIGAVLAHKGY+ EARDVFAQVREATAD  DVW+N+AHIYVEQKQY++A+QMYENC++KF K  NTE+LLYLARA FKC +L++CKQ+LLKARH+AP D ++ +N+A V +R A  V+ DEKSN  +VL  + +L +A   F YLS + D++  ++    +E + C DLLSQA+Y++ RA K++++E+ MR KQ +E+E +
Sbjct:    5 SIEIPLRDTDEVIELDFDQLPEGDEVISILKQEHTQLHIWIALALEYFKQGKTEDFVKLLEAARIDGNLDYRDHEKDQMTCLDTLAAYYVQQARKEKNKDNKKELITQATLLYTMADKIIMYDQNHLLGRACFCLLEGDKMDQADAQFHFVLNQSPNNIPALLGKACISFNKKDYRGALAYYKKALRTNPGCPAGVRLGMGHCFVKLNKLDKARLAFGRALDLNPTCVGALVGLAVLELNNKEADSIKNGVQLLSKAYTIDPSNPMVLNHLANHFFFKKDYSKVQHLALHAFHNTEVEAMQAESCYQLARSFHVQEDYDQAFQYYYQATQFAAASFVLPFFGLGQMYIYRGDKENASQCFEKVLKAYPNNYETMKILGSLYAASDDQEKRDIAKSHLKKVTEQYPDDVEAWIELAQILEQTDIQNALSAYGTATRILQEKVQADVPPEILNNVGALHFRLGNLGEAKKYFLASLDR---AKAEAEH-------DEHYYNSISVTTSYNLARLYEGLCEFHESEKLYKNILREHPNYVDCYLRLGAMARDKGNFYEASDWFKEALQINQDHPDAWSLIGNLHLAKQEWGPGQKKFERILKQPSTQNDTYSMLALGNVWLQTLHQPTRDREKEKRHQDRALAIYKQVLRNDSKNLFAANGIGAVLAHKGYVREARDVFAQVREATADISDVWLNLAHIYVEQKQYISAVQMYENCLRKFYKHQNTEVLLYLARALFKCGKLQECKQILLKARHVAPNDTVLMFNVALVLQRLATLVLKDEKSNLKAVLNAVKELELAHRYFNYLSKVGDKMRFDLALATSEARQCSDLLSQAQYHVARARKQDEEEKEMRTKQEQEKEVL 852          
BLAST of RNA polymerase-associated protein CTR9 homolog vs. UniProt/SwissProt
Match: sp|Q62018|CTR9_MOUSE (RNA polymerase-associated protein CTR9 homolog OS=Mus musculus OX=10090 GN=Ctr9 PE=1 SV=2)

HSP 1 Score: 1002.66 bits (2591), Expect = 0.000e+0
Identity = 501/856 (58.53%), Postives = 645/856 (75.35%), Query Frame = 3
Query:   27 TIEIPLRDTDEVIELDTDAFPDVDEVLNILKQEVAPMHVWILVALEYYRSKKYNDFVKVLNEANIHASVTYADSEKDQVKVLDMLANYYVKQASXXXXXXXXXXLFGQAAVHFTTADRIAMFDHNHLLSRAFFFLFEGDNWSQVDNQLNFVLNSSPNNVPALLGKSCIAFNKKEYRSALSFYRKALRNHPKCPASVRLGMGHCFFRLGNLEKAKFAFERALALDPECXXXXXXXXXXELNEKTLESVHHGVQKLSKAYMKDSNNPMVLNHLADHFFYAQQYKKVHTLALHAFHYTENELMRAQSCYQIARGFHKEENYDEAFQYYYQATQFASNNFVMPFYGLGQMYLCRKDIENAISSFEKVLKVYPNNYETLKILGSLYAQSDKEDRREQAKKMFQNVTEIEPDDLEAWIEYAQLL-KDDTASSLEAYTKAINLLRQE-NLDIPPEILNNVGVLHHMRKNYDETRKYYSEALERIEEVKTELSNNQDIKQDDVNYYIGLSVTINYNQGRLFEAEYQTDEADLLYKKILTQFPEYLDCHLRLGCMSRDRGQIYDASDWFKDALKVNQDHPDSWSLMGMLHLSKSEAGPAQKKFEFIVRQ--NPNDIFANVALGNIWLNTLFHPSRDKEKEKRHQERALTHYRNVLRVDPKNILAAHGIGAVLAHKGYINEARDVFAQVREATADFPDVWINIAHIYVEQKQYLAAIQMYENCIKKFNKQTNTELLLYLARAHFKCDQLKKCKQVLLKARHIAPWDPLIAYNLAFVQKRWALSVVPDEKSNFSSVLEGINDLNMAQCTFKYLSILKDQI--NIPQLPNEIKDCQDLLSQARYYLDRATKREQQERYMRQKQVEERE 2576
            +IEIPLRDTDEVIELD D  P+ DEV++ILKQE   +H+WI +ALEYY+  K  +FVK+L  A I  ++ Y D EKDQ+  LD LA YYV+QA KEK K+ K++L  QA + +T AD+I M+D NHLL RA F L EGD   Q D Q +FVLN SPNN+PALLGK+CI+FNKK+YR AL++Y+KALR +P CPA VRLGMGHCF +L  LEKA+ AF RAL L+ +CVGALVGLAVLELN K  +S+ +GVQ LS+AY  D +NPMVLNHLA+HFF+ + Y KV  LALHAFH TE E M+A+SCYQ+AR FH +E+YD+AFQYYYQATQFAS++FV+PF+GLGQMY+ R D ENA   FEKVLK YPNNYET+KILGSLYA S+ +++R+ AK   + VTE  PDD+EAWIE AQ+L + D   +L AY  A  +L+++   D+PPEILNNVG LH    N  E +KY+  +L+R    K E  +       D +YY  +SVT +YN  RL+EA  +  EA+ LYK IL + P Y+DC+LRLG M+RD+G  Y+ASDWFK+AL++NQDHPD+WSL+G LHL+K E GP QKKFE I++Q    +D ++ +ALGN+WL TL  P+RD+EKEKRHQ+RAL  Y+ VLR D KN+ AA+GIGAVLAHKGY  EARDVFAQVREATAD  DVW+N+AHIYVEQKQY++A+QMYENC++KF K  NTE++LYLARA FKC +L++CKQ LLKARH+AP D ++ +N+A V +R A SV+ DEKSN   VL  + +L +A   F YLS + D++  ++    +E + C DLLSQA+Y++ RA K++++ER +R KQ +E+E
Sbjct:    5 SIEIPLRDTDEVIELDFDQLPEGDEVISILKQEHTQLHIWIALALEYYKQGKTEEFVKLLEAARIDGNLDYRDHEKDQMTCLDTLAAYYVQQARKEKNKDNKKDLITQATLLYTMADKIIMYDQNHLLGRACFCLLEGDKMDQADAQFHFVLNQSPNNIPALLGKACISFNKKDYRGALAYYKKALRTNPGCPAEVRLGMGHCFVKLNKLEKARLAFSRALELNSKCVGALVGLAVLELNNKEADSIKNGVQLLSRAYTIDPSNPMVLNHLANHFFFKKDYSKVQHLALHAFHNTEVEAMQAESCYQLARSFHVQEDYDQAFQYYYQATQFASSSFVLPFFGLGQMYIYRGDKENASQCFEKVLKAYPNNYETMKILGSLYAASEDQEKRDIAKGHLKKVTEQYPDDVEAWIELAQILEQTDIQGALSAYGTATRILQEKVQADVPPEILNNVGALHFRLGNLGEAKKYFLASLDR---AKAEAEH-------DEHYYNAISVTTSYNLARLYEAMCEFHEAEKLYKNILREHPNYVDCYLRLGAMARDKGNFYEASDWFKEALQINQDHPDAWSLIGNLHLAKQEWGPGQKKFERILKQPATQSDTYSMLALGNVWLQTLHQPTRDREKEKRHQDRALAIYKQVLRNDAKNLYAANGIGAVLAHKGYFREARDVFAQVREATADISDVWLNLAHIYVEQKQYISAVQMYENCLRKFYKHQNTEVVLYLARALFKCGKLQECKQTLLKARHVAPSDTVLMFNVALVLQRLATSVLKDEKSNLKEVLNAVKELELAHRYFSYLSKVGDKMRFDLALAASEARQCSDLLSQAQYHVARARKQDEEERELRAKQEQEKE 850          
BLAST of RNA polymerase-associated protein CTR9 homolog vs. UniProt/SwissProt
Match: sp|Q6DEU9|CTR9_XENTR (RNA polymerase-associated protein CTR9 homolog OS=Xenopus tropicalis OX=8364 GN=ctr9 PE=2 SV=1)

HSP 1 Score: 1001.89 bits (2589), Expect = 0.000e+0
Identity = 501/856 (58.53%), Postives = 644/856 (75.23%), Query Frame = 3
Query:   27 TIEIPLRDTDEVIELDTDAFPDVDEVLNILKQEVAPMHVWILVALEYYRSKKYNDFVKVLNEANIHASVTYADSEKDQVKVLDMLANYYVKQASXXXXXXXXXXLFGQAAVHFTTADRIAMFDHNHLLSRAFFFLFEGDNWSQVDNQLNFVLNSSPNNVPALLGKSCIAFNKKEYRSALSFYRKALRNHPKCPASVRLGMGHCFFRLGNLEKAKFAFERALALDPECXXXXXXXXXXELNEKTLESVHHGVQKLSKAYMKDSNNPMVLNHLADHFFYAQQYKKVHTLALHAFHYTENELMRAQSCYQIARGFHKEENYDEAFQYYYQATQFASNNFVMPFYGLGQMYLCRKDIENAISSFEKVLKVYPNNYETLKILGSLYAQSDKEDRREQAKKMFQNVTEIEPDDLEAWIEYAQLL-KDDTASSLEAYTKAINLLRQE-NLDIPPEILNNVGVLHHMRKNYDETRKYYSEALERIEEVKTELSNNQDIKQDDVNYYIGLSVTINYNQGRLFEAEYQTDEADLLYKKILTQFPEYLDCHLRLGCMSRDRGQIYDASDWFKDALKVNQDHPDSWSLMGMLHLSKSEAGPAQKKFEFIVRQ--NPNDIFANVALGNIWLNTLFHPSRDKEKEKRHQERALTHYRNVLRVDPKNILAAHGIGAVLAHKGYINEARDVFAQVREATADFPDVWINIAHIYVEQKQYLAAIQMYENCIKKFNKQTNTELLLYLARAHFKCDQLKKCKQVLLKARHIAPWDPLIAYNLAFVQKRWALSVVPDEKSNFSSVLEGINDLNMAQCTFKYLSILKDQI--NIPQLPNEIKDCQDLLSQARYYLDRATKREQQERYMRQKQVEERE 2576
            +IEIPLRDTDEVIELD D  P+ DEV++ILKQE   +H+WI + LEYY+  K  DFVK+L  A I  ++ Y D EKDQ+  LD LA YYV+QA KEK K+ K+EL  QA + +T AD+I M+D NHLL RA F L EGD   Q D Q +FVLN SPNN+PALLGK+CI+FNKK+YR AL++Y+KALR +P CPA VRLGMGHCF +L  L+KA+ AF RAL L+P CVGALVGLAVLELN K  +S+ +GVQ LSKAY  D +NPMVLNHLA+HFF+ + Y KV  LALHAFH TE E M+A+SCYQ+AR FH +E+YD+AFQYYYQATQFA+ +FV+PF+GLGQMY+ R D ENA   FEKVLK YPNNYET+KILGSLYA SD +++R+ AK   + VTE  PDD+EAWIE AQ+L + D  ++L AY  A  +L+++   D+PPEILNNVG LH    N  E +KY+  +L+R    K E  +       D +YY  +SVT  YN  RL+E   +  E++ LYK IL + P Y+DC+LRLG M+RD+G  Y+ASDWFK+AL++NQDHPD+WSL+G LHL+K E GP QKKFE I++Q    ND ++ +ALGN+WL TL  P+RD+EKEKRHQ+RAL  Y+ VLR D KN+ AA+GIGAVLAHKGY+ EARDVFAQVREATAD  DVW+N+AHIYVEQKQY++A+QMYENC++KF K  NTE+LLYLARA FKC +L++CKQ+LLKARH+AP D ++ +N+A V +R A  V+ DEKSN  +VL  + +L +A   F YLS + D++  ++    +E + C DLLSQA+Y++ RA K++++E+ +R KQ +E+E
Sbjct:    5 SIEIPLRDTDEVIELDFDQLPEGDEVISILKQEHTQLHIWIALGLEYYKQVKTEDFVKLLEAARIDGNLDYRDHEKDQMTCLDTLAAYYVQQARKEKNKDNKKELITQATLLYTMADKIIMYDQNHLLGRACFCLLEGDKMDQADAQFHFVLNQSPNNIPALLGKACISFNKKDYRGALAYYKKALRTNPGCPAGVRLGMGHCFVKLNKLDKARLAFGRALDLNPTCVGALVGLAVLELNNKEADSIKNGVQLLSKAYTIDPSNPMVLNHLANHFFFKKDYSKVQHLALHAFHNTEVEAMQAESCYQLARSFHVQEDYDQAFQYYYQATQFAAASFVLPFFGLGQMYIYRGDKENASQCFEKVLKAYPNNYETMKILGSLYAASDDQEKRDIAKSHLKKVTEQYPDDVEAWIELAQILEQTDIQNALSAYGTATRILQEKVQADVPPEILNNVGALHFRLGNLGEAKKYFLASLDR---AKAEAEH-------DEHYYNAISVTTTYNLARLYEGLCEFHESEKLYKNILREHPNYVDCYLRLGAMARDKGNFYEASDWFKEALQINQDHPDAWSLIGNLHLAKQEWGPGQKKFERILKQPSTQNDTYSMLALGNVWLQTLHQPTRDREKEKRHQDRALAIYKQVLRNDSKNLYAANGIGAVLAHKGYVREARDVFAQVREATADISDVWLNLAHIYVEQKQYISAVQMYENCLRKFYKHQNTEVLLYLARALFKCGKLQECKQILLKARHVAPNDTVLMFNVALVLQRLATLVLKDEKSNLKAVLNAVKELELAHRYFNYLSKVGDKMRFDLALAASEARQCSDLLSQAQYHVARARKQDEEEKELRAKQEQEKE 850          
BLAST of RNA polymerase-associated protein CTR9 homolog vs. UniProt/SwissProt
Match: sp|Q6PD62|CTR9_HUMAN (RNA polymerase-associated protein CTR9 homolog OS=Homo sapiens OX=9606 GN=CTR9 PE=1 SV=1)

HSP 1 Score: 1001.12 bits (2587), Expect = 0.000e+0
Identity = 501/856 (58.53%), Postives = 644/856 (75.23%), Query Frame = 3
Query:   27 TIEIPLRDTDEVIELDTDAFPDVDEVLNILKQEVAPMHVWILVALEYYRSKKYNDFVKVLNEANIHASVTYADSEKDQVKVLDMLANYYVKQASXXXXXXXXXXLFGQAAVHFTTADRIAMFDHNHLLSRAFFFLFEGDNWSQVDNQLNFVLNSSPNNVPALLGKSCIAFNKKEYRSALSFYRKALRNHPKCPASVRLGMGHCFFRLGNLEKAKFAFERALALDPECXXXXXXXXXXELNEKTLESVHHGVQKLSKAYMKDSNNPMVLNHLADHFFYAQQYKKVHTLALHAFHYTENELMRAQSCYQIARGFHKEENYDEAFQYYYQATQFASNNFVMPFYGLGQMYLCRKDIENAISSFEKVLKVYPNNYETLKILGSLYAQSDKEDRREQAKKMFQNVTEIEPDDLEAWIEYAQLL-KDDTASSLEAYTKAINLLRQE-NLDIPPEILNNVGVLHHMRKNYDETRKYYSEALERIEEVKTELSNNQDIKQDDVNYYIGLSVTINYNQGRLFEAEYQTDEADLLYKKILTQFPEYLDCHLRLGCMSRDRGQIYDASDWFKDALKVNQDHPDSWSLMGMLHLSKSEAGPAQKKFEFIVRQ--NPNDIFANVALGNIWLNTLFHPSRDKEKEKRHQERALTHYRNVLRVDPKNILAAHGIGAVLAHKGYINEARDVFAQVREATADFPDVWINIAHIYVEQKQYLAAIQMYENCIKKFNKQTNTELLLYLARAHFKCDQLKKCKQVLLKARHIAPWDPLIAYNLAFVQKRWALSVVPDEKSNFSSVLEGINDLNMAQCTFKYLSILKDQI--NIPQLPNEIKDCQDLLSQARYYLDRATKREQQERYMRQKQVEERE 2576
            +IEIPLRDTDEVIELD D  P+ DEV++ILKQE   +H+WI +ALEYY+  K  +FVK+L  A I  ++ Y D EKDQ+  LD LA YYV+QA KEK K+ K++L  QA + +T AD+I M+D NHLL RA F L EGD   Q D Q +FVLN SPNN+PALLGK+CI+FNKK+YR AL++Y+KALR +P CPA VRLGMGHCF +L  LEKA+ AF RAL L+ +CVGALVGLAVLELN K  +S+ +GVQ LS+AY  D +NPMVLNHLA+HFF+ + Y KV  LALHAFH TE E M+A+SCYQ+AR FH +E+YD+AFQYYYQATQFAS++FV+PF+GLGQMY+ R D ENA   FEKVLK YPNNYET+KILGSLYA S+ +++R+ AK   + VTE  PDD+EAWIE AQ+L + D   +L AY  A  +L+++   D+PPEILNNVG LH    N  E +KY+  +L+R    K E  +       D +YY  +SVT +YN  RL+EA  +  EA+ LYK IL + P Y+DC+LRLG M+RD+G  Y+ASDWFK+AL++NQDHPD+WSL+G LHL+K E GP QKKFE I++Q    +D ++ +ALGN+WL TL  P+RD+EKEKRHQ+RAL  Y+ VLR D KN+ AA+GIGAVLAHKGY  EARDVFAQVREATAD  DVW+N+AHIYVEQKQY++A+QMYENC++KF K  NTE++LYLARA FKC +L++CKQ LLKARH+AP D ++ +N+A V +R A SV+ DEKSN   VL  + +L +A   F YLS + D++  ++     E + C DLLSQA+Y++ RA K++++ER +R KQ +E+E
Sbjct:    5 SIEIPLRDTDEVIELDFDQLPEGDEVISILKQEHTQLHIWIALALEYYKQGKTEEFVKLLEAARIDGNLDYRDHEKDQMTCLDTLAAYYVQQARKEKNKDNKKDLITQATLLYTMADKIIMYDQNHLLGRACFCLLEGDKMDQADAQFHFVLNQSPNNIPALLGKACISFNKKDYRGALAYYKKALRTNPGCPAEVRLGMGHCFVKLNKLEKARLAFSRALELNSKCVGALVGLAVLELNNKEADSIKNGVQLLSRAYTIDPSNPMVLNHLANHFFFKKDYSKVQHLALHAFHNTEVEAMQAESCYQLARSFHVQEDYDQAFQYYYQATQFASSSFVLPFFGLGQMYIYRGDKENASQCFEKVLKAYPNNYETMKILGSLYAASEDQEKRDIAKGHLKKVTEQYPDDVEAWIELAQILEQTDIQGALSAYGTATRILQEKVQADVPPEILNNVGALHFRLGNLGEAKKYFLASLDR---AKAEAEH-------DEHYYNAISVTTSYNLARLYEAMCEFHEAEKLYKNILREHPNYVDCYLRLGAMARDKGNFYEASDWFKEALQINQDHPDAWSLIGNLHLAKQEWGPGQKKFERILKQPSTQSDTYSMLALGNVWLQTLHQPTRDREKEKRHQDRALAIYKQVLRNDAKNLYAANGIGAVLAHKGYFREARDVFAQVREATADISDVWLNLAHIYVEQKQYISAVQMYENCLRKFYKHQNTEVVLYLARALFKCGKLQECKQTLLKARHVAPSDTVLMFNVALVLQRLATSVLKDEKSNLKEVLNAVKELELAHRYFSYLSKVGDKMRFDLALAATEARQCSDLLSQAQYHVARARKQDEEERELRAKQEQEKE 850          
BLAST of RNA polymerase-associated protein CTR9 homolog vs. UniProt/SwissProt
Match: sp|Q03560|CTR9_CAEEL (RNA polymerase-associated protein CTR9 OS=Caenorhabditis elegans OX=6239 GN=ctr-9 PE=3 SV=3)

HSP 1 Score: 627.476 bits (1617), Expect = 0.000e+0
Identity = 356/875 (40.69%), Postives = 548/875 (62.63%), Query Frame = 3
Query:   27 TIEIPLRDT--DEVIELDTDAFPDVDEVLNILKQEVAPMHVWILVALEYYRSKKYNDFVKVLNEANIHASVTYADSEKDQVKVLDMLANYYVKQASXXXXXXXXXXLFGQAAVHFTTADRIAMFDHNHLLSRAFFFLFEGDN----WSQVDNQLNFVLNSSPNNVPALLGKSCIAFNKKEYRSALSFYRKALRNHPKCPASVRLGMGHCFFRLGNLEKAKFAFERALALDPECXXXXXXXXXXELNEKTLESVHHGVQKLSKAYMKDSNNPMVLNHLADHFFYAQQYKKVHTLALHAFHYTENELMRAQSCYQIARGFHKEENYDEAFQYYYQATQFASNNFVMPFYGLGQMYLCRKDIENAISSFEKVLKVYPNNYETLKILGSLYAQSDKED------RREQAKKMFQNVTEIEPDDLEAWIEYAQLLK-DDTASSLEAYTKAINLL-RQENLDIPPEILNNVGVLHHMRKNYDETRKYYSEALERIEEVKTELSNNQDIKQDDVNYYIGLSVTINYNQGRLFEAEYQTDEADLLYKKILTQFPEYLDCHLRLGCMSRDRGQIYDASDWFKDALKVNQDHPDSWSLMGMLHLSKSEAGPAQKKFEFIVRQNPN----DIFANVALGNIWLNTLFHPSRDKEKEKRHQERALTHYRNVLRVDPKNILAAHGIGAVLAHKGYINEARDVFAQVREATADFPDVWINIAHIYVEQKQYLAAIQMYENCIKKFNKQTNTELLLYLARAHFKCDQLKKCKQVLLKARHIAPWDPLIAYNLAFVQKRWALSVVPDEKSNFSSVLEGINDLNMAQCTFKYLSILKD--------QINIPQLPNEIKDCQDLLSQARYYLDRATKREQQERYMRQKQVEER 2573
            TI IPL+D+  DEVIE++    PD +EVL IL+ E A +  WI VALEYYR  + + F+ +L  A   A + Y   ++DQ++ LD+LA Y++ Q  +EK K+KK + F +A V F TAD+IAM++ +HL  RA+F+LFE D     +   D Q N+V+ ++P NV  L+GK+ IAFNKK+Y++A+ ++RKA+R      A +R+G+GHCF ++G ++KAK AFERA+ ++P  V A+ GL ++ LN    +S+ H V    ++Y   +++P+ L HLA+HFF+ ++ ++  TLA HA  Y + + ++A++ YQ+ R  H +  +D A++YYYQA Q  +    +  YGLGQMY+ R +IE AI  F+ V K  PNN +T+KILGSLYA     D       R++ + +      +E DD EA I+ AQLL+  D   SLE Y  AI+LL   E++   PE+LNNVG L+   K Y++   ++  A ER+EE       +  +++        L +TI YN     E   +T EA+ +YK I+ + P Y+D +LRLGC++RDR Q+Y++S W K  ++ +Q  P  W+L+G LH +K+E  PAQKKFEFI+ +  N    D ++ VALGN+W   L +PSR KE EK++ +RAL  Y+  L++ PKN+ AA+GIG VLA+K   N+ARDVF+QVRE+T++F DVW+NIAH+ +E++Q++AA+QMY + +KKF K+ ++ L  YLA+A+++ + L + K+ L  A      +  + +N A V K+ A  V+   K     V   I+DL  A   F+Y+S   D        +I+      E K+C+DLL+QA++ L  A  ++++ER + +KQ +E+
Sbjct:   13 TIAIPLKDSHEDEVIEINCSELPDGEEVLQILEAEEAKLSYWIEVALEYYRQDRVDLFMMILESAGSRAGLEYEGVKQDQMRALDILAAYWMTQGYREKAKDKKSDFFSKATVLFNTADKIAMYEWSHLTVRAWFYLFERDKSTNKYELADQQFNYVVKTNPKNVLPLIGKAVIAFNKKDYKTAIYYFRKAIRQCRHTIADLRVGIGHCFAKMGMMDKAKTAFERAMEIEPYNVSAMCGLGIILLNTYDHDSLKHAVSLFGRSYNLQTDHPVALIHLANHFFFKKEIERAWTLAWHAATYNDCDSIKAEAFYQMGRCRHAQGQFDGAYKYYYQARQANNGEHTLAHYGLGQMYIHRNEIEEAIKCFDTVHKRLPNNTDTMKILGSLYAHVQLNDPAQTAEARQKGRDVLGKYLAVENDDYEACIDLAQLLEATDPKRSLELYENAIDLLVTNESIQPQPEMLNNVGALYMSMKQYEKAEHHFKRAKERLEEQLNTDEGSLLLERRSAPEKSHL-LTIRYNLALCLEHLCRTVEAEQMYKDIVKECPGYIDGYLRLGCITRDRHQVYESSLWLKQGVQFDQASPIVWTLIGNLHFAKNEWMPAQKKFEFILSKIFNNKIPDPYSLVALGNVWFEQLLNPSRKKEDEKKYIDRALQMYQKALKLQPKNMYAANGIGCVLAYKRNWNDARDVFSQVRESTSEFYDVWLNIAHVCMEREQWMAAVQMYSSAMKKFRKENDSTLQHYLAKAYYRANMLNEAKEALECAMLDQLDNTQLKFNYAIVLKKSAKEVLRGHKMTSEQVTAAIDDLKFADKIFQYISKNDDRQSSHTGMRISRTICAEEAKNCKDLLTQAKHKLAAAQTQDEEERRLMEKQEKEK 886          
BLAST of RNA polymerase-associated protein CTR9 homolog vs. TrEMBL
Match: A0A183MSF9 (TPR_REGION domain-containing protein OS=Schistosoma margrebowiei OX=48269 GN=SMRZ_LOCUS18984 PE=4 SV=1)

HSP 1 Score: 1117.84 bits (2890), Expect = 0.000e+0
Identity = 550/858 (64.10%), Postives = 685/858 (79.84%), Query Frame = 3
Query:   27 TIEIPLRDTDEVIELDTDAFPDVDEVLNILKQEVAPMHVWILVALEYYRSKKYNDFVKVLNEANIHASVTYADSEKDQVKVLDMLANYYVKQASXXXXXXXXXXLFGQAAVHFTTADRIAMFDHNHLLSRAFFFLFEGDNWSQVDNQLNFVLNSSPNNVPALLGKSCIAFNKKEYRSALSFYRKALRNHPKCPASVRLGMGHCFFRLGNLEKAKFAFERALALDPECXXXXXXXXXXELNEKTLESVHHGVQKLSKAYMKDSNNPMVLNHLADHFFYAQQYKKVHTLALHAFHYTENELMRAQSCYQIARGFHKEENYDEAFQYYYQATQFASNNFVMPFYGLGQMYLCRKDIENAISSFEKVLKVYPNNYETLKILGSLYAQSDKEDRREQAKKMFQNVTEIEPDDLEAWIEYAQLLKDDTASSLEAYTKAINLLRQENLDIPPEILNNVGVLHHMRKNYDETRKYYSEALERI-EEVKTE----LSNNQDIKQDDVNYYIGLSVTINYNQGRLFEAEYQTDEADLLYKKILTQFPEYLDCHLRLGCMSRDRGQIYDASDWFKDALKVNQDHPDSWSLMGMLHLSKSEAGPAQKKFEFIVRQNP--NDIFANVALGNIWLNTLFHPSRDKEKEKRHQERALTHYRNVLRVDPKNILAAHGIGAVLAHKGYINEARDVFAQVREATADFPDVWINIAHIYVEQKQYLAAIQMYENCIKKFNKQTNTELLLYLARAHFKCDQLKKCKQVLLKARHIAPWDPLIAYNLAFVQKRWALSVVPDEKSNFSSVLEGINDLNMAQCTFKYLSILKDQINIPQLPNEIKDCQDLLSQARYYLDRATKREQQERYMRQKQVEERES 2579
            TIEIPLR  DE+IELDTD  PD +EVLNIL QE AP+ +WI VA+ YY+ K Y+DF KVL EA ++A+      + D V++LDMLANYY ++A KEK+K+KK +L  QA   FT+ADRI M+D  HLL RAFFF++EG+NWSQ D+QLNFVLN    +VPA LGK+CIAFNKKEYR+AL FYRKALR  P CPA+VRLGMGHCFFRLGN+EKA+ AF+RAL LDPECVGALVGLAVL+LNEKT ES+  GVQKLS+AY  DS NPMVLNHLADHFFY ++Y KVH LALHAF+ TE E +RA+SCYQ+AR FH +ENYD AFQYYY ATQ AS+ F++PFYGLGQMYL R D+E+A  SFE+VLK  PNNYETLKILGSLYAQS+K D+R Q+K++F+ VTE +P+D+EAWIEYAQLL  D   +L+AY+KA+ +L    L+I PEILNN+G LH ++  YD++ ++++ + +RI EE + E      ++  +  DD  YY GLS+T+ YNQ RL EA+ ++D A+ +YK IL + P Y++C+LRLGC++RDRGQI DAS WFK+AL V+QD+PD+W+L+G+LHL+K+E   AQKKF+ I+RQ     D FA + LGNIWL TL HP +DK+K KRHQ+RAL+ Y+ VL  DP+NI AAHGIG VLAHKG++NEARDVFAQVREATADFPDVWINIAHIYVEQKQY AAIQMYENCIKKF++Q NTELL YLARAHFK  QLK+CK +LLKARH+ PWDP++ +NLAFVQKR A++V+ DE S+FSSV E I DLNMA+CTF +LS L + +N     +E + CQDLLSQA+Y+LDRA  RE+QER +R++Q EERE+
Sbjct:   18 TIEIPLRGGDEIIELDTDQLPDGEEVLNILNQEKAPLQIWITVAIAYYKKKLYDDFEKVLEEAYLNAADLQPYHDSDLVRLLDMLANYYGRKAYKEKSKDKKNQLIAQATRLFTSADRIDMYDQKHLLGRAFFFIYEGENWSQADSQLNFVLNQGAPSVPAYLGKACIAFNKKEYRNALGFYRKALRLQPNCPATVRLGMGHCFFRLGNMEKARLAFKRALDLDPECVGALVGLAVLDLNEKTQESIKQGVQKLSRAYNLDSTNPMVLNHLADHFFYKKEYAKVHRLALHAFYNTETESIRAESCYQMARAFHIQENYDNAFQYYYLATQLASSTFILPFYGLGQMYLHRNDLEHAAMSFERVLKDNPNNYETLKILGSLYAQSNKSDKRTQSKQLFKQVTESQPEDVEAWIEYAQLLDHDINGALDAYSKALTILENIQLEIAPEILNNIGALHFIKGEYDKSSEFFTRSYDRILEEQRNEENECGGDSSGLTNDD--YYHGLSITVRYNQARLHEAQGRSDLAEEIYKSILLRHPSYIECYLRLGCIARDRGQIRDASIWFKEALDVDQDNPDAWTLIGLLHLNKNEVEQAQKKFDRIIRQPAYRADAFARICLGNIWLTTLHHPIKDKDKRKRHQDRALSFYKAVLCADPRNIWAAHGIGCVLAHKGFVNEARDVFAQVREATADFPDVWINIAHIYVEQKQYTAAIQMYENCIKKFSRQNNTELLQYLARAHFKAGQLKECKTMLLKARHVKPWDPVLTFNLAFVQKRLAVTVLQDETSSFSSVCEAIADLNMARCTFNHLSKLNEVLNQAMAADEARICQDLLSQAKYHLDRAKSREEQERVVRKRQEEEREA 873          
BLAST of RNA polymerase-associated protein CTR9 homolog vs. TrEMBL
Match: G4V9B2 (Putative tpr repeat nuclear phosphoprotein OS=Schistosoma mansoni OX=6183 GN=Smp_072370 PE=4 SV=1)

HSP 1 Score: 1115.52 bits (2884), Expect = 0.000e+0
Identity = 549/858 (63.99%), Postives = 683/858 (79.60%), Query Frame = 3
Query:   27 TIEIPLRDTDEVIELDTDAFPDVDEVLNILKQEVAPMHVWILVALEYYRSKKYNDFVKVLNEANIHASVTYADSEKDQVKVLDMLANYYVKQASXXXXXXXXXXLFGQAAVHFTTADRIAMFDHNHLLSRAFFFLFEGDNWSQVDNQLNFVLNSSPNNVPALLGKSCIAFNKKEYRSALSFYRKALRNHPKCPASVRLGMGHCFFRLGNLEKAKFAFERALALDPECXXXXXXXXXXELNEKTLESVHHGVQKLSKAYMKDSNNPMVLNHLADHFFYAQQYKKVHTLALHAFHYTENELMRAQSCYQIARGFHKEENYDEAFQYYYQATQFASNNFVMPFYGLGQMYLCRKDIENAISSFEKVLKVYPNNYETLKILGSLYAQSDKEDRREQAKKMFQNVTEIEPDDLEAWIEYAQLLKDDTASSLEAYTKAINLLRQENLDIPPEILNNVGVLHHMRKNYDETRKYYSEALERI-EEVKTE----LSNNQDIKQDDVNYYIGLSVTINYNQGRLFEAEYQTDEADLLYKKILTQFPEYLDCHLRLGCMSRDRGQIYDASDWFKDALKVNQDHPDSWSLMGMLHLSKSEAGPAQKKFEFIVRQNP--NDIFANVALGNIWLNTLFHPSRDKEKEKRHQERALTHYRNVLRVDPKNILAAHGIGAVLAHKGYINEARDVFAQVREATADFPDVWINIAHIYVEQKQYLAAIQMYENCIKKFNKQTNTELLLYLARAHFKCDQLKKCKQVLLKARHIAPWDPLIAYNLAFVQKRWALSVVPDEKSNFSSVLEGINDLNMAQCTFKYLSILKDQINIPQLPNEIKDCQDLLSQARYYLDRATKREQQERYMRQKQVEERES 2579
            TIEIPLR  DE+IELDTD  PD +EVLNIL QE AP+ +WI VA+ YY+ K Y+DF KVL EA ++A+      + D V++LDMLANYY ++A KEK+K+KK +L  QA   FT+ADRI M+D  HLL RAFFF++EG+NWSQ D+QLNFVLN    +VPA LGK+CIAFNKKEYR+AL FYRKALR  P CPA+VRLGMGHCFFRLGN+EKA+ AF+RAL LDPECVGALVGLAVL+LNEKT ES+  GVQKLS+AY  DS NPMVLNHLADHFFY ++Y KVH LALHAF+ TE E +RA+SCYQ+AR FH +ENYD AFQYYY ATQ AS+ F++PFYGLGQMYL R D+E+A  SFE+VLK  PNNYETLKILGSLYAQS+K D+R Q+K++F+ VTE +P+D+EAWIEYAQLL +D   +L+AY+KA+ +L    L+I PEILNN+  LH  +  YD++ ++++ + +RI EE + E      ++  +  DD  YY GLS+T+ YNQ RL EA+ ++D A+ +YK IL + P Y++C+LRLGC++RDRGQI DAS WFK+AL V+QD+PD+W+L+G+LHL K+E   AQKKF+ I+RQ     D FA + LGNIWL TL HP +DK+K KRHQ+RAL+ Y+ VL  DP+NI AAHGIG VLAHKG++NEARDVFAQVREATADFPDVWINIAHIYVEQKQY AAIQMYENCIKKF++Q NTELL YLARAHFK  QLK+CK +LLKARH+ PWDP++ +NLAFVQKR A++V+ DE S+FSSV E I DLNMA+CTF +LS L + +N     +E + CQDLLSQA+Y+LDRA  RE+QER +R++Q EERE+
Sbjct:   17 TIEIPLRGGDEIIELDTDQLPDGEEVLNILNQEKAPLQIWITVAIAYYKKKLYDDFEKVLEEAYLNAADLQPYHDSDLVRLLDMLANYYGRKAYKEKSKDKKNQLIAQATRLFTSADRIDMYDQKHLLGRAFFFIYEGENWSQADSQLNFVLNQGAPSVPAYLGKACIAFNKKEYRNALGFYRKALRLQPNCPATVRLGMGHCFFRLGNMEKARLAFKRALDLDPECVGALVGLAVLDLNEKTQESIKQGVQKLSRAYNLDSTNPMVLNHLADHFFYKKEYAKVHRLALHAFYNTETESIRAESCYQMARAFHIQENYDNAFQYYYLATQLASSTFILPFYGLGQMYLHRNDLEHAAMSFERVLKDNPNNYETLKILGSLYAQSNKPDKRTQSKQLFKQVTESQPEDVEAWIEYAQLLDNDINGALDAYSKALTILENIQLEIAPEILNNIAALHFTKGEYDKSSEFFTRSYDRILEEQRNEENECGGDSSGLTNDD--YYHGLSITVRYNQARLHEAQGRSDLAEEIYKSILLRHPSYIECYLRLGCIARDRGQIRDASIWFKEALDVDQDNPDAWTLIGLLHLGKNEVEQAQKKFDRIIRQPAYRADAFARICLGNIWLTTLHHPIKDKDKRKRHQDRALSFYKAVLCADPRNIWAAHGIGCVLAHKGFVNEARDVFAQVREATADFPDVWINIAHIYVEQKQYTAAIQMYENCIKKFSRQNNTELLQYLARAHFKAGQLKECKTMLLKARHVKPWDPVLTFNLAFVQKRLAVTVLQDETSSFSSVCEAIADLNMARCTFNHLSKLNEVLNQAMAADEARICQDLLSQAKYHLDRAKSREEQERVVRKRQEEEREA 872          
BLAST of RNA polymerase-associated protein CTR9 homolog vs. TrEMBL
Match: A0A4E0RCQ6 (RNA polymerase-associated protein CTR9 OS=Fasciola hepatica OX=6192 GN=D915_002541 PE=4 SV=1)

HSP 1 Score: 1094.34 bits (2829), Expect = 0.000e+0
Identity = 544/865 (62.89%), Postives = 667/865 (77.11%), Query Frame = 3
Query:   12 LYVMTTIEIPLRDTDEVIELDTDAFPDVDEVLNILKQEVAPMHVWILVALEYYRSKKYNDFVKVLNEANIHASVTYADSEKDQVKVLDMLANYYVKQASXXXXXXXXXXLFGQAAVHFTTADRIAMFDHNHLLSRAFFFLFEGDNWSQVDNQLNFVLNSSPNNVPALLGKSCIAFNKKEYRSALSFYRKALRNHPKCPASVRLGMGHCFFRLGNLEKAKFAFERALALDPECXXXXXXXXXXELNEKTLESVHHGVQKLSKAYMKDSNNPMVLNHLADHFFYAQQYKKVHTLALHAFHYTENELMRAQSCYQIARGFHKEENYDEAFQYYYQATQFASNNFVMPFYGLGQMYLCRKDIENAISSFEKVLKVYPNNYETLKILGSLYAQSDKEDRREQAKKMFQNVTEIEPDDLEAWIEYAQLLKDDTASSLEAYTKAINLLRQENLDIPPEILNNVGVLHHMRKNYDETRKYYSEALERI-------EEVKTELSNNQDIKQDDVNYYIGLSVTINYNQGRLFEAEYQTDEADLLYKKILTQFPEYLDCHLRLGCMSRDRGQIYDASDWFKDALKVNQDHPDSWSLMGMLHLSKSEAGPAQKKFEFIVRQNP--NDIFANVALGNIWLNTLFHPSRDKEKEKRHQERALTHYRNVLRVDPKNILAAHGIGAVLAHKGYINEARDVFAQVREATADFPDVWINIAHIYVEQKQYLAAIQMYENCIKKFNKQTNTELLLYLARAHFKCDQLKKCKQVLLKARHIAPWDPLIAYNLAFVQKRWALSVVPDEKSNFSSVLEGINDLNMAQCTFKYLSILKDQINIPQLPNEIKDCQDLLSQARYYLDRATKREQQERYMRQKQVEERES 2579
            L    +IEIPLR  DEVIELDTD  PD +EVLNIL QE AP+ +W  VA+ YY+ K YNDF K+L EA  +A       E D V++LDMLANYY ++A KEK+KEKK +L  QA   FT+ADRI M+D  HLL RAFFF++EG+NWSQ D+QLNFVLN    +VPA LGK+CIAFNKKEYR+AL FYRKALR  P CPA+VRLGMGHCFF+LGNLEKA+ AF+RAL LDP+CVGALVGLA+L+LNEKT ES+  GVQKLS+AY  D  NPMVLNHLADHFFY ++Y KVH LA+HAF+ TE E MRA+SCYQ+AR FH +ENYD AFQYYY ATQ AS NF++PFYGLGQMYL R D+E+A  SFE+VLK +P NYETLKILGSLYAQS K D+R  AK++F+ VTE +P+D+EAWIEYAQLL+ D + +L+AY KA+ +L    LD+ PEILNN+G L++M+   D+   ++S A +RI       E+ + E     +  Q D +YY GL +T+ YN+ RL EA+ + D A+ +YK +L + P Y+DC+LRLGC++RDRGQI+DAS WFKDAL V+ D+PD WSL+G+LHL+K+E   AQKKF+ I+RQ     D FA ++LGNIWL TL HP RDK+K KRHQ+RAL+ Y+ VL  DP+NI AAHGIG VLAHKG++ EARDVFAQVREATADF DVWINIAHIYVEQKQY AAIQMYENCI+KF KQ NTELL YLARAHFK  QLK+CK +LLKA H+ PWDPL+ +NLA V KR A++V+ DE S+FS V E I DLNMA+CTF +LS   D +N     +E + CQDLLSQA Y+LDRA  RE+QER +R++Q EERE+
Sbjct:   10 LSAENSIEIPLRGGDEVIELDTDQLPDGEEVLNILNQEKAPLQIWTTVAVAYYKKKLYNDFEKILEEAYRNAVELQPYHESDLVRLLDMLANYYGRKAYKEKSKEKKSQLIAQATRLFTSADRIDMYDQKHLLGRAFFFIYEGENWSQADSQLNFVLNQGTPSVPAYLGKACIAFNKKEYRNALGFYRKALRLQPNCPATVRLGMGHCFFKLGNLEKARLAFQRALDLDPDCVGALVGLAILDLNEKTQESIKQGVQKLSRAYNLDPTNPMVLNHLADHFFYKKEYAKVHRLAIHAFYNTETEAMRAESCYQMARAFHMQENYDNAFQYYYLATQMASLNFILPFYGLGQMYLHRNDLEHAAVSFERVLKDHPTNYETLKILGSLYAQSTKPDKRAHAKQLFKQVTESQPEDVEAWIEYAQLLEHDVSGALDAYLKALAILENIQLDMAPEILNNIGCLYYMKNELDQAGSFFSRADDRIQEEQQHEEQERAERGTVSNPTQAD-DYYHGLGITVRYNRARLHEAQGRPDLAEEIYKNLLLKHPSYIDCYLRLGCIARDRGQIWDASIWFKDALDVDPDNPDVWSLIGLLHLNKNEVEQAQKKFDRIIRQPAYRADAFARISLGNIWLTTLHHPIRDKDKRKRHQDRALSFYKAVLCADPRNIWAAHGIGCVLAHKGFVTEARDVFAQVREATADFADVWINIAHIYVEQKQYTAAIQMYENCIRKFGKQNNTELLQYLARAHFKAGQLKECKTILLKAMHVKPWDPLLTFNLALVHKRLAVTVLQDETSSFSLVCEVIADLNMARCTFDHLSKANDSLNQAMAADEARACQDLLSQAEYHLDRARSREEQERVVRKRQEEEREA 873          
BLAST of RNA polymerase-associated protein CTR9 homolog vs. TrEMBL
Match: A0A4S2LNK8 (TPR_REGION domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_007254 PE=4 SV=1)

HSP 1 Score: 1090.1 bits (2818), Expect = 0.000e+0
Identity = 541/861 (62.83%), Postives = 674/861 (78.28%), Query Frame = 3
Query:   12 LYVMTTIEIPLRDTDEVIELDTDAFPDVDEVLNILKQEVAPMHVWILVALEYYRSKKYNDFVKVLNEANIHASVTYADSEKDQVKVLDMLANYYVKQASXXXXXXXXXXLFGQAAVHFTTADRIAMFDHNHLLSRAFFFLFEGDNWSQVDNQLNFVLNSSPNNVPALLGKSCIAFNKKEYRSALSFYRKALRNHPKCPASVRLGMGHCFFRLGNLEKAKFAFERALALDPECXXXXXXXXXXELNEKTLESVHHGVQKLSKAYMKDSNNPMVLNHLADHFFYAQQYKKVHTLALHAFHYTENELMRAQSCYQIARGFHKEENYDEAFQYYYQATQFASNNFVMPFYGLGQMYLCRKDIENAISSFEKVLKVYPNNYETLKILGSLYAQSDKEDRREQAKKMFQNVTEIEPDDLEAWIEYAQLLKDDTASSLEAYTKAINLLRQENLDIPPEILNNVGVLHHMRKNYDETRKYYSEALERIEEVKTELSN---NQDIKQDDVNYYIGLSVTINYNQGRLFEAEYQTDEADLLYKKILTQFPEYLDCHLRLGCMSRDRGQIYDASDWFKDALKVNQDHPDSWSLMGMLHLSKSEAGPAQKKFEFIVRQNP--NDIFANVALGNIWLNTLFHPSRDKEKEKRHQERALTHYRNVLRVDPKNILAAHGIGAVLAHKGYINEARDVFAQVREATADFPDVWINIAHIYVEQKQYLAAIQMYENCIKKFNKQTNTELLLYLARAHFKCDQLKKCKQVLLKARHIAPWDPLIAYNLAFVQKRWALSVVPDEKSNFSSVLEGINDLNMAQCTFKYLSILKDQINIPQLPNEIKDCQDLLSQARYYLDRATKREQQERYMRQKQVEERES 2579
            L    +IEIPLR  DEVIELDTD  PD +EVLNIL QE AP+ +WI VA+ YY+ + Y+DF KVL EA  +A+      E D V++LDMLANYY ++A KEKTKEKK +L   A   FT+ADRI M+D  HLL RAFFF++EG+NWSQ D+QLNFVLN    +VPA LGK+CIAFNKKEYR+AL FYRKALR  P CPASVRLGMGHCFF+LGN+EKA+ AF+RAL LDP+CVGALVGLA+L+LNEKT ES+  GVQ+LS+AY  D  NPMVLNHLADHFFY ++Y KV  LALHAF+ TE E MRA+SCYQ+AR FH +ENYD AFQYYY ATQ AS+NF++PFYGLGQMYL R D+E+A  SFE+VLK +P NYETLKILGSLY+QS+K D+R QAK++F+ VTE +P+D+EAWIEYAQLL++DT  +L+AY KA+ +L    LD+ PEILNN+  L+HM+ ++ +   +++ A++RI+E +    N   +  +  DD  YY GL+VT+ YN+ RL E   + D A+ +YK IL Q P Y+DC+LRLGC++RDRG I+DAS WFKDAL ++ DHPD WSL+G+LHLSK+EA  AQKKF+ I+RQ     D FA ++LGNIWL TL HP RDK+K KRHQ+RAL+ Y+ VL  DP+NI AAHGIG VLAHKG++NEARDVFAQVREATADFPDVWINIAHIYVEQKQY AAIQMYENC+KKF+ Q NTELL YLARA+FK  QLK+CK +LLKA H+ PWD L+ +NLA V+KR A++V+ DE S+F SV + I DLNMA+CTF +LS   + +N     +E + CQDLLSQA+Y+LDRA  RE+QER +R++Q +ERE+
Sbjct:   50 LAAENSIEIPLRGGDEVIELDTDQLPDGEEVLNILNQEKAPLPIWINVAVAYYKKRLYDDFEKVLEEAYRNAADLQPYQEGDLVRLLDMLANYYGRKAYKEKTKEKKNQLIAHATRLFTSADRIDMYDQKHLLGRAFFFIYEGENWSQADSQLNFVLNQGAPSVPAYLGKACIAFNKKEYRNALGFYRKALRLQPNCPASVRLGMGHCFFKLGNMEKARLAFQRALDLDPDCVGALVGLAILDLNEKTQESIKQGVQRLSRAYNLDPTNPMVLNHLADHFFYKKEYDKVQRLALHAFYNTETEAMRAESCYQMARAFHMQENYDNAFQYYYLATQLASSNFILPFYGLGQMYLHRNDLEHAAVSFERVLKDHPTNYETLKILGSLYSQSNKPDKRAQAKQLFKQVTESQPEDVEAWIEYAQLLENDTNGALDAYLKALTILENIQLDVAPEILNNIACLYHMKNDHTQAMNFFTRAVDRIQEEQQSEENERADGGVGHDD-EYYHGLNVTVRYNRARLHEVCGRPDLAEEIYKSILLQHPSYIDCYLRLGCIARDRGMIWDASIWFKDALDIDPDHPDVWSLIGLLHLSKNEAEQAQKKFDRIIRQPTYRADAFARISLGNIWLTTLHHPIRDKDKRKRHQDRALSFYKAVLCADPRNIWAAHGIGCVLAHKGFVNEARDVFAQVREATADFPDVWINIAHIYVEQKQYTAAIQMYENCLKKFSMQNNTELLQYLARAYFKAGQLKECKTMLLKAMHVKPWDQLLTFNLALVRKRLAVTVLQDETSSFLSVCDAIADLNMARCTFDHLSKSNEVLNQALAADEARTCQDLLSQAKYHLDRAKSREEQERVVRKRQEDEREA 909          
BLAST of RNA polymerase-associated protein CTR9 homolog vs. TrEMBL
Match: A0A504Y458 (RNA polymerase-associated protein CTR9 (Fragment) OS=Fasciola gigantica OX=46835 GN=FGIG_06589 PE=4 SV=1)

HSP 1 Score: 1090.1 bits (2818), Expect = 0.000e+0
Identity = 543/860 (63.14%), Postives = 667/860 (77.56%), Query Frame = 3
Query:   27 TIEIPLRDTDEVIELDTDAFPDVDEVLNILKQEVAPMHVWILVALEYYRSKKYNDFVKVLNEANIHASVTYADSEKDQVKVLDMLANYYVKQASXXXXXXXXXXLFGQAAVHFTTADRIAMFDHNHLLSRAFFFLFEGDNWSQVDNQLNFVLNSSPNNVPALLGKSCIAFNKKEYRSALSFYRKALRNHPKCPASVRLGMGHCFFRLGNLEKAKFAFERALALDPECXXXXXXXXXXELNEKTLESVHHGVQKLSKAYMKDSNNPMVLNHLADHFFYAQQYKKVHTLALHAFHYTENELMRAQSCYQIARGFHKEENYDEAFQYYYQATQFASNNFVMPFYGLGQMYLCRKDIENAISSFEKVLKVYPNNYETLKILGSLYAQSDKEDRREQAKKMFQNVTEIEPDDLEAWIEYAQLLKDDTASSLEAYTKAINLLRQENLDIPPEILNNVGVLHHMRKNYDETRKYYSEALERI-------EEVKTELSNNQDIKQDDVNYYIGLSVTINYNQGRLFEAEYQTDEADLLYKKILTQFPEYLDCHLRLGCMSRDRGQIYDASDWFKDALKVNQDHPDSWSLMGMLHLSKSEAGPAQKKFEFIVRQNP--NDIFANVALGNIWLNTLFHPSRDKEKEKRHQERALTHYRNVLRVDPKNILAAHGIGAVLAHKGYINEARDVFAQVREATADFPDVWINIAHIYVEQKQYLAAIQMYENCIKKFNKQTNTELLLYLARAHFKCDQLKKCKQVLLKARHIAPWDPLIAYNLAFVQKRWALSVVPDEKSNFSSVLEGINDLNMAQCTFKYLSILKDQINIPQLPNEIKDCQDLLSQARYYLDRATKREQQERYMRQKQVEERES 2579
            +IEIPLR  DEVIELDTD  PD +EVLNIL QE AP+ +W  VA+ YY+ K YNDF K+L EA  +A+      E D V++LDMLANYY ++A KEK+KEKK +L  QA   FT+ADRI M+D  HLL RAFFF++EG+NWSQ D+QLNFVLN    +VPA LGK+CIAFNKKEYR+AL FYRKALR  P CPA+VRLGMGHCFF+LGNLEKA+ AF+RAL LDP+CVGALVGLA+L+LNEKT ES+  GVQKLS+AY  D  NPMVLNHLADHFFY ++Y KVH LA+HAF+ TE E MRA+SCYQ+AR FH +ENYD AFQYYY ATQ AS NF++PFYGLGQMYL R D+E+A  SFE+VLK +P NYETLKILGSLYAQS K D+R  AK++F+ VTE +P+D+EAWIEYAQLL+ D + +L+AY KA+ +L    LD+ PEILNN+G L++M+   D+   ++S A +RI       E+ + E     +  Q D +YY GL +T+ YN+ RL EA+ + D A+ +YK +L + P Y+DC+LRLGC++RDRGQI+DAS WFKDAL V+ D+PD WSL+G+LHL+K+E   AQKKF+ I+RQ     D FA ++LGNIWL TL HP RDK+K KRHQ+RAL+ Y+ VL  DP+NI AAHGIG VLAHKG++ EARDVFAQVREATADF DVWINIAHIYVEQKQY AAIQMYENCI+KF KQ NTELL YLARAHFK  QLK+CK +LLKA H+ PWDPL+ +NLA V KR A++V+ DE S+FS V E I DLNMA+CTF +LS   D +N     +E + CQDLLSQA Y+LDRA  RE+QER +R++Q EERE+
Sbjct:   14 SIEIPLRGGDEVIELDTDQLPDGEEVLNILNQEKAPLQIWTTVAVAYYKKKLYNDFEKILEEAYRNAAELQPYHESDLVRLLDMLANYYGRKAYKEKSKEKKSQLIAQATRLFTSADRIDMYDQKHLLGRAFFFIYEGENWSQADSQLNFVLNQGTPSVPAYLGKACIAFNKKEYRNALGFYRKALRLQPNCPATVRLGMGHCFFKLGNLEKARLAFQRALDLDPDCVGALVGLAILDLNEKTQESIKQGVQKLSRAYNLDPTNPMVLNHLADHFFYKKEYAKVHRLAIHAFYNTETEAMRAESCYQMARAFHMQENYDNAFQYYYLATQMASLNFILPFYGLGQMYLHRNDLEHAAVSFERVLKDHPTNYETLKILGSLYAQSAKPDKRAHAKQLFKQVTESQPEDVEAWIEYAQLLEHDVSGALDAYLKALAILENIQLDMAPEILNNIGCLYYMKNELDQAGSFFSRADDRIQEEQQHEEQERAERGTMSNPTQAD-DYYHGLGITVRYNRARLHEAQGRPDLAEEIYKSLLLKHPSYIDCYLRLGCIARDRGQIWDASIWFKDALDVDPDNPDVWSLIGLLHLNKNEVEQAQKKFDRIIRQPAYRADAFARISLGNIWLTTLHHPIRDKDKRKRHQDRALSFYKAVLCADPRNIWAAHGIGCVLAHKGFVTEARDVFAQVREATADFADVWINIAHIYVEQKQYTAAIQMYENCIRKFGKQNNTELLQYLARAHFKAGQLKECKTILLKAMHVKPWDPLLTFNLALVHKRLAVTVLQDETSSFSLVCEVIADLNMARCTFDHLSKANDSLNQAMAADEARACQDLLSQAEYHLDRARSREEQERVVRKRQEEEREA 872          
BLAST of RNA polymerase-associated protein CTR9 homolog vs. Ensembl Cavefish
Match: ctr9 (CTR9 homolog, Paf1/RNA polymerase II complex component [Source:NCBI gene;Acc:103042616])

HSP 1 Score: 1001.5 bits (2588), Expect = 0.000e+0
Identity = 502/856 (58.64%), Postives = 644/856 (75.23%), Query Frame = 3
Query:   27 TIEIPLRDTDEVIELDTDAFPDVDEVLNILKQEVAPMHVWILVALEYYRSKKYNDFVKVLNEANIHASVTYADSEKDQVKVLDMLANYYVKQASXXXXXXXXXXLFGQAAVHFTTADRIAMFDHNHLLSRAFFFLFEGDNWSQVDNQLNFVLNSSPNNVPALLGKSCIAFNKKEYRSALSFYRKALRNHPKCPASVRLGMGHCFFRLGNLEKAKFAFERALALDPECXXXXXXXXXXELNEKTLESVHHGVQKLSKAYMKDSNNPMVLNHLADHFFYAQQYKKVHTLALHAFHYTENELMRAQSCYQIARGFHKEENYDEAFQYYYQATQFASNNFVMPFYGLGQMYLCRKDIENAISSFEKVLKVYPNNYETLKILGSLYAQSDKEDRREQAKKMFQNVTEIEPDDLEAWIEYAQLL-KDDTASSLEAYTKAINLLRQE-NLDIPPEILNNVGVLHHMRKNYDETRKYYSEALERIEEVKTELSNNQDIKQDDVNYYIGLSVTINYNQGRLFEAEYQTDEADLLYKKILTQFPEYLDCHLRLGCMSRDRGQIYDASDWFKDALKVNQDHPDSWSLMGMLHLSKSEAGPAQKKFEFIVRQ--NPNDIFANVALGNIWLNTLFHPSRDKEKEKRHQERALTHYRNVLRVDPKNILAAHGIGAVLAHKGYINEARDVFAQVREATADFPDVWINIAHIYVEQKQYLAAIQMYENCIKKFNKQTNTELLLYLARAHFKCDQLKKCKQVLLKARHIAPWDPLIAYNLAFVQKRWALSVVPDEKSNFSSVLEGINDLNMAQCTFKYLSILKDQI--NIPQLPNEIKDCQDLLSQARYYLDRATKREQQERYMRQKQVEERE 2576
            +IEIPLRDTDEVIELD D  P+ DEV++ILKQE   +H+WI +ALEYY+  K  DFVK+L  A I  ++ Y D EKDQ+  LD LA YYV+QA KEK K+ K++L  Q+ + +T AD+I M+D NHLL RA F L EGD   Q D Q +FVLN S NN+PALLGK+CI+FNKK+YR AL++Y+KALR +P CPA VRLGMGHCF +L  LEKA+ AF RAL L+ +CVGALVGLAVLELN K  +S+ +GVQ LS+AY  D +NPMVLNHLA+HFF+ + Y KV  LALHAFH TE E M+A+SCYQ+AR FH +E+YD+AFQYYYQATQFAS+ FV+PF+GLGQMY+ R+D ENA   FEKVLK YPNNYET+KILGSLYA SD +++R+ AK   + VTE  PDD+EAWIE AQ+L + D   +L AY  A  +L+++   D+PPEILNN+G LH    N  E +KY+  +LER    K E        + D +YY  +SVT +YN  RL+EA  +  EA+ LYK IL + P Y+DC+LRLG M+RD+G  Y+ASDWFK+AL++NQDHPD+WSL+G LHL+K E GP QKKFE I++Q    ND ++ +ALGN+WL TL  P+RD+EKEKRHQ+RAL  Y+ VLR D KN+ AA+GIGAVLAHKGY  EARDVFAQVREATAD  DVW+N+AHIYVEQKQY++A+QMYENC+KKF K  NTE+LLYLARA FKC +L++CKQ+LL+ARH+AP D ++ +N+A V +R A  V+ DEKSN  +VL  + +L +A   F YLS   D++  ++    +E + C DLLSQA+Y++ RA K++++E+ +R KQ +ERE
Sbjct:    5 SIEIPLRDTDEVIELDFDQLPEGDEVISILKQEHTQLHIWIALALEYYKQGKTEDFVKLLEAARIDGNLDYRDHEKDQMTCLDTLAAYYVQQARKEKNKDAKKDLINQSTLLYTMADKIIMYDQNHLLGRACFCLLEGDKMDQADAQFHFVLNQSTNNIPALLGKACISFNKKDYRGALAYYKKALRTNPGCPAEVRLGMGHCFVKLNKLEKARLAFGRALELNSKCVGALVGLAVLELNNKEADSIKNGVQLLSRAYTIDPSNPMVLNHLANHFFFKKDYSKVQHLALHAFHNTEVEAMQAESCYQLARSFHVQEDYDQAFQYYYQATQFASSTFVLPFFGLGQMYVYRRDKENAAQCFEKVLKAYPNNYETMKILGSLYATSDDQEKRDIAKGHLKKVTEQYPDDVEAWIELAQILEQTDIQGALSAYGTATRILQEKVQADVPPEILNNLGALHFRLGNLGEAKKYFLASLER---AKAE-------GEHDEHYYNAISVTTSYNLARLYEAMCEFHEAEKLYKNILREHPNYVDCYLRLGAMARDKGNFYEASDWFKEALQINQDHPDAWSLIGNLHLAKQEWGPGQKKFERILKQPSTQNDTYSMLALGNVWLQTLHQPTRDREKEKRHQDRALAIYKQVLRNDSKNLYAANGIGAVLAHKGYYREARDVFAQVREATADISDVWLNLAHIYVEQKQYISAVQMYENCLKKFYKYQNTEVLLYLARALFKCGKLQECKQMLLRARHVAPNDTVLMFNIALVLQRLATLVLKDEKSNLKAVLSAVKELELAHRYFSYLSKAGDKMRFDLALASSEARQCSDLLSQAQYHVARARKQDEEEKELRAKQDQERE 850          
BLAST of RNA polymerase-associated protein CTR9 homolog vs. Ensembl Cavefish
Match: ctr9 (CTR9 homolog, Paf1/RNA polymerase II complex component [Source:NCBI gene;Acc:103042616])

HSP 1 Score: 999.964 bits (2584), Expect = 0.000e+0
Identity = 502/856 (58.64%), Postives = 644/856 (75.23%), Query Frame = 3
Query:   27 TIEIPLRDTDEVIELDTDAFPDVDEVLNILKQEVAPMHVWILVALEYYRSKKYNDFVKVLNEANIHASVTYADSEKDQVKVLDMLANYYVKQASXXXXXXXXXXLFGQAAVHFTTADRIAMFDHNHLLSRAFFFLFEGDNWSQVDNQLNFVLNSSPNNVPALLGKSCIAFNKKEYRSALSFYRKALRNHPKCPASVRLGMGHCFFRLGNLEKAKFAFERALALDPECXXXXXXXXXXELNEKTLESVHHGVQKLSKAYMKDSNNPMVLNHLADHFFYAQQYKKVHTLALHAFHYTENELMRAQSCYQIARGFHKEENYDEAFQYYYQATQFASNNFVMPFYGLGQMYLCRKDIENAISSFEKVLKVYPNNYETLKILGSLYAQSDKEDRREQAKKMFQNVTEIEPDDLEAWIEYAQLL-KDDTASSLEAYTKAINLLRQE-NLDIPPEILNNVGVLHHMRKNYDETRKYYSEALERIEEVKTELSNNQDIKQDDVNYYIGLSVTINYNQGRLFEAEYQTDEADLLYKKILTQFPEYLDCHLRLGCMSRDRGQIYDASDWFKDALKVNQDHPDSWSLMGMLHLSKSEAGPAQKKFEFIVRQ--NPNDIFANVALGNIWLNTLFHPSRDKEKEKRHQERALTHYRNVLRVDPKNILAAHGIGAVLAHKGYINEARDVFAQVREATADFPDVWINIAHIYVEQKQYLAAIQMYENCIKKFNKQTNTELLLYLARAHFKCDQLKKCKQVLLKARHIAPWDPLIAYNLAFVQKRWALSVVPDEKSNFSSVLEGINDLNMAQCTFKYLSILKDQI--NIPQLPNEIKDCQDLLSQARYYLDRATKREQQERYMRQKQVEERE 2576
            +IEIPLRDTDEVIELD D  P+ DEV++ILKQE   +H+WI +ALEYY+  K  DFVK+L  A I  ++ Y D EKDQ+  LD LA YYV+QA KEK K+ K++L  Q+ + +T AD+I M+D NHLL RA F L EGD   Q D Q +FVLN S NN+PALLGK+CI+FNKK+YR AL++Y+KALR +P CPA VRLGMGHCF +L  LEKA+ AF RAL L+ +CVGALVGLAVLELN K  +S+ +GVQ LS+AY  D +NPMVLNHLA+HFF+ + Y KV  LALHAFH TE E M+A+SCYQ+AR FH +E+YD+AFQYYYQATQFAS+ FV+PF+GLGQMY+ R+D ENA   FEKVLK YPNNYET+KILGSLYA SD +++R+ AK   + VTE  PDD+EAWIE AQ+L + D   +L AY  A  +L+++   D+PPEILNN+G LH    N  E +KY+  +LER    K E        + D +YY  +SVT +YN  RL+EA  +  EA+ LYK IL + P Y+DC+LRLG M+RD+G  Y+ASDWFK+AL++NQDHPD+WSL+G LHL+K E GP QKKFE I++Q    ND ++ +ALGN+WL TL  P+RD+EKEKRHQ+RAL  Y+ VLR D KN+ AA+GIGAVLAHKGY  EARDVFAQVREATAD  DVW+N+AHIYVEQKQY++A+QMYENC+KKF K  NTE+LLYLARA FKC +L++CKQ+LL+ARH+AP D ++ +N+A V +R A  V+ DEKSN  +VL  + +L +A   F YLS   D++  ++    +E + C DLLSQA+Y++ RA K++++E+ +R KQ +ERE
Sbjct:    5 SIEIPLRDTDEVIELDFDQLPEGDEVISILKQEHTQLHIWIALALEYYKQGKTEDFVKLLEAARIDGNLDYRDHEKDQMTCLDTLAAYYVQQARKEKNKDAKKDLINQSTLLYTMADKIIMYDQNHLLGRACFCLLEGDKMDQADAQFHFVLNQSTNNIPALLGKACISFNKKDYRGALAYYKKALRTNPGCPAEVRLGMGHCFVKLNKLEKARLAFGRALELNSKCVGALVGLAVLELNNKEADSIKNGVQLLSRAYTIDPSNPMVLNHLANHFFFKKDYSKVQHLALHAFHNTEVEAMQAESCYQLARSFHVQEDYDQAFQYYYQATQFASSTFVLPFFGLGQMYVYRRDKENAAQCFEKVLKAYPNNYETMKILGSLYATSDDQEKRDIAKGHLKKVTEQYPDDVEAWIELAQILEQTDIQGALSAYGTATRILQEKVQADVPPEILNNLGALHFRLGNLGEAKKYFLASLER---AKAE-------GEHDEHYYNAISVTTSYNLARLYEAMCEFHEAEKLYKNILREHPNYVDCYLRLGAMARDKGNFYEASDWFKEALQINQDHPDAWSLIGNLHLAKQEWGPGQKKFERILKQPSTQNDTYSMLALGNVWLQTLHQPTRDREKEKRHQDRALAIYKQVLRNDSKNLYAANGIGAVLAHKGYYREARDVFAQVREATADISDVWLNLAHIYVEQKQYISAVQMYENCLKKFYKYQNTEVLLYLARALFKCGKLQECKQMLLRARHVAPNDTVLMFNIALVLQRLATLVLKDEKSNLKAVLSAVKELELAHRYFSYLSKAGDKMRFDLALASSEARQCSDLLSQAQYHVARARKQDEEEKELRAKQDQERE 850          
BLAST of RNA polymerase-associated protein CTR9 homolog vs. Ensembl Cavefish
Match: ctr9 (CTR9 homolog, Paf1/RNA polymerase II complex component [Source:NCBI gene;Acc:103042616])

HSP 1 Score: 983.4 bits (2541), Expect = 0.000e+0
Identity = 496/854 (58.08%), Postives = 633/854 (74.12%), Query Frame = 3
Query:   27 TIEIPLRDTDEVIELDTDAFPDVDEVLNILKQEVAPMHVWILVALEYYRSKKYNDFVKVLNEANIHASVTYADSEKDQVKVLDMLANYYVKQASXXXXXXXXXXLFGQAAVHFTTADRIAMFDHNHLLSRAFFFLFEGDNWSQVDNQLNFVLNSSPNNVPALLGKSCIAFNKKEYRSALSFYRKALRNHPKCPASVRLGMGHCFFRLGNLEKAKFAFERALALDPECXXXXXXXXXXELNEKTLESVHHGVQKLSKAYMKDSNNPMVLNHLADHFFYAQQYKKVHTLALHAFHYTENELMRAQSCYQIARGFHKEENYDEAFQYYYQATQFASNNFVMPFYGLGQMYLCRKDIENAISSFEKVLKVYPNNYETLKILGSLYAQSDKEDRREQAKKMFQNVTEIEPDDLEAWIEYAQLL-KDDTASSLEAYTKAINLLRQE-NLDIPPEILNNVGVLHHMRKNYDETRKYYSEALERIEEVKTELSNNQDIKQDDVNYYIGLSVTINYNQGRLFEAEYQTDEADLLYKKILTQFPEYLDCHLRLGCMSRDRGQIYDASDWFKDALKVNQDHPDSWSLMGMLHLSKSEAGPAQKKFEFIVRQ--NPNDIFANVALGNIWLNTLFHPSRDKEKEKRHQERALTHYRNVLRVDPKNILAAHGIGAVLAHKGYINEARDVFAQVREATADFPDVWINIAHIYVEQKQYLAAIQMYENCIKKFNKQTNTELLLYLARAHFKCDQLKKCKQVLLKARHIAPWDPLIAYNLAFVQKRWALSVVPDEKSNFSSVLEGINDLNMAQCTFKYLSILKDQINIPQLPNEIKDCQDLLSQARYYLDRATKREQQERYMRQKQVEERE 2576
            +IEIPLRDTDEVIELD D  P+ DEV++ILKQE   +H+WI +ALEYY+  K  DFVK+L  A I  ++ Y D EKDQ+  LD LA YYV+QA KEK K+ K++L  Q+ + +T AD+I M+D NHLL RA F L EGD   Q D Q +FVLN S NN+PALLGK+CI+FNKK+YR AL++Y+KALR +P CPA VRLGMGHCF +L  LEKA+ AF RAL L+ +CVGALVGLAVLELN K  +S+ +GVQ LS+AY  D +NPMVLNHLA+HFF+ + Y KV  LALHAFH TE E M+A+SCYQ+AR FH +E+YD+AFQYYYQATQFAS+ FV+PF+GLGQMY+ R+D ENA   FEKVLK YPNNYET+KILGSLYA SD +++R+ AK   + VTE  PDD+EAWIE AQ+L + D   +L AY  A  +L+++   D+PPEILNN+G LH    N  E +KY+  +LER    K E        + D +YY  +SVT +YN  RL+EA  +  EA+ LYK IL + P Y+DC+LRLG M+RD+G  Y+ASDWFK+AL++NQDHPD+WSL+G LHL+K E GP QKKFE I++Q    ND ++ +ALGN+WL TL  P+RD+EKEKRHQ+RAL  Y+ VLR D KN+ AA+GIGAVLAHKGY  EARDVFAQVREATAD  DVW+N+AHIYVEQKQY++A+QMYENC+KKF K  NTE+LLYLARA FKC +L++CKQ+LL+ARH+AP D ++ +N+A V +R A  V+ DEKSN  +VL  + +L +A                       + C DLLSQA+Y++ RA K++++E+ +R KQ +ERE
Sbjct:    5 SIEIPLRDTDEVIELDFDQLPEGDEVISILKQEHTQLHIWIALALEYYKQGKTEDFVKLLEAARIDGNLDYRDHEKDQMTCLDTLAAYYVQQARKEKNKDAKKDLINQSTLLYTMADKIIMYDQNHLLGRACFCLLEGDKMDQADAQFHFVLNQSTNNIPALLGKACISFNKKDYRGALAYYKKALRTNPGCPAEVRLGMGHCFVKLNKLEKARLAFGRALELNSKCVGALVGLAVLELNNKEADSIKNGVQLLSRAYTIDPSNPMVLNHLANHFFFKKDYSKVQHLALHAFHNTEVEAMQAESCYQLARSFHVQEDYDQAFQYYYQATQFASSTFVLPFFGLGQMYVYRRDKENAAQCFEKVLKAYPNNYETMKILGSLYATSDDQEKRDIAKGHLKKVTEQYPDDVEAWIELAQILEQTDIQGALSAYGTATRILQEKVQADVPPEILNNLGALHFRLGNLGEAKKYFLASLER---AKAE-------GEHDEHYYNAISVTTSYNLARLYEAMCEFHEAEKLYKNILREHPNYVDCYLRLGAMARDKGNFYEASDWFKEALQINQDHPDAWSLIGNLHLAKQEWGPGQKKFERILKQPSTQNDTYSMLALGNVWLQTLHQPTRDREKEKRHQDRALAIYKQVLRNDSKNLYAANGIGAVLAHKGYYREARDVFAQVREATADISDVWLNLAHIYVEQKQYISAVQMYENCLKKFYKYQNTEVLLYLARALFKCGKLQECKQMLLRARHVAPNDTVLMFNIALVLQRLATLVLKDEKSNLKAVLSAVKELELAH----------------------RQCSDLLSQAQYHVARARKQDEEEKELRAKQDQERE 826          
BLAST of RNA polymerase-associated protein CTR9 homolog vs. Ensembl Cavefish
Match: ogt.1 (O-linked N-acetylglucosamine (GlcNAc) transferase [Source:NCBI gene;Acc:103028765])

HSP 1 Score: 63.5438 bits (153), Expect = 1.548e-9
Identity = 81/345 (23.48%), Postives = 140/345 (40.58%), Query Frame = 3
Query: 1542 NQGRLFEAEYQTDEADLLYKKILTQFPEYLDCHLRLGCMSRDRGQIYDASDWFKDALKVN--------QDHPD---SWSLMGMLHLSKSEAGPAQKKFEFIVRQNPNDIFANVALGNIWLNTLFHPSRDKEKEKRHQERALTHYRNVLRVDPKNILAAHGIGAVLAHKGYINEARDVFAQVREATADFPDVWINIAHIYVEQKQYLAAIQMYENCIKKFNKQTNTELLLYLARAHFKCDQLKKCKQVLLKARHIAPWDPLIAYNLAFVQK------------RWALSVVP---DEKSNFSSVLEGINDLNMA-QCTFKYL--------------SILKDQINIPQ 2453
            N G +++   Q  EA   Y+  L   P+++D ++ L       G +  A   +  AL+ N        +  P+   +WS +G +  ++ E   A   FE  V  +PN + A + LGN+             KE R  +RA+  Y   L + P + +    +  V   +G I+ A D + +  E    FPD + N+A+   E+     A + Y   ++     T+ + L  LA    +   +++  Q+  KA  + P       NLA V +            + A+ + P   D  SN  + L+ + D+  A QC  + +              SI KD  NIP+
Sbjct:   84 NLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDMEGAVQAYVSALQYNPACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVL------------KEARIFDRAVAGYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANALKEKGNVSEAEECYNTALRLC--PTHADSLNNLANIKREQGNIEEAVQLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPE 414          

HSP 2 Score: 62.003 bits (149), Expect = 4.467e-9
Identity = 87/383 (22.72%), Postives = 151/383 (39.43%), Query Frame = 3
Query:  978 YDEAFQY----YYQATQFASNNFVMPFYGLGQMYLCRKDIENAISSFEKVLKVYPNNYETLKILGSLYAQSDKEDRREQAKKMFQNVTEIEPDDLE-----AWIEYAQLLKDDTASSLEAYTKAINLLRQENLDIPPEILNNVGVLHHMRKNYDETRKYYSEALERIEEVKTELSNNQDIKQDDVNYYIGLSVTINYNQGRLFEAEYQTDEADLLYKKILTQFPEYLDCHLRLGCMSRDRGQIYDASDWFKDALKVNQDHPDSWSLMGMLHLSKSEAGPAQKKFEFIVRQNPNDIFANVALGNIWLNTLFHPSRDKEKEKRHQERALTHYRNVLRVDPKNILAAHGIGAVLAHKGYINEARDVFAQVREATADFPDVWINIAH 2099
            Y  A QY    Y +A +    NF + +  LG ++  + +I  AI  FEK + + PN  +    LG++  ++   DR   A   +     + P+        A + Y Q L D    +++ Y +AI L  Q +    P+   N+      + N  E  + Y+ AL         L+N  +IK++               QG +       +EA  LY+K L  FPE+   H  L  + + +G++ +A   +K+A++++    D++S MG                                      NTL        KE +  + AL  Y   ++++P    A   + ++    G I EA   +    +   DFPD + N+AH
Sbjct:  136 YVSALQYNPACYLKAIE-TQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDR---AVAGYLRALSLSPNHAVVHGNLACVYYEQGLID---LAIDTYRRAIEL--QPHF---PDAYCNLANALKEKGNVSEAEECYNTALRLCPTHADSLNNLANIKRE---------------QGNI-------EEAVQLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMG--------------------------------------NTL--------KEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAH 438          
BLAST of RNA polymerase-associated protein CTR9 homolog vs. Ensembl Cavefish
Match: ogt.1 (O-linked N-acetylglucosamine (GlcNAc) transferase [Source:NCBI gene;Acc:103028765])

HSP 1 Score: 62.003 bits (149), Expect = 3.876e-9
Identity = 88/394 (22.34%), Postives = 155/394 (39.34%), Query Frame = 3
Query: 1362 EILNNVGVLHHMRKNYDETRKYYSEALERIEEVKTELSNNQDIKQDDVNYYIGLSVTINYNQGRLFEAEYQTDEADLLYKKILTQFPEYLDCHLRLGCMSRDRGQIYDASDWFKDALKVNQDHPDSWSLMGMLHLSKSEAGPAQKKFEFIVRQNPNDIFANVALGNIWLNTLFHPSRDKEKEKRHQERALTHYRNVLRVDPKNILAAHGIGAVLAHKGYINEARDVFAQVREATADFPDVWINIAHIYVEQKQYLAAIQMYENCIKKFNKQTNTELLLYLARAHFKCDQLKKCKQVLLKARHIAPWDPLIAYNLAFVQK------------RWALSVVP---DEKSNFSSVLEGINDLNMA-QCTFKYL--------------SILKDQINIPQ 2453
            E  +N+G ++  R    E  ++Y  AL               +K D ++ YI L+  +         A    + A   Y   L   P+       LG + +  G++ +A   +  A++   +   +WS +G +  ++ E   A   FE  V  +PN + A + LGN+             KE R  +RA+  Y   L + P + +    +  V   +G I+ A D + +  E    FPD + N+A+   E+     A + Y   ++     T+ + L  LA    +   +++  Q+  KA  + P       NLA V +            + A+ + P   D  SN  + L+ + D+  A QC  + +              SI KD  NIP+
Sbjct:   80 EAYSNLGNVYKERGQLQEAIEHYRHALR--------------LKPDFIDGYINLAAAL--------VAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVL------------KEARIFDRAVAGYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANALKEKGNVSEAEECYNTALRLC--PTHADSLNNLANIKREQGNIEEAVQLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPE 437          

HSP 2 Score: 61.6178 bits (148), Expect = 5.581e-9
Identity = 85/378 (22.49%), Postives = 150/378 (39.68%), Query Frame = 3
Query:  981 DEAFQYYYQATQFASNNFVMPFYGLGQMYLCRKDIENAISSFEKVLKVYPNNYETLKILGSLYAQSDKEDRREQAKKMFQNVTEIEPDDLE-----AWIEYAQLLKDDTASSLEAYTKAINLLRQENLDIPPEILNNVGVLHHMRKNYDETRKYYSEALERIEEVKTELSNNQDIKQDDVNYYIGLSVTINYNQGRLFEAEYQTDEADLLYKKILTQFPEYLDCHLRLGCMSRDRGQIYDASDWFKDALKVNQDHPDSWSLMGMLHLSKSEAGPAQKKFEFIVRQNPNDIFANVALGNIWLNTLFHPSRDKEKEKRHQERALTHYRNVLRVDPKNILAAHGIGAVLAHKGYINEARDVFAQVREATADFPDVWINIAH 2099
            +EA   Y +A +    NF + +  LG ++  + +I  AI  FEK + + PN  +    LG++  ++   DR   A   +     + P+        A + Y Q L D    +++ Y +AI L  Q +    P+   N+      + N  E  + Y+ AL         L+N  +IK++               QG +       +EA  LY+K L  FPE+   H  L  + + +G++ +A   +K+A++++    D++S MG                                      NTL        KE +  + AL  Y   ++++P    A   + ++    G I EA   +    +   DFPD + N+AH
Sbjct:  164 EEAKACYLKAIE-TQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDR---AVAGYLRALSLSPNHAVVHGNLACVYYEQGLID---LAIDTYRRAIEL--QPHF---PDAYCNLANALKEKGNVSEAEECYNTALRLCPTHADSLNNLANIKRE---------------QGNI-------EEAVQLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMG--------------------------------------NTL--------KEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAH 461          

HSP 3 Score: 59.6918 bits (143), Expect = 2.094e-8
Identity = 82/417 (19.66%), Postives = 164/417 (39.33%), Query Frame = 3
Query:  924 MRAQSCYQIARGFHKEENYDEAFQYYYQATQFASNNFVMPFYGLGQMYLCRKDIENAISSFEKVLKVYPNNYETLKILGSLYAQSDKEDRREQAKKMFQNVTEIEPDDLEAWIEYAQLL--KDDTASSLEAYTKAINLLRQENLDIPPEILN---NVGVLHHMRKNYDETRKYYSEALERIEEVKTELSNNQDIKQDDVNYYIGLSVTINYNQGRLFEAEYQTDEADLLYKKILTQFPEYLDCHLRLGCMSRDRGQIYDASDWFKDALKVNQDHPDSWSLMGMLHLSKSEAGPAQKKFEFIVRQNPNDIFANVALGNIWLNTLFHPSRDKEKEKRHQERALTHYRNVLRVDPKNILAAHGIGAVLAHKGYINEARDVFAQVREATADFPDVWINIAHIYVEQKQYLAAIQMYENCIK 2159
            M A++   +   + +     EA ++Y  A +   + F+  +  L    +   D+E A+ ++   L+  P+ Y     LG+L        R E+AK  +    E +P+   AW     +   + +   ++  + KA+ L         P  L+   N+G +    + +D     Y  AL         LS N  +   ++         + Y QG +       D A   Y++ +   P + D +  L    +++G + +A + +  AL++   H DS + +  +   K E G  ++  +    +   ++F   A  +  L ++       +++ + QE AL HY+  +R+ P    A   +G  L     +  A   + +  +    F D   N+A I+ +      AI  Y   +K
Sbjct:   77 MLAEAYSNLGNVYKERGQLQEAIEHYRHALRLKPD-FIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLL---KALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTL--------DPNFLDAYINLGNVLKEARIFDRAVAGYLRAL--------SLSPNHAVVHGNL-------ACVYYEQGLI-------DLAIDTYRRAIELQPHFPDAYCNLANALKEKGNVSEAEECYNTALRLCPTHADSLNNLANI---KREQGNIEEAVQLY--RKALEVFPEFAAAHSNLASVL------QQQGKLQE-ALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALK 447          

HSP 4 Score: 57.3806 bits (137), Expect = 1.112e-7
Identity = 88/431 (20.42%), Postives = 169/431 (39.21%), Query Frame = 3
Query:  492 PNNVPALLGKSCIAFNKKEYRSALSFYRKALRNHPKCPASVRLGMGHCFFRLGNLEKAKFAFERALALDPECXXXXXXXXXXELNEKTLESVHHGVQKLSKAYMKDSNNPMVLNHLADHFFYAQQYKKVHTLALHAFHYTENELMRAQSCYQIARGFHKEENYDEAFQYYYQATQFASNNFVMPFYGLGQMYLCRKDIENAISSFEKVLKVYPNNYETLKILGSLYAQSDKEDRREQAKKMFQNVTEIEPDDLEAWIEYAQLLKD--DTASSLEAYTKAINLLRQENLDIPPEILNNVGVLHHMRKNYDETRKYYSEALERIEEVKTELSNNQDIKQDD-------VNYYIGLSVTINY-----NQGRLFEAEYQTDEADLLYKKILTQFPEYLDCHLRLGCMSRDRGQIYDASDWFKDALKVNQDHPDSW 1742
            P+N   LL  S I F  +    +  F   A++ +P   A     +G+ +   G L++A   +  AL L P+ +   + LA   +    +E     VQ    A   + +   V + L +      + ++     L A     N    A +   +   F+ +     A  ++ +A      NF+  +  LG +    +  + A++ + + L + PN+      L  +Y +    D    A   ++   E++P   +A+   A  LK+  + + + E Y  A+ L          + LNN+  +   + N +E  + Y +ALE   E     SN   + Q         ++Y   + ++  +     N G   +       A   Y + +   P + D H  L  + +D G I +A   ++ ALK+  D PD++
Sbjct:   42 PDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPML-AEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDMEG---AVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPN---FAVAWSNLGCVFNAQGEIWLAIHHFEKAVTL-DPNFLDAYINLGNVLKEARIFDRAVAGYLRALSLSPNHAVVHGNLACVYYEQGLIDL---AIDTYRRAIELQPHFPDAYCNLANALKEKGNVSEAEECYNTALRLCPTH-----ADSLNNLANIKREQGNIEEAVQLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAY 456          
BLAST of RNA polymerase-associated protein CTR9 homolog vs. Ensembl Sea Lamprey
Match: ctr9 (CTR9 homolog, Paf1/RNA polymerase II complex component [Source:ZFIN;Acc:ZDB-GENE-030131-3782])

HSP 1 Score: 897.886 bits (2319), Expect = 0.000e+0
Identity = 459/809 (56.74%), Postives = 589/809 (72.81%), Query Frame = 3
Query:   27 TIEIPLRDTDEVIELDTDAFPDVDEVLNILKQEVAPMHVWILVALEYYRSKKYNDFVKVLNEANIHASVTYADSEKDQVKVLDMLANYYVKQASXXXXXXXXXXLFGQAAVHFTTADRIAMFDHNHLLSRAFFFLFEGDNWSQVDNQLNFVLNSSPNNVPALLGKSCIAFNKKEYRSALSFYRKALRNHPKCPASVRLGMGHCFFRLGNLEKAKFAFERALALDPECXXXXXXXXXXELNEKTLESVHHGVQKLSKAYMKDSNNPMVLNHLADHFFYAQQYKKVHTLALHAFHYTENELMRAQSCYQIARGFHKEENYDEAFQYYYQATQFASNNFVMPFYGLGQMYLCRKDIENAISSFEKVLKVYPNNYETLKILGSLYAQSDKEDRREQAKKMFQNVTEIEPDDLEAWIEYAQLL-KDDTASSLEAYTKAINLLRQE-NLDIPPEILNNVGVLHHMRKNYDETRKYYSEALERIEEVKTELSNNQDIKQDDVNYYIGLSVTINYNQGRLFEAEYQTDEADLLYKKILTQFPEYLDCHLRLGCMSRDRGQIYDASDWFKDALKVNQDHPDSWSLMGMLHLSKSEAGPAQKKFEFIVRQ--NPNDIFANVALGNIWLNTLFHPSRDKEKEKRHQERALTHYRNVLRVDPKNILAAHGIGAVLAHKGYINEARDVFAQVREATADFPDVWINIAHIYVEQKQYLAAIQMYENCIKKFNKQTNTELLLYLARAHFKCDQLKKCKQVLLKARHIAPWDPLIAYNLAFVQKRWALSVVPDEKSNFSSVLEGINDLNMAQCTFKYLSILKDQI 2441
            +IEIPLRDTDEVIELD D  P+ DEV++ILKQE   +H+WI +ALEYYR  K  DFVK+L  A +  ++ Y D EKDQ+  LD LA YYV+QA +EK K+ K+EL  QA + +T AD+I M+D NHLL RA + L EG+   Q D Q +FVLN SP+N+PALLGK+CIAFNKK++R AL++Y+KALR +P CPA VRLGMGHCF +L   EKA+ AF RAL L+P+CVGALVGLA+LELN+K  +S+ +GVQ LSKAY  DS+NPMVLNHLA+HFF+ +   ++  +  H  +   +        +  A   H + +YD+AFQYYYQATQFAS NF++P++GLGQMY+ R D +NA   FEKVLK YPNNYET+KILGSLYA S+ +++RE AK   + VTE  PDD+EAWIE AQ+L + D   +L AY  A  +L+++   D+PPEILNNV  LH    N  E +KYY+ +L+R    K E        Q D +YY  +SVT  YN  RL E+      A+  YK IL + P Y+DC+LRLGCM+RD+G  Y+ASDWFK+AL++NQDHPD+WSL+G LHL+K E  P QKKFE I++Q    ND ++ +ALGN+WL TL  P+RDKEKEKRHQ+RAL  Y+ VLR DPKN+ AA+GIGAVLAHKG I EARDVFAQVREATAD  DVW+N+AHIYVEQKQ+++A   YENC+KKF K  NTE+LL+LARA+FKC +L +CKQ LLKARH+AP D ++ +N+A V +R A SV+ DEKSN  +VL  + +L +AQ  F YLS   D++
Sbjct:    5 SIEIPLRDTDEVIELDFDQLPEGDEVISILKQEHTQLHIWIALALEYYRQGKPEDFVKLLEAARVDGTLDYRDHEKDQMTCLDTLAAYYVQQARREKNKDVKKELLTQATLLYTMADKIIMYDQNHLLGRACYCLLEGEKMEQADAQFHFVLNQSPSNIPALLGKACIAFNKKDFRGALAYYKKALRTNPNCPAEVRLGMGHCFVKLSKPEKAQLAFMRALELNPKCVGALVGLAILELNKKEADSIKNGVQLLSKAYTIDSSNPMVLNHLANHFFFKKDMVRLSEINKHNNNNQLSLATDVSGAFATALPLHVQGDYDQAFQYYYQATQFASPNFLLPYFGLGQMYIYRGDRDNAAGCFEKVLKAYPNNYETMKILGSLYATSNDQEKRETAKGHLKKVTEQYPDDVEAWIELAQILEQSDIQGALSAYGTATRILQEKVQADVPPEILNNVAALHFRLGNLGEAKKYYAASLDR---AKAE-------AQHDEHYYNAISVTSTYNLARLHESTCNYHGAEQHYKNILREHPNYVDCYLRLGCMARDKGNFYEASDWFKEALQINQDHPDAWSLIGNLHLAKQEWQPGQKKFERILKQPATQNDAYSMLALGNVWLQTLHQPTRDKEKEKRHQDRALAIYKQVLRNDPKNLYAANGIGAVLAHKGCIREARDVFAQVREATADVCDVWLNLAHIYVEQKQFISAYPQYENCLKKFFKCQNTEVLLFLARAYFKCGKLAECKQTLLKARHVAPSDSVLMFNVALVLQRLATSVLRDEKSNLKAVLSAVKELELAQRYFSYLSKSGDRM 803          
BLAST of RNA polymerase-associated protein CTR9 homolog vs. Ensembl Sea Lamprey
Match: ogt.1 (O-linked N-acetylglucosamine (GlcNAc) transferase, tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GENE-030131-9631])

HSP 1 Score: 63.929 bits (154), Expect = 2.116e-10
Identity = 87/375 (23.20%), Postives = 149/375 (39.73%), Query Frame = 3
Query:  981 DEAFQYYYQATQFASNNFVMPFYGLGQMYLCRKDIENAISSFEKVLKVYPNNYETLKILGSLYAQSDKEDRREQA--KKMFQNVTEIEPDDLEAWIEYAQLLKDDTASSLEAYTKAINLLRQENLDIPPEILNNVGVLHHMRKNYDETRKYYSEALERIEEVKTELSNNQDIKQDDVNYYIGLSVTINYNQGRLFEAEYQTDEADLLYKKILTQFPEYLDCHLRLGCMSRDRGQIYDASDWFKDALKVNQDHPDSWSLMGMLHLSKSEAGPAQKKFEFIVRQNPNDIFANVALGNIWLNTLFHPSRDKEKEKRHQERALTHYRNVLRVDPKNILAAHGIGAVLAHKGYINEARDVFAQVREATADFPDVWINIAH 2099
            +EA   Y +A +    NF + +  LG ++  + +I  AI  FEK + + PN  +    LG++  ++   DR   A  + +  N          A + Y Q L D    +++ Y +AI L  Q N    P+   N+      + N  E  + Y+ AL         L+N  +IK++               QG +       +EA  LY+K L  FPE+   H  L  + + +G++ DA   +K+A++++    D++S MG                                      NTL        KE +  + AL  Y   ++++P    A   + ++    G I EA   +    +   DFPD + N+AH
Sbjct:  175 EEAKACYLKAIE-TQPNFSVAWSNLGCVFNSQGEIWLAIHHFEKAVSLDPNFLDAYINLGNVLKEARIFDRAVAAYLRALSLNHNHAVVHGNLACVYYEQGLID---LAIDTYRRAIEL--QPNF---PDAYCNLANALKEKGNIAEAEECYNTALHLCPNHADSLNNLANIKRE---------------QGNI-------EEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQDALLHYKEAIRISPTFADAYSNMG--------------------------------------NTL--------KEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAISSYRTALKLKPDFPDAYCNLAH 472          

HSP 2 Score: 57.3806 bits (137), Expect = 2.006e-8
Identity = 94/431 (21.81%), Postives = 174/431 (40.37%), Query Frame = 3
Query:  492 PNNVPALLGKSCIAFNKKEYRSALSFYRKALRNHPKCPASVRLGMGHCFFRLGNLEKAKFAFERALALDPECXXXXXXXXXXELNEKTLESVHHGVQKLSKAYMKDSNNPMVLNHLADHFFYAQQYKKVHTLALHAFHYTENELMRAQSCYQIARGFHKEENYDEAFQYYYQATQFASNNFVMPFYGLGQMYLCRKDIENAISSFEKVLKVYPNNYETLKILGSLYAQSDKEDRREQAKKMFQNVTEIEPDDLEAWIEYAQLLKD--DTASSLEAYTKAINLLRQENLDIPPEILNNVGVLHHMRKNYDETRKYYSEALERIEEVKTELSN------NQDIKQDDVNYY---IGLSVTIN---YNQGRLFEAEYQTDEADLLYKKILTQFPEYLDCHLRLGCMSRDRGQIYDASDWFKDALKVNQDHPDSW 1742
            P+N   LL  S I F  +    +  F   A++ +P   A     +G+ F   G L +A   +  A+ L P+ +   + LA   +    LE     VQ    A   + +   V + L +      + ++     L A   T+     A S   +   F+ +     A  ++ +A      NF+  +  LG +    +  + A++++ + L +   N+    + G+L     ++   + A   ++   E++P+  +A+   A  LK+  + A + E Y  A++L          + LNN+  +   + N +E  + Y +ALE   E     SN       Q   QD + +Y   I +S T      N G   +       A   Y + +   P + D H  L  + +D G I +A   ++ ALK+  D PD++
Sbjct:   53 PDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPML-AEAYSNLGNVFKERGQLAEALEHYRHAVRLKPDFIDGYINLAAALVAAGDLEG---AVQAYVTALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIE-TQPNFSVAWS--NLGCVFNSQGEIWLAIHHFEKAVSL-DPNFLDAYINLGNVLKEARIFDRAVAAYLRALSL---NHNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPNFPDAYCNLANALKEKGNIAEAEECYNTALHLCPNH-----ADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQDALLHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAISSYRTALKLKPDFPDAY 467          

HSP 3 Score: 53.9138 bits (128), Expect = 2.507e-7
Identity = 78/352 (22.16%), Postives = 140/352 (39.77%), Query Frame = 3
Query: 1488 IKQDDVNYYIGLSVTINYNQGRLFEAEYQTDEADLLYKKILTQFPEYLDCHLRLGCMSRDRGQIYDASDWFKDALKVNQDHPDSWSLMGMLHLSKSEAGPAQKKFEFIVRQNPNDIFANVALGNIWLNTLFHPSRDKEKEKRHQERALTHYRNVLRVDPKNILAAHGIGAVLAHKGYINEARDVFAQVREATADFPDVWINIAHIYVEQKQYLAAIQMYENCIKKFNKQTNTELLLYLARAHFKCDQLKKCKQVLLKARHIAPWDPLIAYNLAFVQK------------RWALSVVP---DEKSNFSSVLEGINDLNMA-QCTFKYL--------------SILKDQINIPQ 2453
            +K D ++ YI L+  +         A    + A   Y   L   P+       LG + +  G++ +A   +  A++   +   +WS +G +  S+ E   A   FE  V  +PN + A + LGN+             KE R  +RA+  Y   L ++  + +    +  V   +G I+ A D + +  E   +FPD + N+A+   E+     A + Y   +       ++  L  LA    +   +++  ++  KA  + P       NLA V +            + A+ + P   D  SN  + L+ + D+  A QC  + +              SI KD  NIP+
Sbjct:  119 LKPDFIDGYINLAAAL--------VAAGDLEGAVQAYVTALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFSVAWSNLGCVFNSQGEIWLAIHHFEKAVSLDPNFLDAYINLGNVL------------KEARIFDRAVAAYLRALSLNHNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPNFPDAYCNLANALKEKGNIAEAEECYNTALHLCPNHADS--LNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQDALLHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPE 448          
BLAST of RNA polymerase-associated protein CTR9 homolog vs. Ensembl Yeast
Match: CTR9 (Component of the Paf1p complex involved in transcription elongation; binds to and modulates the activity of RNA polymerases I and II; required for expression of a subset of genes, including cyclin genes; involved in SER3 repression by helping to maintain SRG1 transcription-dependent nucleosome occupancy; contains TPR repeats [Source:SGD;Acc:S000005505])

HSP 1 Score: 154.836 bits (390), Expect = 1.305e-38
Identity = 181/789 (22.94%), Postives = 363/789 (46.01%), Query Frame = 3
Query:   24 TTIEIPLRDTDEV--IELDTDAFPDVDEVLNILKQEVAPMHVWILVALEYYRSKKYNDFVKVLNEANIHASVTYADSEKDQVKVLDMLANYYVKQASXXXXXXXXXXLFGQAAVHFTTADRIAMFDHNHLLSRAFFFLFEGDNWSQVDNQLNFVLN----------SSPNNVPALLGKSCIAFNKKEYRSALSFYRKALRNHPKCPASVRLGMGHCFFRLGNLEKAKFAFERALALDPECXXXXXXXXXXEL--------NEKTL-ESVHHGVQKLSKAYMKDSNNPMVLNHLADHFFYAQQYKKVHTLALHAFHYTE---NELMRAQSCYQIARGFHKEENYDEAFQYYYQATQFASNNFVMPFYGLGQMYLCRKDIENAISSFEKVLKVYPNNYETLKILGSLYAQS--DKEDRREQAKKMFQNVTEIEPDDLE-----------------AWIEYAQL--LKDDTASSLEAYTKAINLLRQENLDIPPEILNNVGVLHHMRKNYDETRKYYSEALERIEEVKTELSNNQDIKQDDVNYYIGLSVTINYNQGRLFEAEYQTDEADLLYKKILTQFPEYLDCHLRLGCMSRDRGQIYDA--SDWFKDALKVNQDHPD-----SWSLMGMLHLSKSEAGPAQKKFEFIVRQNPNDIFANVALGNIWLNTL-----FHPSRDKEKEKRHQERALTHYRNVLRVDPKNILAAHGIGAVLAHKGYINEARDVFAQVREATADFPDVWINIAHIYVEQKQYLAAIQMYENCIKKF-NKQTNTELLLYLARAHF 2216
            T+++IPL+ ++E+  I+L+TD   D  ++  +L +E +    W+ +AL Y    K N+ +K++      A   + +SE+  +      A+  + +      + K+ EL  QA ++   A         ++L+    +   G     ++    FV +           S  N   LL ++ + + KK Y ++L  +++ L  +P      R+G+G CF++L + + A  +++RAL L+P+   A + + + E         N+KT  E+    +  L+  + ++ +NP++L  L  ++++   Y+ V  +  H          +++ ++S +   R  +   +Y ++F  + ++ +   +N +    GLGQ  +    +E +I +FE + K   +  E   ILG LYA    D +  +  + K   N+ E     LE                 A++  +QL  L++   +SL+  +KA+  +     +IP E+LNN+   H +  ++ +    + +A  ++ +           K + VN      +T+ YN  R  E     ++++ +Y ++ +  P Y+   +R   +   + +I D+  S      L +N+   +      W L        +E      K E +V+ N +D +A ++L N+++            +++EK K    +A+  Y+ VL+VDP NI AA G+  + A    +  A ++  +VR+ + D  DV +N+AH Y+E ++Y  AI+ YE  +KKF N++T   +L  L RA +
Sbjct:   17 TSLDIPLKASEELVGIDLETDLPDDPTDLKTLLVEENSEKEHWLTIALAYCNHGKTNEGIKLIE----MALDVFQNSERASLHTFLTWAHLNLAKGQSLSVETKEHEL-TQAELNLKDAIGFDPTWIGNMLATVELYYQRGHYDKALETSDLFVKSIHAEDHRSGRQSKPNCLFLLLRAKLLYQKKNYMASLKIFQELLVINPVLQPDPRIGIGLCFWQLKDSKMAIKSWQRALQLNPKNTSASILVLLGEFRESFTNSTNDKTFKEAFTKALSDLNNIFSENQHNPVLLTLLQTYYYFKGDYQTVLDIYHHRILKMSPMIAKIVLSESSFWCGRAHYALGDYRKSFIMFQESLKKNEDNLLAKL-GLGQTQIKNNLLEESIITFENLYKTNESLQELNYILGMLYAGKAFDAKTAKNTSAKEQSNLNEKALKYLERYLKLTLATKNQLVISRAYLVISQLYELQNQYKTSLDYLSKALEEMEFIKKEIPLEVLNNLACYHFINGDFIKADDLFKQAKAKVSD-----------KDESVN------ITLEYNIARTNEKN-DCEKSESIYSQVTSLHPAYIAARIRNLYLKFAQSKIEDSDMSTEMNKLLDLNKSDLEIRSFYGWYLKNSKERKNNEKSTTHNK-ETLVKYNSHDAYALISLANLYVTIARDGKKSRNPKEQEKSKHSYLKAIQLYQKVLQVDPFNIFAAQGLAIIFAESKRLGPALEILRKVRD-SLDNEDVQLNLAHCYLEMREYGKAIENYELVLKKFDNEKTRPHILNLLGRAWY 779          
BLAST of RNA polymerase-associated protein CTR9 homolog vs. Ensembl Nematostella
Match: EDO34243 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPW8])

HSP 1 Score: 961.059 bits (2483), Expect = 0.000e+0
Identity = 477/861 (55.40%), Postives = 638/861 (74.10%), Query Frame = 3
Query:   18 VMTTIEIPLRDTDEVIELDTDAFPDVDEVLNILKQEVAPMHVWILVALEYYRSKKYNDFVKVLNEANIHASVTYADSEKDQVKVLDMLANYYVKQASXXXXXXXXXXLFGQAAVHFTTADRIAMFDHNHLLSRAFFFLFEGDNWSQVDNQLNFVLNSSPNNVPALLGKSCIAFNKKEYRSALSFYRKALRNHPKCPASVRLGMGHCFFRLGNLEKAKFAFERALALDPECXXXXXXXXXXELNEKTLESVHHGVQKLSKAYMKDSNNPMVLNHLADHFFYAQQYKKVHTLALHAFHYTENELMRAQSCYQIARGFHKEENYDEAFQYYYQATQFASNNFVMPFYGLGQMYLCRKDIENAISSFEKVLKVYPNNYETLKILGSLYAQSDKEDRREQAKKMFQNVTEIEPDDLEAWIEYAQLL-KDDTASSLEAYTKAINLLRQE-NLDIPPEILNNVGVLHHMRKNYDETRKYYSEALERIEEVKTELSNNQDIKQDDVNYYIGLSVTINYNQGRLFEAEYQTDEADLLYKKILTQFPEYLDCHLRLGCMSRDRGQIYDASDWFKDALKVNQDHPDSWSLMGMLHLSKSEAGPAQKKFEFIVRQ--NPNDIFANVALGNIWLNTLFHPSRDKEKEKRHQERALTHYRNVLRVDPKNILAAHGIGAVLAHKGYINEARDVFAQVREATADFPDVWINIAHIYVEQKQYLAAIQMYENCIKKFNKQTNTELLLYLARAHFKCDQLKKCKQVLLKARHIAPWDPLIAYNLAFVQKRWALSVVPDEKSNFSSVLEGINDLNMAQCTFKYLSILKDQI--NIPQLPNEIKDCQDLLSQARYYLDRATKREQQERYMRQKQVEERESI 2582
            + T+IEIPLRDTDEVIEL  D  PD +E+L+ILKQE   +++W  +AL+YY+  K  DF+++L  A   A+  Y DSEKDQ+  LD LA +YV+QA KEK KEKK+ELF QA   +T AD+I M+D NHLL RA+F L EGD   Q D Q NFVL  S NN+PALLGK+CI FNK++Y++AL+FY+KALR +P CP +VRLGMGHCF +L  L+KA+ AF+RAL L+P C GA+VGLA+LELN K  +S+  GVQ LSKAY  D++NPMVLNHLA+HFF+ + Y KV  LALHAFH TE E M+A+SCYQ+AR FH + ++D+AFQYYYQATQFAS NF++P +GLGQMY+ R+D+ NA   FEKVLK  P NYET+KILGSLY+ S    +RE A++  + VTE  PDD+EAWIE A +L + D  ++L+AY  A  LL+++   D+PPEILNNVG LH    N  E +++Y  +L+R          ++    +D +YY  +SVT  YN  RL EA  + D+A+ LYK IL + P Y+DC+LRLGCM+R+RGQIY+ASDWFK+AL++NQDHPD+WSL+G LHL+K E GP QKKFE I++Q    ND ++ +ALGN+WL TL  P+RDK KE+RHQ+RAL  Y+ VLR D +N+ AA+GIG +LAHKGYI EARDVF+QVREATAD PDVW+N+AHIYVEQKQY++AIQMYENC++KF K  + E++LYLARA+++  +LK CK+VLLKARH++P D ++ +N++ VQ++ A  ++  EKS+   VL  + +L  AQ  F +LS   D++  ++     E +   DLLSQA+Y++ RA K ++QE+ +R+KQ  E+E++
Sbjct:    1 MATSIEIPLRDTDEVIELQFDQLPDGEELLSILKQEDVRLNIWNTLALQYYKQGKTEDFIRILESARTDANRKYGDSEKDQMVCLDTLAAFYVQQARKEKNKEKKKELFTQATSLYTMADKIIMYDQNHLLGRAYFCLLEGDKMEQADAQFNFVLAQSGNNIPALLGKACIFFNKRDYKNALAFYKKALRTNPNCPGAVRLGMGHCFVKLNKLDKARLAFKRALELEPRCTGAMVGLAILELNSKKPDSIKIGVQLLSKAYTIDNSNPMVLNHLANHFFFKKDYSKVQHLALHAFHGTEVEAMQAESCYQLARAFHVQGDFDQAFQYYYQATQFASPNFILPHFGLGQMYIARRDLNNASQCFEKVLKAMPGNYETMKILGSLYSPSSDLVKRELARQHLKKVTEQHPDDVEAWIELAGILEQSDVQAALQAYGTASRLLKEKVEADVPPEILNNVGALHFRLGNLKEAKRFYESSLDR----------SKQESHNDESYYNAISVTTTYNLARLHEAMCEIDKAEQLYKNILREHPNYVDCYLRLGCMARNRGQIYEASDWFKEALQINQDHPDAWSLIGNLHLAKQEWGPGQKKFERILKQPSTANDAYSLLALGNVWLQTLHAPTRDKAKERRHQDRALAMYKQVLRNDSRNLYAANGIGCILAHKGYIREARDVFSQVREATADVPDVWLNLAHIYVEQKQYVSAIQMYENCLRKFFKHHSVEVMLYLARAYYRAGKLKDCKRVLLKARHVSPNDTILLFNVSLVQQKLATGILRAEKSSLKVVLGAVGELEQAQRNFTWLSRHGDRMKFDLAWAAYESRHTSDLLSQAQYHVSRARKLDEQEQELRRKQEAEKEAL 851          
BLAST of RNA polymerase-associated protein CTR9 homolog vs. Ensembl Nematostella
Match: EDO47073 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RN48])

HSP 1 Score: 62.003 bits (149), Expect = 1.338e-9
Identity = 84/417 (20.14%), Postives = 165/417 (39.57%), Query Frame = 3
Query:  924 MRAQSCYQIARGFHKEENYDEAFQYYYQATQFASNNFVMPFYGLGQMYLCRKDIENAISSFEKVLKVYPNNYETLKILGSLYAQSDKEDRREQAKKMFQNVTEIEPDDLEAWIEYAQLL--KDDTASSLEAYTKAINLLRQENLDIPPEILN---NVGVLHHMRKNYDETRKYYSEALERIEEVKTELSNNQDIKQDDVNYYIGLSVTINYNQGRLFEAEYQTDEADLLYKKILTQFPEYLDCHLRLGCMSRDRGQIYDASDWFKDALKVNQDHPDSWSLMGMLHLSKSEAGPAQKKFEFIVRQNPNDIFANVALGNIWLNTLFHPSRDKEKEKRHQERALTHYRNVLRVDPKNILAAHGIGAVLAHKGYINEARDVFAQVREATADFPDVWINIAHIYVEQKQYLAAIQMYENCIK 2159
            M A++   +   F +     +A   Y  A +   + F+  +  L    +   D+E A+ ++   L+  P+ Y     LG+L        R E+AK  +    E +P    AW     +   + +   ++  + KA+ L         P  L+   N+G +    + +D     Y  AL         LS N  +   ++         + Y QG +       D A   Y++ +   P + D +  L    +++G++ +A + +  AL+++  H DS + +  +   K E G  ++      +    +IF   A  +  L ++       +++ + QE AL HY+  +R+ P    A   +G +L     I  A   +++  +    F D   N+A ++ +      AIQ Y   +K
Sbjct:   83 MLAEAYSNLGNVFKERGQLKDALANYRHAVKLKPD-FIDGYINLAAALVAAGDLEGAVHAYATALQYNPDLYCVRSDLGNLL---KALGRLEEAKACYLKAIETQPSFAVAWSNLGCVFNAQGEIWLAIHHFEKAVQL--------DPNFLDAYINLGNVLKEARIFDRAVAAYLRALN--------LSPNHAVVHGNL-------ACVYYEQGLI-------DLAVDTYRRAIELQPNFPDAYCNLANALKEQGKVSEAEECYNTALQLSPTHADSLNNLANI---KREQGKIEESIRLYCKAL--EIFPEFAAAHSNLASVL------QQQGKLQE-ALLHYKEAIRIHPTFADAFSNMGNLLKEMQDIQGAIQCYSRAIQINPAFADAHSNLASVHKDSGNIPEAIQSYRTALK 453          

HSP 2 Score: 61.6178 bits (148), Expect = 1.711e-9
Identity = 80/352 (22.73%), Postives = 145/352 (41.19%), Query Frame = 3
Query: 1488 IKQDDVNYYIGLSVTINYNQGRLFEAEYQTDEADLLYKKILTQFPEYLDCHLRLGCMSRDRGQIYDASDWFKDALKVNQDHPDSWSLMGMLHLSKSEAGPAQKKFEFIVRQNPNDIFANVALGNIWLNTLFHPSRDKEKEKRHQERALTHYRNVLRVDPKNILAAHGIGAVLAHKGYINEARDVFAQVREATADFPDVWINIAHIYVEQKQYLAAIQMYENCIKKFNKQTNTELLLYLARAHFKCDQLKKCKQVLLKARHIAPWDPLIAYNLAFVQK------------RWALSVVP---DEKSNFSSVLEGINDLNMA-QCTFKYL--------------SILKDQINIPQ 2453
            +K D ++ YI L+  +         A    + A   Y   L   P+       LG + +  G++ +A   +  A++       +WS +G +  ++ E   A   FE  V+ +PN + A + LGN+             KE R  +RA+  Y   L + P + +    +  V   +G I+ A D + +  E   +FPD + N+A+   EQ +   A + Y   ++     T+ + L  LA    +  ++++  ++  KA  I P       NLA V +            + A+ + P   D  SN  ++L+ + D+  A QC  + +              S+ KD  NIP+
Sbjct:  114 LKPDFIDGYINLAAAL--------VAAGDLEGAVHAYATALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPSFAVAWSNLGCVFNAQGEIWLAIHHFEKAVQLDPNFLDAYINLGNVL------------KEARIFDRAVAAYLRALNLSPNHAVVHGNLACVYYEQGLIDLAVDTYRRAIELQPNFPDAYCNLANALKEQGKVSEAEECYNTALQL--SPTHADSLNNLANIKREQGKIEESIRLYCKALEIFPEFAAAHSNLASVLQQQGKLQEALLHYKEAIRIHPTFADAFSNMGNLLKEMQDIQGAIQCYSRAIQINPAFADAHSNLASVHKDSGNIPE 443          

HSP 3 Score: 56.225 bits (134), Expect = 7.972e-8
Identity = 89/451 (19.73%), Postives = 177/451 (39.25%), Query Frame = 3
Query:  432 FEGDNWSQVDNQLNFVLNSSPNNVPALLGKSCIAFNKKEYRSALSFYRKALRNHPKCPASVRLGMGHCFFRLGNLEKAKFAFERALALDPECXXXXXXXXXXELNEKTLESVHHGVQKLSKAYMKDSNNPMVLNHLADHFFYAQQYKKVHTLALHAFHYTENELMRAQSCYQIARGFHKEENYDEAFQYYYQATQFASNNFVMPFYGLGQMYLCRKDIENAISSFEKVLKVYPNNYETLKILGSLYAQSDKEDRREQAKKMFQNVTEIEPDDLEAWIEYAQLLKDD--TASSLEAYTKAINLLRQENLDIPPEILNNVGVLHHMRKNYDETRKYYSEALERIEEVKTELSNNQDIKQDD-------VNYYIGLSVTINY-----NQGRLFEAEYQTDEADLLYKKILTQFPEYLDCHLRLGCMSRDRGQIYDASDWFKDALKVNQDHPDSW 1742
            ++  N+ + +     +    P+N   LL  S I F  +    +  F   A++ +P   A     +G+ F   G L+ A   +  A+ L P+ +   + LA   +    LE     V   + A   + +   V + L +      + ++     L A    E +   A +   +   F+ +     A  ++ +A Q    NF+  +  LG +    +  + A++++ + L + PN+      L  +Y +    D    A   ++   E++P+  +A+   A  LK+    + + E Y  A+ L          + LNN+  +   +   +E+ + Y +ALE   E     SN   + Q         ++Y   + +   +     N G L +       A   Y + +   P + D H  L  + +D G I +A   ++ ALK+    PD++
Sbjct:   28 YQSGNYDRAEQICMQLWRREPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPML-AEAYSNLGNVFKERGQLKDALANYRHAVKLKPDFIDGYINLAAALVAAGDLEG---AVHAYATALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAI---ETQPSFAVAWSNLGCVFNAQGEIWLAIHHFEKAVQL-DPNFLDAYINLGNVLKEARIFDRAVAAYLRALNLSPNHAVVHGNLACVYYEQGLIDL---AVDTYRRAIELQPNFPDAYCNLANALKEQGKVSEAEECYNTALQLSPTH-----ADSLNNLANIKREQGKIEESIRLYCKALEIFPEFAAAHSNLASVLQQQGKLQEALLHYKEAIRIHPTFADAFSNMGNLLKEMQDIQGAIQCYSRAIQINPAFADAHSNLASVHKDSGNIPEAIQSYRTALKLKPSFPDAY 462          

HSP 4 Score: 52.7582 bits (125), Expect = 9.801e-7
Identity = 85/400 (21.25%), Postives = 156/400 (39.00%), Query Frame = 3
Query:  981 DEAFQYYYQATQFASNNFVMPFYGLGQMYLCRKDIENAISSFEKVLKVYPNNYETLKILGSLYAQSDKEDRREQAKKMFQNVTEIEPDDLE-----AWIEYAQLLKDDTASSLEAYTKAINLLRQENLDIPPEILNNVGVLHHMRKNYDETRKYYSEALERIEEVKTELSNNQDIKQDDVNYYIGLSVTINYNQGRLFEAEYQTDEADLLYKKILTQFPEYLDCHLRLGCMSRDRGQIYDASDWFKDALKVNQDHPDSWSLMGMLHLSKSEAGPAQKKFEFIVRQNPNDIFANVALGNIWLNTLFHPSRDKEKEKRHQERALTHYRNVLRVDPKNILAAHGIGAVLAHKGYINEARDVFAQVREATADFPDVWINIAHIYVEQKQYLAAIQMYENCIKKF 2165
            +EA   Y +A +    +F + +  LG ++  + +I  AI  FEK +++ PN  +    LG++  ++   DR   A   +     + P+        A + Y Q L D    +++ Y +AI L  Q N    P+   N+      +    E  + Y+ AL+        L+N  +IK++               QG++       +E+  LY K L  FPE+   H  L  + + +G++ +A   +K+A++++    D++S MG L                                               KE +  + A+  Y   ++++P    A   + +V    G I EA   +    +    FPD + N+AH      Q +     Y+N +KK 
Sbjct:  170 EEAKACYLKAIE-TQPSFAVAWSNLGCVFNAQGEIWLAIHHFEKAVQLDPNFLDAYINLGNVLKEARIFDR---AVAAYLRALNLSPNHAVVHGNLACVYYEQGLID---LAVDTYRRAIEL--QPNF---PDAYCNLANALKEQGKVSEAEECYNTALQLSPTHADSLNNLANIKRE---------------QGKI-------EESIRLYCKALEIFPEFAAAHSNLASVLQQQGKLQEALLHYKEAIRIHPTFADAFSNMGNL----------------------------------------------LKEMQDIQGAIQCYSRAIQINPAFADAHSNLASVHKDSGNIPEAIQSYRTALKLKPSFPDAYCNLAHCL----QIICDWTDYDNRMKKL 485          
BLAST of RNA polymerase-associated protein CTR9 homolog vs. Ensembl Nematostella
Match: EDO28725 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T5N6])

HSP 1 Score: 60.8474 bits (146), Expect = 3.631e-9
Identity = 121/578 (20.93%), Postives = 217/578 (37.54%), Query Frame = 3
Query:  549 YRSALSFYRKALRNHPKCP-----ASVRLGMGHCFFRLGNLEKAKFAFERALALDPECXXXXXXXXXXELNEKTLESVHHGVQKLSKAYMKDSNNPMVLNHLADHFFYAQQYKKVHTLALHAFHYTENELMRAQSCYQIARGFHKEENYDEAFQYYYQATQF-----ASNNFVMPFYGLGQMYLCRKDIENAISSFEKVLKVY---PNNYETLKILGSLYAQSDKEDRREQAKKMFQNVTEI------EPDDLEAWIEYAQLLK--DDTASSLEAYTKAINLL-RQENLDIPPEILNNVGVLHHMRKNYDETRKYYSEALERIEEVKTELSNNQDIKQDDVNYYIGLSVTINYNQGRLFEAEYQTDEADLLYKKILTQFPEYLDCHLRLGCMSRDRGQIYDASDWFKDALKVNQDHPDSWSLMGMLHLSKSEAGPAQKKFEFIVRQNPNDIFANVALGNIWLNTLFHPSRDKEKEKRHQERALTHYRNVLRV------DPKNILAAHGIGAVLAHKGYINEARDVFAQVREA------TADFPDVWINIAHIYVEQKQYLAAIQMYENCIKKFNKQTN 2180
            Y  A+ +Y++AL+   +       A VRL +G    RLGN E+A   +++AL +                NE     V H +  + ++          L +  +   Y QQ       AL  F  T NE  +A   + I        NY+EA +YY QA Q        ++       +G +     + E A+  F++ L+V+    N  +   +  ++     +    E+A K +Q   ++      E D     +    + +  D+   +++ Y +A+ +  R  N     ++ +N+GV+     NY+E  KYY +AL+  E    E       KQ +V   IG    +    G   EA     +A  ++++   +  +     + +G + +  G   +A  +++ AL+V +   +     G                   VR N   +    +LGN                    E A+ +Y+  L+V      + K     H IG V    G   EA   + QV +        +D  DV  NI  +      Y  A++ Y+  ++ F +  N
Sbjct:  244 YEEAMKYYQQALQVFERTGNESEQAGVRLNIGGVQQRLGNYEEAMKYYQQALQVFERTG-----------NESEQAGVRHNIGVVQQS----------LGNYEEAMKYYQQ-------ALQVFERTGNESKQADVRHNIGVVQQSLGNYEEAMKYYQQALQVFERTGNESDQADVRLNIGGVQQRLGNYEEAMKYFQQALQVFERTGNESDQAGVRMNIGGVQQRLGNYEEAMKYYQQALQVFERTGNESDQAGVRLNIGGVQRRLDNYEEAMKYYQQALQVFERTGNESKQADVRHNIGVVQQSLGNYEEAMKYYQQALQVYERTGNE------SKQANVRLNIG---GVQQRLGNYEEAMKYFQQALQVFERTGNE-SDQAGARMNIGGVQQRLGNYEEAMKYYQQALQVFERTGNESDQAG-------------------VRLNIGGV--QQSLGNY-------------------EEAMKYYQQALQVYERTGNESKQANVRHNIGVVQQSLGNYEEAMKYYQQVLQVFERTGNESDQADVRHNIGVVQQSLGNYEEAMKYYQQALQVFERTGN 743          

HSP 2 Score: 54.6842 bits (130), Expect = 2.463e-7
Identity = 81/342 (23.68%), Postives = 137/342 (40.06%), Query Frame = 3
Query:  549 YRSALSFYRKALRNHPKCP-----ASVRLGMGHCFFRLGNLEKAKFAFERALALDPECXXXXXXXXXXELNEKTL-ESVHHGVQKLSKAYMKDSNNPMVLNHLADHFFYAQQYKKVHTLALHAFHYTENELMRAQSCYQIARGFHKEENYDEAFQYYYQATQF-------ASNNFVMPFYGLGQMYLCRKDIENAISSFEKVLKVYPNNYETLKILGSLYAQSDKEDRR-------------EQAKKMFQNVTEI--------EPDDLEAWIEYAQLLKDDTASSLEAYTKAINLL-RQENLDIPPEILNNVGVLHHMRKNYDETRKYYSEALERIEEVKTE 1469
            Y  A+ +Y++AL+ + +       A+VRL +G    RLGN E+A   F++AL                ++ E+T  ES   G      A M        L +  +   Y QQ       AL  F  T NE  +A     I        NY+EA +YY QA Q        +    V    G+         ++ ++ ++E+ +K Y    + L++      +SD+ D R             E+A K +Q   ++        +  ++   I   Q    +   +++ Y +A+ +  R  N     ++ NN+GV+     NY+E  KYY +AL+  E    E
Sbjct:  524 YEEAMKYYQQALQVYERTGNESKQANVRLNIGGVQQRLGNYEEAMKYFQQAL----------------QVFERTGNESDQAG------ARMNIGGVQQRLGNYEEAMKYYQQ-------ALQVFERTGNESDQAGVRLNIGGVQQSLGNYEEAMKYYQQALQVYERTGNESKQANVRHNIGV---------VQQSLGNYEEAMKYYQ---QVLQVFERTGNESDQADVRHNIGVVQQSLGNYEEAMKYYQQALQVFERTGNESKQANVRHNIGVVQQSLGNYEEAMKYYQQALQVFERTGNESDQADVRNNIGVVQQSLGNYEEAMKYYQQALQVFERTGNE 824          

HSP 3 Score: 50.8322 bits (120), Expect = 4.210e-6
Identity = 74/323 (22.91%), Postives = 128/323 (39.63%), Query Frame = 3
Query:  549 YRSALSFYRKALR-----NHPKCPASVRLGMGHCFFRLGNLEKAKFAFERALALDPECXXXXXXXXXXELNEKTLESVHHGVQKLSKAYMKDSNNPMVLNHLADHFFYAQQYKKVHTLALHAFHYTENELMRAQSCYQIARGFHKEENYDEAFQYYYQATQ-FASNNFVMPFYGLGQMYLCRKDIENAISSFEKVLKVYPNNYETLKILGSLYAQSDKEDRREQAKKMFQNV-TEIEPDDLEAWIEYAQLLKDDTASSLEAYTKAINLL-RQENLDIPPEILNNVGVLHHMRKNYDETRKYYSEALERIEEVKTELSNNQDIK 1493
            Y  A+ +Y++AL+      +    A VRL +G  +  LGN E+A    ++AL +            +   NE     V   +  L +  + +    +     A   F A +  K +  AL  F  T NE  +A     I        NY+EA +YY QA Q F          G+    L    ++  + ++E+ +K Y                       +QA ++F+    E E   +   I   Q    +   +++ Y +A+ +  R  N     ++ +N+GV+     NY+E  KYY +AL+  E    E S+  D++
Sbjct:  108 YEEAIKYYQQALQVYISTGNESKQAGVRLNIGAVYQSLGNYEEAMKYCQQALQV-----------YISTGNESKQADVRQSI-GLVQQSLGNYEEAIKYYQQALQVFIALEAMKYYQQALQVFESTGNESKQADVRQNIGLVQDSLGNYEEAMKYYQQALQVFERTGNESEQAGV---RLNIGGVQQRLGNYEEAMKYY-----------------------QQALQVFERTGNESEQAGVRHNIGVVQQSLGNYEEAMKYYQQALQVFERTGNESKQADVRHNIGVVQQSLGNYEEAMKYYQQALQVFERTGNE-SDQADVR 391          
BLAST of RNA polymerase-associated protein CTR9 homolog vs. Ensembl Nematostella
Match: EDO42048 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2Q9])

HSP 1 Score: 54.6842 bits (130), Expect = 2.818e-7
Identity = 93/415 (22.41%), Postives = 168/415 (40.48%), Query Frame = 3
Query:  549 YRSALSFYRKALR-----NHPKCPASVRLGMGHCFFRLGNLEKAKFAFERALALDPECXXXXXXXXXXELNEKTL-ESVHHGVQKLSKAYMKDSNNPMVLNHLADHFFYAQQYKKVHTLALHAFHYTENELMRAQSCYQIARGFHKEENYDEAFQYYYQATQFASNNF-----VMPFYGLGQMYLCRKDIENAISSFEKVLKVY---PNNYETLKILGSLYAQSDKEDRREQAKKMFQNVTEI--------EPDDLEAWIEYAQLLKDDTASSLEAYTKAINL-LRQENLDIPPEILNNVGVLHHMRKNYDETRKYYSEALERIEEVKTELSNNQDIKQDDVNYYIGLSVTINYNQGRLFEAEYQTDEADLLYKKILTQFPEYLDCHLR--LGCMSRDRGQIYDASDWFKDALKV 1718
            Y  A+ +Y++AL+      +    A VR  +G     LGN E+A   +++AL                ++ E+T  ES   GV++         N  +V   L ++    ++  K +  AL  F  T NE  +A     I     +  NY+EA +YY Q  Q    N            +G +  C  + E A+  +++ L+VY    N  +   +  ++    +     E+A K +Q   ++        E  D+   I   Q    +   +++ Y +A+ + +   N     ++  N+GV+     NY+E  KYY +AL+  E    E        Q DV   IG+   +  + G   EA     +A  +Y   ++   E     +R  +G + +  G   +A  +++ AL+V
Sbjct:   68 YEEAMKYYQQALQVYISTGNESDQADVRQNIGGVQQSLGNYEEAMKYYQQAL----------------QVFERTGNESEQAGVRQ---------NIGVVQESLGNY----EEAMKYYQQALQVFISTGNESKQADVRQNIGGVQRRLGNYEEAMKYYQQVLQVFERNGNESDQAGVLLNIGVVQQCLGNYEEAMKYYQQALQVYISTGNESKQASVRQNIGGVQESLGNYEEAMKYYQQALQVFISTGNESEQADVRLNIGGVQQSLGNYEEAMKYYQQALQVFISTGNESKQADVRQNIGVVQRRLGNYEEAMKYYQQALQVFERTGNESD------QADVRLNIGV---VQQSLGNYEEAMKYYQQALQVY---ISTGNESKQARVRQKIGVVQQSLGNYEEAMKYYQQALQV 441          

HSP 2 Score: 51.2174 bits (121), Expect = 3.102e-6
Identity = 75/325 (23.08%), Postives = 135/325 (41.54%), Query Frame = 3
Query:  549 YRSALSFYRKALR-----NHPKCPASVRLGMGHCFFRLGNLEKAKFAFERALALDPECXXXXXXXXXXELNEKTLESVHHGVQKLSKAYMKDSNNPMVLNHLADHFFYAQQYKKVHTLALHAFHYTENELMRAQSCYQIARGFHKEENYDEAFQYYYQATQFASNNFVMPFYGLGQMYLCRK--DIENAISSFEKVLKVYPNNYETLKILGSLYAQSDKEDRREQAKKMFQNVTEIEPDDLEAWIEYAQLLKDDTASSLEAYTKAINL-LRQENLDIPPEILNNVGVLHHMRKNYDETRKYYSEALERIEEVKTELSNNQDIKQD 1499
            Y  A+ +Y++AL+      +    A VRL +G     LGN E+A   +++AL +            +   NE T   V   +  + ++          L +  +   Y QQ       AL  F  T NE  +A     I    H   NY+EA +YY QA Q     ++       Q  + +    ++  + ++E+ +K Y    +  +  G+   +SD+ D R       QN+  ++ D L  + E           +++ Y +A+ + +   N     ++  N+G +     NY+E  KYY +AL+  E    E S+  D++Q+
Sbjct:  548 YEEAMKYYQQALQVYISTGNESNQAGVRLKIGVVQESLGNYEEAMKYYQQALQV-----------YISTGNESTQARVRQKIGVVQQS----------LGNYEEAMKYYQQ-------ALQVFERTGNESDQADVRQNIGVVQHSLGNYEEAMKYYQQALQV----YISTGNESDQADVRQNIGGVQQRLGNYEEAMKYYQQALQVFERTGN---ESDQADVR-------QNIGAVQ-DSLGNYEE-----------AMKYYQQALQVYISTGNESDQADVRQNIGGVQQRLGNYEEAMKYYQQALQVYERTGNE-SDQADVRQN 817          
BLAST of RNA polymerase-associated protein CTR9 homolog vs. Ensembl Nematostella
Match: EDO33965 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQP9])

HSP 1 Score: 53.5286 bits (127), Expect = 4.687e-7
Identity = 59/230 (25.65%), Postives = 96/230 (41.74%), Query Frame = 3
Query: 1080 DIENAISSFEKVLKVYPNNYETLKILGSLYAQSDKE--DRREQAKKMFQNVTEIEPDDLEAWIEYAQLLKDDTASSLEAYTKAI-NLLRQENLDIPPEILNNVGVLHHMRKNYDETRKYYSEALERIEEVKTELSNNQDIKQDDVNYYIGLSVTINYNQGRLFEAEYQTDEADLLYKKILTQFPEYLDCHLRLGCMSRDRGQIYDASDWFKDALKVNQDHPDSWSLMGML 1760
            DI++AIS F K++K +P         G+ Y +   +  +  + A   F  V    P + E WI  A++L     S +    +AI ++    +L    E+    G LH M ++Y    K   ++LE             +  Q     Y+GLS+   Y++G +        +A  LYKK L       + H  LG   R+ G    A + F  AL +     +++ L GML
Sbjct:   21 DIDDAISYFTKIIKEHPKVTSAFLGRGTAYVKKGIQIKENSDAAISDFSTVISHSPKNPEGWIRRAEVL-----SPIGRIPEAIKDISVALSLQPSAELYLISGTLHFMSEDYVTATKNLEKSLE------------YNPSQATATLYLGLSL---YHRGLI-------QQAIPLYKKALQANTNTAEVHRSLGHAYRELGDASAAYEHFTAALLLEPRSAETFHLRGML 223          
BLAST of RNA polymerase-associated protein CTR9 homolog vs. Ensembl Medaka
Match: ctr9 (CTR9 homolog, Paf1/RNA polymerase II complex component [Source:NCBI gene;Acc:101158590])

HSP 1 Score: 1006.51 bits (2601), Expect = 0.000e+0
Identity = 505/856 (59.00%), Postives = 643/856 (75.12%), Query Frame = 3
Query:   27 TIEIPLRDTDEVIELDTDAFPDVDEVLNILKQEVAPMHVWILVALEYYRSKKYNDFVKVLNEANIHASVTYADSEKDQVKVLDMLANYYVKQASXXXXXXXXXXLFGQAAVHFTTADRIAMFDHNHLLSRAFFFLFEGDNWSQVDNQLNFVLNSSPNNVPALLGKSCIAFNKKEYRSALSFYRKALRNHPKCPASVRLGMGHCFFRLGNLEKAKFAFERALALDPECXXXXXXXXXXELNEKTLESVHHGVQKLSKAYMKDSNNPMVLNHLADHFFYAQQYKKVHTLALHAFHYTENELMRAQSCYQIARGFHKEENYDEAFQYYYQATQFASNNFVMPFYGLGQMYLCRKDIENAISSFEKVLKVYPNNYETLKILGSLYAQSDKEDRREQAKKMFQNVTEIEPDDLEAWIEYAQLL-KDDTASSLEAYTKAINLLRQE-NLDIPPEILNNVGVLHHMRKNYDETRKYYSEALERIEEVKTELSNNQDIKQDDVNYYIGLSVTINYNQGRLFEAEYQTDEADLLYKKILTQFPEYLDCHLRLGCMSRDRGQIYDASDWFKDALKVNQDHPDSWSLMGMLHLSKSEAGPAQKKFEFIVRQ--NPNDIFANVALGNIWLNTLFHPSRDKEKEKRHQERALTHYRNVLRVDPKNILAAHGIGAVLAHKGYINEARDVFAQVREATADFPDVWINIAHIYVEQKQYLAAIQMYENCIKKFNKQTNTELLLYLARAHFKCDQLKKCKQVLLKARHIAPWDPLIAYNLAFVQKRWALSVVPDEKSNFSSVLEGINDLNMAQCTFKYLSILKDQI--NIPQLPNEIKDCQDLLSQARYYLDRATKREQQERYMRQKQVEERE 2576
            +IEIPLRDTDEVIELD D  P+ DEV++ILKQE   +H+WI +ALEYY+  K  DFVK+L  A I  ++ Y D EKDQ+  LD LA YYV+QA KEK K+ K+EL  QA + +T AD+I M+D NHLL RA F L EGD   Q D Q +FVLN S NN+PALLGK+CI+FNKK+YR AL++Y+KALR +P CPA VRLGMGHCF +L  LEKA+ AF RAL L+ +CVGALVGLAVLELN K  +S+ +GVQ LS+AY  D +NPMVLNHLA+HFF+ + Y+KV  LALHAFH TE E M+A+SCYQ+AR FH +E+YD+AFQYYYQATQFAS  FV+PF+GLGQMY+ R+D ENA   FEKVLK YPNNYET+KILGSLYA SD +D+R+ AK   + VTE  PDD+EAWIE AQ+L + D   +L AY  A  +L++    D+PPEILNN+G LH    N  E +KY+  +LER    K E        + D +YY  +SVT +YN  RL+EA  +  EA+ LYK IL + P Y+DC+LRLG M+RD+G  Y+ASDWFK+AL++NQDHPD+WSL+G LHL+K E GP QKKFE I++Q    ND ++ +ALGN+WL TL  P+RD+EKEKRHQ+RAL  Y+ VLR D KN+ AA+GIGAVLAHKGY  EARDVFAQVREATAD  DVW+N+AHIYVEQKQY++A+QMYENC+KKF K  NTE+LLYLARA FKC +L++CKQ+LLKARH+AP D ++ +N+A V +R A  V+ DEKSN  +VL  + +L +A   F YLS   D++  ++    +E + C DLLSQA+Y++ RA K++++E+ +R KQ +ER+
Sbjct:    5 SIEIPLRDTDEVIELDFDQLPEGDEVISILKQEHTQLHIWIALALEYYKQGKTEDFVKLLEAARIDGNLDYRDHEKDQMTCLDTLAAYYVQQARKEKNKDAKKELITQATLLYTMADKIIMYDQNHLLGRACFCLLEGDKMDQADAQFHFVLNQSTNNIPALLGKACISFNKKDYRGALAYYKKALRTNPGCPAEVRLGMGHCFVKLNKLEKARLAFSRALELNSKCVGALVGLAVLELNNKEADSIKNGVQLLSRAYTIDPSNPMVLNHLANHFFFKKDYRKVQHLALHAFHNTEVEAMQAESCYQLARSFHVQEDYDQAFQYYYQATQFASTTFVLPFFGLGQMYVYRRDKENAAQCFEKVLKAYPNNYETMKILGSLYATSDDQDKRDIAKGHLKKVTEQYPDDVEAWIELAQILEQTDIQGALSAYGTATRILQETVQADVPPEILNNLGALHFRLGNLGEAKKYFLASLER---AKAE-------GEHDEHYYNAISVTTSYNLARLYEAMCEFHEAEKLYKNILREHPNYVDCYLRLGAMARDKGNFYEASDWFKEALQINQDHPDAWSLIGNLHLAKQEWGPGQKKFERILKQPSTQNDTYSMLALGNVWLQTLHQPTRDREKEKRHQDRALAIYKQVLRNDAKNLHAANGIGAVLAHKGYFREARDVFAQVREATADISDVWLNLAHIYVEQKQYISAVQMYENCLKKFYKYQNTEVLLYLARALFKCGKLQECKQILLKARHVAPSDTVLMFNVALVLQRLATLVLKDEKSNLKAVLSAVKELELAHRYFSYLSKTGDKMRFDLALAASEARQCSDLLSQAQYHVARARKQDEEEKELRAKQEQERD 850          
BLAST of RNA polymerase-associated protein CTR9 homolog vs. Ensembl Medaka
Match: ogt.1 (O-linked N-acetylglucosamine (GlcNAc) transferase [Source:NCBI gene;Acc:101164571])

HSP 1 Score: 62.003 bits (149), Expect = 3.632e-9
Identity = 88/394 (22.34%), Postives = 155/394 (39.34%), Query Frame = 3
Query: 1362 EILNNVGVLHHMRKNYDETRKYYSEALERIEEVKTELSNNQDIKQDDVNYYIGLSVTINYNQGRLFEAEYQTDEADLLYKKILTQFPEYLDCHLRLGCMSRDRGQIYDASDWFKDALKVNQDHPDSWSLMGMLHLSKSEAGPAQKKFEFIVRQNPNDIFANVALGNIWLNTLFHPSRDKEKEKRHQERALTHYRNVLRVDPKNILAAHGIGAVLAHKGYINEARDVFAQVREATADFPDVWINIAHIYVEQKQYLAAIQMYENCIKKFNKQTNTELLLYLARAHFKCDQLKKCKQVLLKARHIAPWDPLIAYNLAFVQK------------RWALSVVP---DEKSNFSSVLEGINDLNMA-QCTFKYL--------------SILKDQINIPQ 2453
            E  +N+G ++  R    E  ++Y  AL               +K D ++ YI L+  +         A    + A   Y   L   P+       LG + +  G++ +A   +  A++   +   +WS +G +  ++ E   A   FE  V  +PN + A + LGN+             KE R  +RA+  Y   L + P + +    +  V   +G I+ A D + +  E    FPD + N+A+   E+     A + Y   ++     T+ + L  LA    +   +++  Q+  KA  + P       NLA V +            + A+ + P   D  SN  + L+ + D+  A QC  + +              SI KD  NIP+
Sbjct:   80 EAYSNLGNVYKERGQLQEAIEHYRHALR--------------LKPDFIDGYINLAAAL--------VAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVL------------KEARIFDRAVAGYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANALKEKGNVSEAEECYNTALRLC--PTHADSLNNLANIKREQGNIEEAVQLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPE 437          

HSP 2 Score: 61.6178 bits (148), Expect = 5.503e-9
Identity = 85/378 (22.49%), Postives = 150/378 (39.68%), Query Frame = 3
Query:  981 DEAFQYYYQATQFASNNFVMPFYGLGQMYLCRKDIENAISSFEKVLKVYPNNYETLKILGSLYAQSDKEDRREQAKKMFQNVTEIEPDDLE-----AWIEYAQLLKDDTASSLEAYTKAINLLRQENLDIPPEILNNVGVLHHMRKNYDETRKYYSEALERIEEVKTELSNNQDIKQDDVNYYIGLSVTINYNQGRLFEAEYQTDEADLLYKKILTQFPEYLDCHLRLGCMSRDRGQIYDASDWFKDALKVNQDHPDSWSLMGMLHLSKSEAGPAQKKFEFIVRQNPNDIFANVALGNIWLNTLFHPSRDKEKEKRHQERALTHYRNVLRVDPKNILAAHGIGAVLAHKGYINEARDVFAQVREATADFPDVWINIAH 2099
            +EA   Y +A +    NF + +  LG ++  + +I  AI  FEK + + PN  +    LG++  ++   DR   A   +     + P+        A + Y Q L D    +++ Y +AI L  Q +    P+   N+      + N  E  + Y+ AL         L+N  +IK++               QG +       +EA  LY+K L  FPE+   H  L  + + +G++ +A   +K+A++++    D++S MG                                      NTL        KE +  + AL  Y   ++++P    A   + ++    G I EA   +    +   DFPD + N+AH
Sbjct:  164 EEAKACYLKAIE-TQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDR---AVAGYLRALSLSPNHAVVHGNLACVYYEQGLID---LAIDTYRRAIEL--QPHF---PDAYCNLANALKEKGNVSEAEECYNTALRLCPTHADSLNNLANIKRE---------------QGNI-------EEAVQLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMG--------------------------------------NTL--------KEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAH 461          

HSP 3 Score: 59.6918 bits (143), Expect = 2.154e-8
Identity = 82/417 (19.66%), Postives = 164/417 (39.33%), Query Frame = 3
Query:  924 MRAQSCYQIARGFHKEENYDEAFQYYYQATQFASNNFVMPFYGLGQMYLCRKDIENAISSFEKVLKVYPNNYETLKILGSLYAQSDKEDRREQAKKMFQNVTEIEPDDLEAWIEYAQLL--KDDTASSLEAYTKAINLLRQENLDIPPEILN---NVGVLHHMRKNYDETRKYYSEALERIEEVKTELSNNQDIKQDDVNYYIGLSVTINYNQGRLFEAEYQTDEADLLYKKILTQFPEYLDCHLRLGCMSRDRGQIYDASDWFKDALKVNQDHPDSWSLMGMLHLSKSEAGPAQKKFEFIVRQNPNDIFANVALGNIWLNTLFHPSRDKEKEKRHQERALTHYRNVLRVDPKNILAAHGIGAVLAHKGYINEARDVFAQVREATADFPDVWINIAHIYVEQKQYLAAIQMYENCIK 2159
            M A++   +   + +     EA ++Y  A +   + F+  +  L    +   D+E A+ ++   L+  P+ Y     LG+L        R E+AK  +    E +P+   AW     +   + +   ++  + KA+ L         P  L+   N+G +    + +D     Y  AL         LS N  +   ++         + Y QG +       D A   Y++ +   P + D +  L    +++G + +A + +  AL++   H DS + +  +   K E G  ++  +    +   ++F   A  +  L ++       +++ + QE AL HY+  +R+ P    A   +G  L     +  A   + +  +    F D   N+A I+ +      AI  Y   +K
Sbjct:   77 MLAEAYSNLGNVYKERGQLQEAIEHYRHALRLKPD-FIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLL---KALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTL--------DPNFLDAYINLGNVLKEARIFDRAVAGYLRAL--------SLSPNHAVVHGNL-------ACVYYEQGLI-------DLAIDTYRRAIELQPHFPDAYCNLANALKEKGNVSEAEECYNTALRLCPTHADSLNNLANI---KREQGNIEEAVQLY--RKALEVFPEFAAAHSNLASVL------QQQGKLQE-ALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALK 447          

HSP 4 Score: 57.3806 bits (137), Expect = 1.115e-7
Identity = 88/431 (20.42%), Postives = 169/431 (39.21%), Query Frame = 3
Query:  492 PNNVPALLGKSCIAFNKKEYRSALSFYRKALRNHPKCPASVRLGMGHCFFRLGNLEKAKFAFERALALDPECXXXXXXXXXXELNEKTLESVHHGVQKLSKAYMKDSNNPMVLNHLADHFFYAQQYKKVHTLALHAFHYTENELMRAQSCYQIARGFHKEENYDEAFQYYYQATQFASNNFVMPFYGLGQMYLCRKDIENAISSFEKVLKVYPNNYETLKILGSLYAQSDKEDRREQAKKMFQNVTEIEPDDLEAWIEYAQLLKD--DTASSLEAYTKAINLLRQENLDIPPEILNNVGVLHHMRKNYDETRKYYSEALERIEEVKTELSNNQDIKQDD-------VNYYIGLSVTINY-----NQGRLFEAEYQTDEADLLYKKILTQFPEYLDCHLRLGCMSRDRGQIYDASDWFKDALKVNQDHPDSW 1742
            P+N   LL  S I F  +    +  F   A++ +P   A     +G+ +   G L++A   +  AL L P+ +   + LA   +    +E     VQ    A   + +   V + L +      + ++     L A     N    A +   +   F+ +     A  ++ +A      NF+  +  LG +    +  + A++ + + L + PN+      L  +Y +    D    A   ++   E++P   +A+   A  LK+  + + + E Y  A+ L          + LNN+  +   + N +E  + Y +ALE   E     SN   + Q         ++Y   + ++  +     N G   +       A   Y + +   P + D H  L  + +D G I +A   ++ ALK+  D PD++
Sbjct:   42 PDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPML-AEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDMEG---AVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPN---FAVAWSNLGCVFNAQGEIWLAIHHFEKAVTL-DPNFLDAYINLGNVLKEARIFDRAVAGYLRALSLSPNHAVVHGNLACVYYEQGLIDL---AIDTYRRAIELQPHFPDAYCNLANALKEKGNVSEAEECYNTALRLCPTH-----ADSLNNLANIKREQGNIEEAVQLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAY 456          
BLAST of RNA polymerase-associated protein CTR9 homolog vs. Ensembl Medaka
Match: ogt.1 (O-linked N-acetylglucosamine (GlcNAc) transferase [Source:NCBI gene;Acc:101164571])

HSP 1 Score: 60.8474 bits (146), Expect = 6.133e-9
Identity = 96/467 (20.56%), Postives = 175/467 (37.47%), Query Frame = 3
Query:  924 MRAQSCYQIARGFHKEENYDEAFQYYYQATQFASNNFVMPFYGLGQMYLCRKDIENAISSFEKVLKVYPNNYETLKILGSLYAQSDKEDRREQAKKMFQNVTEIEPDDLEAWIEYAQLL--KDDTASSLEAYTKAINLLRQENLDIPPEILN---NVGVLHHMRKNYDETRKYYSEALERIEEVKTELSNNQDIKQDDVNYYIGLSVTINYNQGRLFEAEYQTDEADLLYKKILTQFPEYLDCHLRLGCMSRDRGQIYDASDWFKDALKVNQDHPDSWSLMGMLHLSKSEAG-----------------------PAQKK-FEFIVRQNPN--DIFANVALGNIWLNTLFHPSRDKEKEKRHQERALTHYRNVLRVDPKNILAAHGIGAVLAHKGYINEARDVFAQVREATADFPDVWINIAHIYVEQKQYLAAIQMYENCIKKFNKQTNTELLLYLARAHFK--CD 2225
            M A++   +   + +     EA ++Y  A +   + F+  +  L    +   D+E A+ ++   L+  P+ Y     LG+L        R E+AK  +    E +P+   AW     +   + +   ++  + KA+ L         P  L+   N+G +    + +D     Y  AL         LS N  +   ++         + Y QG +       D A   Y++ +   P + D +  L    +++G + +A + +  AL++   H DS + +  +   K E G                       P  K  F F  R +P   D ++N+       NTL        KE +  + AL  Y   ++++P    A   + ++    G I EA   +    +   DFPD + N+AH           +Q+    +  F+   N   LL     HF+  CD
Sbjct:   87 MLAEAYSNLGNVYKERGQLQEAIEHYRHALRLKPD-FIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLL---KALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTL--------DPNFLDAYINLGNVLKEARIFDRAVAGYLRALS--------LSPNHAVVHGNL-------ACVYYEQGLI-------DLAIDTYRRAIELQPHFPDAYCNLANALKEKGNVSEAEECYNTALRLCPTHADSLNNLANI---KREQGNIEEAVQLYRKALEAERIVRLHVPVSKHLFLFHFRISPTFADAYSNMG------NTL--------KEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAH----------CLQVLLTSVFIFSSTPNYRFLLSFDLLHFQIVCD 492          
BLAST of RNA polymerase-associated protein CTR9 homolog vs. Ensembl Medaka
Match: ogt.1 (O-linked N-acetylglucosamine (GlcNAc) transferase [Source:NCBI gene;Acc:101164571])

HSP 1 Score: 61.2326 bits (147), Expect = 6.301e-9
Identity = 85/378 (22.49%), Postives = 150/378 (39.68%), Query Frame = 3
Query:  981 DEAFQYYYQATQFASNNFVMPFYGLGQMYLCRKDIENAISSFEKVLKVYPNNYETLKILGSLYAQSDKEDRREQAKKMFQNVTEIEPDDLE-----AWIEYAQLLKDDTASSLEAYTKAINLLRQENLDIPPEILNNVGVLHHMRKNYDETRKYYSEALERIEEVKTELSNNQDIKQDDVNYYIGLSVTINYNQGRLFEAEYQTDEADLLYKKILTQFPEYLDCHLRLGCMSRDRGQIYDASDWFKDALKVNQDHPDSWSLMGMLHLSKSEAGPAQKKFEFIVRQNPNDIFANVALGNIWLNTLFHPSRDKEKEKRHQERALTHYRNVLRVDPKNILAAHGIGAVLAHKGYINEARDVFAQVREATADFPDVWINIAH 2099
            +EA   Y +A +    NF + +  LG ++  + +I  AI  FEK + + PN  +    LG++  ++   DR   A   +     + P+        A + Y Q L D    +++ Y +AI L  Q +    P+   N+      + N  E  + Y+ AL         L+N  +IK++               QG +       +EA  LY+K L  FPE+   H  L  + + +G++ +A   +K+A++++    D++S MG                                      NTL        KE +  + AL  Y   ++++P    A   + ++    G I EA   +    +   DFPD + N+AH
Sbjct:  136 EEAKACYLKAIE-TQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDR---AVAGYLRALSLSPNHAVVHGNLACVYYEQGLID---LAIDTYRRAIEL--QPHF---PDAYCNLANALKEKGNVSEAEECYNTALRLCPTHADSLNNLANIKRE---------------QGNI-------EEAVQLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMG--------------------------------------NTL--------KEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAH 433          

HSP 2 Score: 58.5362 bits (140), Expect = 4.701e-8
Identity = 70/299 (23.41%), Postives = 124/299 (41.47%), Query Frame = 3
Query: 1647 LGCMSRDRGQIYDASDWFKDALKVNQDHPDSWSLMGMLHLSKSEAGPAQKKFEFIVRQNPNDIFANVALGNIWLNTLFHPSRDKEKEKRHQERALTHYRNVLRVDPKNILAAHGIGAVLAHKGYINEARDVFAQVREATADFPDVWINIAHIYVEQKQYLAAIQMYENCIKKFNKQTNTELLLYLARAHFKCDQLKKCKQVLLKARHIAPWDPLIAYNLAFVQK------------RWALSVVP---DEKSNFSSVLEGINDLNMA-QCTFKYL--------------SILKDQINIPQ 2453
            LG + +  G++ +A   +  A++   +   +WS +G +  ++ E   A   FE  V  +PN + A + LGN+             KE R  +RA+  Y   L + P + +    +  V   +G I+ A D + +  E    FPD + N+A+   E+     A + Y   ++     T+ + L  LA    +   +++  Q+  KA  + P       NLA V +            + A+ + P   D  SN  + L+ + D+  A QC  + +              SI KD  NIP+
Sbjct:  125 LGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVL------------KEARIFDRAVAGYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANALKEKGNVSEAEECYNTALRLC--PTHADSLNNLANIKREQGNIEEAVQLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPE 409          
BLAST of RNA polymerase-associated protein CTR9 homolog vs. Ensembl Medaka
Match: bbs4 (Bardet-Biedl syndrome 4 [Source:NCBI gene;Acc:101165958])

HSP 1 Score: 56.6102 bits (135), Expect = 1.228e-7
Identity = 48/200 (24.00%), Postives = 87/200 (43.50%), Query Frame = 3
Query: 1683 DASDWFKDALKVNQDHPDSWSLMGMLHLSKSEAGPAQKKFEFIVRQNPNDIFANVALGNIWLNTLFHPSRDKEKEKRHQERALTHYRNVLRVDPKNILAAHGIGAVLAHKGYINEARDVFAQVREATADFPDVWINIAHIYVEQKQYLAAIQMYENCIKKFNKQT--NTELLLYLARAHFKCDQLKKCKQVLLKARHIAP 2276
            +A +    AL++N+ H  ++ ++G +HL   E   A + F+  V  +P +      LG ++L            + R  ++A  H  N L  DP N  A    G+++   G  + A + +     A  + P +W NI   +  +K+Y+AAI    +C+K+ N  +  + ++L  L   H    Q       L  A  + P
Sbjct:  192 NAEEHLNTALQINK-HDKTFMMLGKVHLVAGETDKAIEVFKRAVEFSPENTEHLSTLGLLYL------------QLRKYQKAFEHLGNALTFDPNNYKAILAAGSMMQTHGDFDVAMNKYRVAACAVPESPPLWNNIGMCFFGKKKYVAAI----SCLKRANYLSPFDWKVLYNLGLVHLTMQQYASAFHFLSAAISLNP 374          
BLAST of RNA polymerase-associated protein CTR9 homolog vs. Planmine SMEST
Match: SMESG000059268.1 (SMESG000059268.1)

HSP 1 Score: 2033.84 bits (5268), Expect = 0.000e+0
Identity = 1147/1148 (99.91%), Postives = 1147/1148 (99.91%), Query Frame = 3
Query:   21 MTTIEIPLRDTDEVIELDTDAFPDVDEVLNILKQEVAPMHVWILVALEYYRSKKYNDFVKVLNEANIHASVTYADSEKDQVKVLDMLANYYVKQASXXXXXXXXXXLFGQAAVHFTTADRIAMFDHNHLLSRAFFFLFEGDNWSQVDNQLNFVLNSSPNNVPALLGKSCIAFNKKEYRSALSFYRKALRNHPKCPASVRLGMGHCFFRLGNLEKAKFAFERALALDPECXXXXXXXXXXELNEKTLESVHHGVQKLSKAYMKDSNNPMVLNHLADHFFYAQQYKKVHTLALHAFHYTENELMRAQSCYQIARGFHKEENYDEAFQYYYQATQFASNNFVMPFYGLGQMYLCRKDIENAISSFEKVLKVYPNNYETLKILGSLYAQSDKEDRREQAKKMFQNVTEIEPDDLEAWIEYAQLLKDDTASSLEAYTKAINLLRQENLDIPPEILNNVGVLHHMRKNYDETRKYYSEALERIEEVKTELSNNQDIKQDDVNYYIGLSVTINYNQGRLFEAEYQTDEADLLYKKILTQFPEYLDCHLRLGCMSRDRGQIYDASDWFKDALKVNQDHPDSWSLMGMLHLSKSEAGPAQKKFEFIVRQNPNDIFANVALGNIWLNTLFHPSRDKEKEKRHQERALTHYRNVLRVDPKNILAAHGIGAVLAHKGYINEARDVFAQVREATADFPDVWINIAHIYVEQKQYLAAIQMYENCIKKFNKQTNTELLLYLARAHFKCDQLKKCKQVLLKARHIAPWDPLIAYNLAFVQKRWALSVVPDEKSNFSSVLEGINDLNMAQCTFKYLSILKDQINIPQLPNEIKDCQDLLSQARYYLDRATKREQQERYMRQKQVEERESIXXXXXXXXXXXXXXXXXXXXXXXXXXXXFIEKAGPXXXXXXXXXXXXXXXXXAGQKRIKTEEFIXXXXXXXXXXXRVDTGGEPVKKKIXXXXXXXXXXXXXXLQNADMADNNRGNRPKVISKETVXXXXXXXXXXXXXEMQLDASNRSKPKPTAVPVNIDQSSSDENEEANKSIXXXXXXXXXXXXXRKRKAQLQQPXXXXXXXXXXXRQLLESDSESQQENERRNGMMDYSSEEEVGNVVIQTTQTKSLKAVVXXXXXXXXXXXXXXXXXXXXXXXXQVSRMRMMQENESDSA 3464
            MTTIEIPLRDTDEVIELDTDAFPDVDEVLNILKQEVAPMHVWILVALEYYRSKKYNDFVKVLNEANIHASVTYADSEKDQVKVLDMLANYYVKQASKEKTKEKKRELFGQAAVHFTTADRIAMFDHNHLLSRAFFFLFEGDNWSQVDNQLNFVLNSSPNNVPALLGKSCIAFNKKEYRSALSFYRKALRNHPKCPASVRLGMGHCFFRLGNLEKAKFAFERALALDPECVGALVGLAVLELNEKTLESVHHGVQKLSKAYMKDSNNPMVLNHLADHFFYAQQYKKVHTLALHAFHYTENELMRAQSCYQIARGFHKEENYDEAFQYYYQATQFASNNFVMPFYGLGQMYLCRKDIENAISSFEKVLKVYPNNYETLKILGSLYAQSDKEDRREQAKKMFQNVTEIEPDDLEAWIEYAQLLKDDTASSLEAYTKAINLLRQENLDIPPEILNNVGVLHHMRKNYDETRKYYSEALERIEEVKTELSNNQDIKQDDVNYYIGLSVTINYNQGRLFEAEYQTDEADLLYKKILTQFPEYLDCHLRLGCMSRDRGQIYDASDWFKDALKVNQDHPDSWSLMGMLHLSKSEAGPAQKKFEFIVRQNPNDIFANVALGNIWLNTLFHPSRDKEKEKRHQERALTHYRNVLRVDPKNILAAHGIGAVLAHKGYINEARDVFAQVREATADFPDVWINIAHIYVEQKQYLAAIQMYENCIKKFNKQTNTELLLYLARAHFKCDQLKKCKQVLLKARHIAPWDPLIAYNLAFVQKRWALSVVPDEKSNFSSVLEGINDLNMAQCTFKYLSILKDQINIPQLPNEIKDCQDLLSQARYYLDRATKREQQERYMRQKQVEERESIRKTQLTKQQEEENLKLEREKKLEEERNKFIEKAGPKIIIENKTEQTTKKEKKAGQKRIKTEEFIDNNQSSNSDDNRVDTGGEPVKKKIRKDRGGKTKSKKKRLQN DMADNNRGNRPKVISKETVSDSDDDSSANSNDEMQLDASNRSKPKPTAVPVNIDQSSSDENEEANKSIGDGDDDDNSSSSSRKRKAQLQQPHKSSKSKHAKKRQLLESDSESQQENERRNGMMDYSSEEEVGNVVIQTTQTKSLKAVVEDSTSSESEEDKKNSSEKGEESDEQVSRMRMMQENESDSA
Sbjct:    1 MTTIEIPLRDTDEVIELDTDAFPDVDEVLNILKQEVAPMHVWILVALEYYRSKKYNDFVKVLNEANIHASVTYADSEKDQVKVLDMLANYYVKQASKEKTKEKKRELFGQAAVHFTTADRIAMFDHNHLLSRAFFFLFEGDNWSQVDNQLNFVLNSSPNNVPALLGKSCIAFNKKEYRSALSFYRKALRNHPKCPASVRLGMGHCFFRLGNLEKAKFAFERALALDPECVGALVGLAVLELNEKTLESVHHGVQKLSKAYMKDSNNPMVLNHLADHFFYAQQYKKVHTLALHAFHYTENELMRAQSCYQIARGFHKEENYDEAFQYYYQATQFASNNFVMPFYGLGQMYLCRKDIENAISSFEKVLKVYPNNYETLKILGSLYAQSDKEDRREQAKKMFQNVTEIEPDDLEAWIEYAQLLKDDTASSLEAYTKAINLLRQENLDIPPEILNNVGVLHHMRKNYDETRKYYSEALERIEEVKTELSNNQDIKQDDVNYYIGLSVTINYNQGRLFEAEYQTDEADLLYKKILTQFPEYLDCHLRLGCMSRDRGQIYDASDWFKDALKVNQDHPDSWSLMGMLHLSKSEAGPAQKKFEFIVRQNPNDIFANVALGNIWLNTLFHPSRDKEKEKRHQERALTHYRNVLRVDPKNILAAHGIGAVLAHKGYINEARDVFAQVREATADFPDVWINIAHIYVEQKQYLAAIQMYENCIKKFNKQTNTELLLYLARAHFKCDQLKKCKQVLLKARHIAPWDPLIAYNLAFVQKRWALSVVPDEKSNFSSVLEGINDLNMAQCTFKYLSILKDQINIPQLPNEIKDCQDLLSQARYYLDRATKREQQERYMRQKQVEERESIRKTQLTKQQEEENLKLEREKKLEEERNKFIEKAGPKIIIENKTEQTTKKEKKAGQKRIKTEEFIDNNQSSNSDDNRVDTGGEPVKKKIRKDRGGKTKSKKKRLQNVDMADNNRGNRPKVISKETVSDSDDDSSANSNDEMQLDASNRSKPKPTAVPVNIDQSSSDENEEANKSIGDGDDDDNSSSSSRKRKAQLQQPHKSSKSKHAKKRQLLESDSESQQENERRNGMMDYSSEEEVGNVVIQTTQTKSLKAVVEDSTSSESEEDKKNSSEKGEESDEQVSRMRMMQENESDSA 1148          
BLAST of RNA polymerase-associated protein CTR9 homolog vs. Planmine SMEST
Match: SMESG000002813.1 (SMESG000002813.1)

HSP 1 Score: 72.4034 bits (176), Expect = 1.837e-12
Identity = 97/456 (21.27%), Postives = 182/456 (39.91%), Query Frame = 3
Query:  807 DSNNPMVLNHLADHFFYAQQYKKVHTLALHAFHYTENELMRAQSCYQIARGFHKEENYDEAFQYYYQATQFASNNFVMPFYGLGQMYLCRKDIENAISSFEKVLKVYPNNYETLKILGSLYAQSDKEDRREQAKKMFQNVTEIEPDDLEAWIEYAQLL--KDDTASSLEAYTKAINLLRQENLDIPPEILN---NVGVLHHMRKNYDETRKYYSEALERIEEVKTELSNNQDIKQDDVNYYIGLSVTINYNQGRLFEAEYQTDEADLLYKKILTQFPEYLDCHLRLGCMSRDRGQIYDASDWFKDALKVNQDHPDSWSLMGMLHLSKSEAGPAQKKFEFIVRQNPNDIFANVALGNIWLNTLFHPSRDKEKEKRHQERALTHYRNVLRVDPKNILAAHGIGAVLAHKGYINEARDVFAQVREATADFPDVWINIAHIYVEQKQYLAAIQMYENCIK 2159
            D NN  +L  L+  +F   Q KK+   A       +     A++   +   F ++    EA  +Y QA Q   N F+  +  L   ++   +++NAIS++  VL   P  Y     LG+L+    K    E+AK  +    E  P    AW     +   + D   ++  + KA+ L         P  L+   N+G +    K +D     Y++AL         L ++  I   ++         + Y QG L++    +      Y+K +   P + D +  L    +++G + +A   +  AL++N +H DS + +  +   K E G  ++     + +   +I+   A+ +  L ++        + + H + AL HYR  +++ P    A   +G        +  A   + +  +    F D   N+A +Y +      AI  Y   +K
Sbjct:   41 DPNNSAILLFLSSVYF---QLKKLDKSAFFCQLAIKQNPQMAEAYSNLGNVFKEKGQLIEAISFYKQALQLKPN-FIDAYINLASAFVAAGNLDNAISTYILVLNHNPELYHVRSELGNLFKALGK---LEEAKSCYLKAIETYPAFAVAWSNVGCIFNAQGDIWLAIHHFEKAVTL--------DPNFLDAHVNLGHVFKEAKIFDRAVAAYTKALT--------LDSDNPILHGNL-------ACVYYEQG-LYDLAIDS------YRKAIELQPNFPDAYCNLANALKEKGNVLEAEKCYNTALRLNPNHADSLNNLANI---KREQGLNEEAMN--LYKKALEIYPEFAVAHSNLASML-------QLQGHLQSALNHYREAIKISPNFADAYSNMGNTFKELQDLPNAVQCYQRAIQIKPTFADAHSNLASVYKDTGNINEAIGSYTTALK 447          

HSP 2 Score: 60.4622 bits (145), Expect = 9.753e-9
Identity = 76/350 (21.71%), Postives = 133/350 (38.00%), Query Frame = 3
Query: 1110 KVLKVYPNNYETLKILGSLYAQSDKEDRREQAKKMFQNVTEIEPDDLEAWIEYAQLLKDDTASSLEAYTKAINLLRQENLDIPPEILNNVGVLHHMRKNYDETRKYYSEALERIEEVKTELSNNQDIKQDDVNYYIGLSVTINYNQGRLFEAEYQTDEADLLYKKILTQFPEYLDCHLRLGCMSRDRGQIYDASDWFKDALKVNQDHPDSWSLMGMLHLSKSEAGPAQKKFEFIVRQNPNDIFANVALGNIWLNTLFHPSRDKEKEKRHQERALTHYRNVLRVDPKNILAAHGIGAVLAHKGYINEARDVFAQVREATADFPDVWINIAHIYVEQKQYLAAIQMYENCIK 2159
            ++ K+ PNN   L  L S+Y Q  K D     K  F                + QL         EAY+   N+ +++   I                   E   +Y +AL+              +K + ++ YI L+          F A    D A   Y  +L   PE       LG + +  G++ +A   +  A++       +WS +G +  ++ +   A   FE  V  +PN + A+V LG+++            KE +  +RA+  Y   L +D  N +    +  V   +G  + A D + +  E   +FPD + N+A+   E+   L A + Y   ++
Sbjct:   36 EIWKLDPNNSAILLFLSSVYFQLKKLD-----KSAF----------------FCQLAIKQNPQMAEAYSNLGNVFKEKGQLI-------------------EAISFYKQALQ--------------LKPNFIDAYINLASA--------FVAAGNLDNAISTYILVLNHNPELYHVRSELGNLFKALGKLEEAKSCYLKAIETYPAFAVAWSNVGCIFNAQGDIWLAIHHFEKAVTLDPNFLDAHVNLGHVF------------KEAKIFDRAVAAYTKALTLDSDNPILHGNLACVYYEQGLYDLAIDSYRKAIELQPNFPDAYCNLANALKEKGNVLEAEKCYNTALR 311          
BLAST of RNA polymerase-associated protein CTR9 homolog vs. Planmine SMEST
Match: SMESG000004465.1 (SMESG000004465.1)

HSP 1 Score: 67.3958 bits (163), Expect = 4.738e-11
Identity = 81/344 (23.55%), Postives = 144/344 (41.86%), Query Frame = 3
Query: 1443 ERIEEVKTELSNNQDIKQDDVNYYIGLSVTINYNQGRLFEAEYQTDEADLLYKKILTQFPEYLDCHLRLGCMSRDRGQIYDASDWFKDALKVNQDHPDSWSLMGMLHLSKSEAGPAQKKFEFIVRQNPNDIFANVALGNIWLNTLFHPSRDKEKEKRHQERALTHYRNVLRVDPKNILAAHGIGAVLAHKGYINEARDVFAQVREATADFPDVWINIAHIYVEQKQYLAAIQMYENCIKKFNKQTNTELLLYLARAHFKCDQLKKCKQVLLKARHIAPWDPLIAYNL------------AFVQKRWALSVVP---DEKSNFSSVLEGINDLNMA-QCTFKYLSI 2426
            E IE  K  L     IK + ++ Y+ L+          F A    + A   Y  +L   P+       LG + +  G++ +A   +  A++       +WS +G +  ++SE   A   FE  V  +PN + A + LGN++            KE R  +RA+T Y   L + P N +    +  V   +  +  A D + +  E   +FPD + N+A+   E+ +   A + Y   ++   + T+ + L  LA    +    ++  Q+ ++A  I P   +   NL            A +  R A+ + P   D  SN  + L+ + D+N A QC  + + I
Sbjct:   99 EAIENYKHALR----IKPEFIDGYLNLAAA--------FVAAGHMESAISTYMIVLNNNPDLYYVRSDLGNLFKALGRLDEAKSCYLKAIETCPQFAVAWSNLGCVFNAQSEIWLAIHHFEKAVSLDPNFLDAYLNLGNVF------------KEARIFDRAVTAYLKALNLAPNNAIIHGNLACVYYEQNLVELAIDTYKRAIELQPNFPDAYCNLANALKEKGKVSEAEECYNTALRL--QPTHADSLNNLANIKREQCHSEEAMQLYVRALEIYPEFAVAHSNLASMLQLQGKLNEALMHYREAIRISPNFADAYSNMGNTLKEMQDINGAMQCYQRAIQI 416          

HSP 2 Score: 60.4622 bits (145), Expect = 6.064e-9
Identity = 95/441 (21.54%), Postives = 183/441 (41.50%), Query Frame = 3
Query:  492 PNNVPALLGKSCIAFNKKEYRSALSFYRKALRNHPKCPASVRLGMGHCFFRLGNLEKAKFAFERALALDPECXXXXXXXXXXELNEKTLESVHHGVQKLSKAYMKDSNNP---MVLNHLADHFFYAQQYKKVHTLALHAFHYTENELMRAQSCYQIARG-------FHKEENYDEAFQYYYQATQFASNNFVMPFYGLGQMYLCRKDIENAISSFEKVLKVYPNNYETLKILGSLYAQSDKEDRREQAKKMFQNVTEIEPDDLEAWIEYAQLLKDD--TASSLEAYTKAINLLRQENLDIPPEILNNVGVLHHMRKNYDETRKYYSEALERIEEVKTELSNNQDIKQDD-------VNYYIGLSVTINY-----NQGRLFEAEYQTDEADLLYKKILTQFPEYLDCHLRLGCMSRDRGQIYDASDWFKDALKVNQDHPDSW 1742
            P+N   LL  S I F  ++   +  F + A++ +P+  A     +G+     G L +A   ++ AL + PE +   + LA   +    +ES       +S   +  +NNP    V + L + F    +  +  +  L A           ++C Q A         F+ +     A  ++ +A      NF+  +  LG ++   +  + A++++ K L + PNN     I G+L     +++  E A   ++   E++P+  +A+   A  LK+    + + E Y  A+ L          + LNN+  +   + + +E  + Y  ALE   E     SN   + Q         ++Y   + ++ N+     N G   +     + A   Y++ +   P + D H  L  + +D G I DA   +K ALK+  ++ D++
Sbjct:   44 PHNTAILLLLSSIYFQMRKLDKSGFFCQLAIKQNPQM-AEAYSNLGNVLKEKGQLAEAIENYKHALRIKPEFIDGYLNLAAAFVAAGHMESA------ISTYMIVLNNNPDLYYVRSDLGNLFKALGRLDEAKSCYLKAI----------ETCPQFAVAWSNLGCVFNAQSEIWLAIHHFEKAVSL-DPNFLDAYLNLGNVFKEARIFDRAVTAYLKALNLAPNN---AIIHGNLACVYYEQNLVELAIDTYKRAIELQPNFPDAYCNLANALKEKGKVSEAEECYNTALRLQPTH-----ADSLNNLANIKREQCHSEEAMQLYVRALEIYPEFAVAHSNLASMLQLQGKLNEALMHYREAIRISPNFADAYSNMGNTLKEMQDINGAMQCYQRAIQINPTFADAHSNLASIYKDTGNINDAISSYKTALKIKPNYHDAF 458          
The following BLAST results are available for this feature:
BLAST of RNA polymerase-associated protein CTR9 homolog vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CTR90.000e+058.53CTR9 homolog, Paf1/RNA polymerase II complex compo... [more]
CTR94.701e-11156.55CTR9 homolog, Paf1/RNA polymerase II complex compo... [more]
TMTC31.768e-921.02transmembrane O-mannosyltransferase targeting cadh... [more]
OGT3.723e-820.40O-linked N-acetylglucosamine (GlcNAc) transferase ... [more]
OGT3.896e-820.40O-linked N-acetylglucosamine (GlcNAc) transferase ... [more]
back to top
BLAST of RNA polymerase-associated protein CTR9 homolog vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ctr-90.000e+040.69RNA polymerase-associated protein CTR9 [Source:Un... [more]
ogt-14.541e-821.27UDP-N-acetylglucosamine--peptide N-acetylglucosami... [more]
ogt-14.541e-821.27UDP-N-acetylglucosamine--peptide N-acetylglucosami... [more]
ogt-16.733e-823.70UDP-N-acetylglucosamine--peptide N-acetylglucosami... [more]
back to top
BLAST of RNA polymerase-associated protein CTR9 homolog vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ctr90.000e+056.29gene:FBgn0035205 transcript:FBtr0072668[more]
Ctr90.000e+056.29gene:FBgn0035205 transcript:FBtr0072669[more]
CG98992.032e-7925.81gene:FBgn0034829 transcript:FBtr0071969[more]
sxc5.372e-1020.92gene:FBgn0261403 transcript:FBtr0086085[more]
sxc5.372e-1020.92gene:FBgn0261403 transcript:FBtr0086084[more]
back to top
BLAST of RNA polymerase-associated protein CTR9 homolog vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ctr90.000e+058.18CTR9 homolog, Paf1/RNA polymerase II complex compo... [more]
ogt.14.545e-922.34O-linked N-acetylglucosamine (GlcNAc) transferase,... [more]
ogt.14.706e-922.34O-linked N-acetylglucosamine (GlcNAc) transferase,... [more]
ogt.15.139e-922.34O-linked N-acetylglucosamine (GlcNAc) transferase,... [more]
ogt.15.653e-922.34O-linked N-acetylglucosamine (GlcNAc) transferase,... [more]
back to top
BLAST of RNA polymerase-associated protein CTR9 homolog vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ctr90.000e+057.73CTR9 homolog, Paf1/RNA polymerase II complex compo... [more]
ctr90.000e+057.73CTR9 homolog, Paf1/RNA polymerase II complex compo... [more]
ctr90.000e+057.73CTR9 homolog, Paf1/RNA polymerase II complex compo... [more]
ctr90.000e+057.73CTR9 homolog, Paf1/RNA polymerase II complex compo... [more]
ctr90.000e+057.66CTR9 homolog, Paf1/RNA polymerase II complex compo... [more]
back to top
BLAST of RNA polymerase-associated protein CTR9 homolog vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Ctr90.000e+058.53CTR9 homolog, Paf1/RNA polymerase II complex compo... [more]
Ogt2.396e-820.40O-linked N-acetylglucosamine (GlcNAc) transferase ... [more]
Ogt2.492e-820.40O-linked N-acetylglucosamine (GlcNAc) transferase ... [more]
Tmtc35.017e-821.83transmembrane and tetratricopeptide repeat contain... [more]
back to top
BLAST of RNA polymerase-associated protein CTR9 homolog vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q4QR29|CTR9_XENLA0.000e+058.51RNA polymerase-associated protein CTR9 homolog OS=... [more]
sp|Q62018|CTR9_MOUSE0.000e+058.53RNA polymerase-associated protein CTR9 homolog OS=... [more]
sp|Q6DEU9|CTR9_XENTR0.000e+058.53RNA polymerase-associated protein CTR9 homolog OS=... [more]
sp|Q6PD62|CTR9_HUMAN0.000e+058.53RNA polymerase-associated protein CTR9 homolog OS=... [more]
sp|Q03560|CTR9_CAEEL0.000e+040.69RNA polymerase-associated protein CTR9 OS=Caenorha... [more]
back to top
BLAST of RNA polymerase-associated protein CTR9 homolog vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A183MSF90.000e+064.10TPR_REGION domain-containing protein OS=Schistosom... [more]
G4V9B20.000e+063.99Putative tpr repeat nuclear phosphoprotein OS=Schi... [more]
A0A4E0RCQ60.000e+062.89RNA polymerase-associated protein CTR9 OS=Fasciola... [more]
A0A4S2LNK80.000e+062.83TPR_REGION domain-containing protein OS=Opisthorch... [more]
A0A504Y4580.000e+063.14RNA polymerase-associated protein CTR9 (Fragment) ... [more]
back to top
BLAST of RNA polymerase-associated protein CTR9 homolog vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ctr90.000e+058.64CTR9 homolog, Paf1/RNA polymerase II complex compo... [more]
ctr90.000e+058.64CTR9 homolog, Paf1/RNA polymerase II complex compo... [more]
ctr90.000e+058.08CTR9 homolog, Paf1/RNA polymerase II complex compo... [more]
ogt.11.548e-923.48O-linked N-acetylglucosamine (GlcNAc) transferase ... [more]
ogt.13.876e-922.34O-linked N-acetylglucosamine (GlcNAc) transferase ... [more]
back to top
BLAST of RNA polymerase-associated protein CTR9 homolog vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ctr90.000e+056.74CTR9 homolog, Paf1/RNA polymerase II complex compo... [more]
ogt.12.116e-1023.20O-linked N-acetylglucosamine (GlcNAc) transferase,... [more]
back to top
BLAST of RNA polymerase-associated protein CTR9 homolog vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
CTR91.305e-3822.94Component of the Paf1p complex involved in transcr... [more]
back to top
BLAST of RNA polymerase-associated protein CTR9 homolog vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO342430.000e+055.40Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO470731.338e-920.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO287253.631e-920.93Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO420482.818e-722.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO339654.687e-725.65Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of RNA polymerase-associated protein CTR9 homolog vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ctr90.000e+059.00CTR9 homolog, Paf1/RNA polymerase II complex compo... [more]
ogt.13.632e-922.34O-linked N-acetylglucosamine (GlcNAc) transferase ... [more]
ogt.16.133e-920.56O-linked N-acetylglucosamine (GlcNAc) transferase ... [more]
ogt.16.301e-922.49O-linked N-acetylglucosamine (GlcNAc) transferase ... [more]
bbs41.228e-724.00Bardet-Biedl syndrome 4 [Source:NCBI gene;Acc:1011... [more]
back to top
BLAST of RNA polymerase-associated protein CTR9 homolog vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000059268.10.000e+099.91SMESG000059268.1[more]
SMESG000002813.11.837e-1221.27SMESG000002813.1[more]
SMESG000004465.14.738e-1123.55SMESG000004465.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028145 ID=SMED30028145|Name=RNA polymerase-associated protein CTR9 homolog|organism=Schmidtea mediterranea sexual|type=transcript|length=3677bp
CTATATAAATCTTATATGTAATGACCACAATCGAAATACCATTGCGTGAC
ACTGATGAAGTTATCGAATTAGACACAGATGCATTTCCAGATGTTGATGA
AGTTCTTAATATATTAAAGCAAGAAGTTGCTCCTATGCATGTTTGGATTT
TAGTGGCTTTGGAATATTATCGGTCAAAAAAATATAATGACTTCGTGAAA
GTTTTGAATGAAGCTAATATACATGCTTCTGTAACGTATGCCGATTCAGA
AAAAGATCAAGTTAAAGTGTTGGATATGCTTGCAAATTATTACGTAAAGC
AAGCATCTAAAGAAAAGACAAAGGAAAAGAAGAGAGAATTATTTGGCCAA
GCTGCTGTTCACTTTACAACTGCTGATAGAATCGCTATGTTTGATCATAA
CCATTTGTTAAGCAGAGCATTCTTTTTTCTCTTTGAAGGCGATAATTGGT
CACAAGTAGATAATCAGTTAAATTTTGTATTGAATTCATCCCCAAATAAT
GTTCCTGCTTTACTGGGTAAAAGTTGTATAGCATTTAACAAAAAAGAATA
TCGTTCTGCACTTTCATTCTATAGAAAAGCTTTAAGAAATCATCCAAAAT
GTCCGGCCTCAGTGAGATTAGGGATGGGTCATTGTTTTTTTCGATTAGGA
AATTTAGAAAAGGCTAAGTTTGCTTTTGAAAGAGCATTAGCTCTTGATCC
TGAATGCGTTGGTGCTCTTGTGGGATTAGCTGTCTTAGAGTTGAATGAAA
AAACTTTAGAAAGTGTTCATCATGGCGTTCAAAAATTGTCTAAAGCGTAT
ATGAAGGATAGTAATAATCCAATGGTTCTTAATCATCTGGCGGATCATTT
CTTTTATGCACAACAATATAAAAAAGTCCATACATTGGCTCTACATGCCT
TTCATTATACAGAAAATGAATTGATGCGTGCTCAGAGTTGTTATCAAATT
GCTAGAGGATTTCACAAAGAAGAGAATTATGACGAAGCTTTCCAATATTA
CTATCAAGCTACTCAATTCGCTTCTAATAATTTTGTAATGCCTTTTTACG
GTCTTGGTCAAATGTATTTATGTCGAAAAGATATTGAAAACGCAATATCT
TCCTTTGAAAAAGTTCTAAAAGTGTATCCGAATAATTATGAAACCCTTAA
AATACTTGGAAGTTTATATGCACAGTCGGACAAAGAAGACCGCCGTGAGC
AGGCTAAAAAAATGTTTCAAAATGTTACGGAAATAGAACCCGATGACCTA
GAAGCCTGGATTGAGTACGCTCAATTATTGAAGGACGATACTGCGTCTTC
GCTAGAAGCTTACACAAAAGCCATAAATTTGTTACGACAGGAAAATTTGG
ATATTCCACCGGAAATTCTCAACAATGTCGGTGTTTTACATCACATGCGT
AAGAATTATGATGAAACAAGGAAATATTACTCTGAAGCTTTGGAAAGAAT
TGAGGAAGTGAAAACAGAATTGTCGAACAATCAAGATATCAAACAGGACG
ATGTTAATTACTACATTGGGTTATCTGTGACAATCAATTACAATCAAGGC
CGTTTGTTTGAAGCCGAATATCAAACCGACGAAGCGGATTTGTTATATAA
AAAGATTTTAACCCAATTCCCGGAATATCTCGATTGCCATTTGAGATTGG
GCTGTATGTCACGTGATCGTGGTCAGATTTATGACGCTTCTGATTGGTTT
AAAGATGCATTGAAAGTAAATCAAGACCACCCGGACTCATGGTCACTGAT
GGGAATGCTCCATTTGAGTAAAAGTGAAGCGGGACCGGCACAAAAGAAAT
TTGAATTCATCGTTCGACAGAATCCTAACGATATTTTCGCTAACGTTGCT
CTGGGAAACATATGGTTGAATACTCTGTTTCACCCGTCTCGGGATAAAGA
GAAAGAGAAAAGACATCAGGAAAGAGCCCTAACCCATTACCGAAATGTCT
TGCGTGTTGATCCGAAAAATATCCTTGCAGCACACGGTATCGGAGCGGTT
TTGGCACATAAAGGTTACATAAATGAAGCGAGAGATGTTTTTGCTCAAGT
AAGAGAAGCCACGGCAGATTTTCCAGATGTTTGGATCAATATTGCCCACA
TCTACGTTGAACAGAAACAGTATTTGGCTGCGATTCAAATGTATGAGAAT
TGCATCAAGAAGTTTAATAAACAAACCAATACGGAACTCCTATTATATCT
GGCTAGAGCGCATTTCAAATGCGATCAATTGAAAAAATGCAAACAAGTAC
TATTAAAGGCTCGTCATATCGCTCCTTGGGATCCGTTAATTGCATACAAT
TTGGCATTTGTGCAGAAGCGGTGGGCGTTGTCAGTTGTGCCGGATGAGAA
AAGTAATTTCTCGTCTGTGCTTGAAGGAATTAATGATTTAAATATGGCCC
AATGCACATTCAAATACCTCAGCATATTGAAAGACCAAATCAATATTCCA
CAACTGCCAAATGAAATCAAAGACTGTCAGGATCTTTTGAGTCAAGCCCG
TTATTATCTAGACAGAGCAACGAAACGCGAACAACAGGAGCGATATATGA
GACAGAAACAGGTTGAGGAACGGGAATCGATTAGAAAAACACAGCTGACC
AAGCAGCAGGAAGAGGAGAATCTGAAATTAGAAAGAGAAAAGAAACTTGA
AGAGGAACGTAACAAATTCATTGAGAAAGCTGGTCCCAAAATTATAATTG
AGAATAAAACTGAGCAAACAACGAAGAAAGAAAAGAAAGCCGGCCAGAAA
CGGATTAAAACTGAGGAGTTTATCGATAATAACCAATCGAGTAACAGTGA
CGATAATCGGGTCGATACCGGTGGTGAGCCAGTAAAAAAGAAAATCCGCA
AAGATCGTGGCGGAAAGACGAAATCGAAAAAGAAACGGCTGCAAAACGCG
GATATGGCTGACAATAACCGTGGAAACCGGCCGAAAGTCATCAGCAAGGA
AACGGTATCCGATAGCGACGATGATTCGAGTGCCAATTCAAACGATGAAA
TGCAATTGGATGCTAGCAATCGATCGAAACCGAAACCAACGGCAGTGCCG
GTGAATATTGATCAATCGTCGAGTGATGAAAACGAGGAAGCGAATAAATC
GATTGGCGATGGTGACGACGACGACAATTCCTCGTCGAGCAGCAGGAAGC
GCAAGGCACAACTGCAACAGCCTCACAAGTCGAGCAAATCAAAGCATGCG
AAAAAGAGGCAATTATTGGAGAGCGATTCTGAGTCACAACAGGAGAACGA
GCGGAGGAATGGGATGATGGATTACAGCAGTGAGGAGGAGGTGGGCAATG
TCGTGATTCAGACCACCCAGACGAAAAGTCTGAAAGCCGTTGTTGAAGAC
TCGACTAGTTCGGAAAGTGAGGAAGATAAGAAAAACTCCTCGGAAAAGGG
AGAGGAATCTGACGAGCAGGTCAGTCGGATGAGAATGATGCAGGAGAATG
AGAGCGATTCTGCATAGATTTTTTCATTGGGCAGTGTTAGAATTCTTGTG
TAAATAATCCATTATTCATTCTCTTGTCTTAGTTTTTGTTCAATAAAATG
TTCTATTTATAGATTGTGATTGCTGGAATTGACTTTTTGTGAAACTATTC
TCATTGGTCAATTAAATATTTGGGATTTTTTGAATAAAATTTTCATCATT
TACTTTCATTTTGTTTATTTTACGAAG
back to top

protein sequence of SMED30028145-orf-1

>SMED30028145-orf-1 ID=SMED30028145-orf-1|Name=SMED30028145-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1149bp
MTTIEIPLRDTDEVIELDTDAFPDVDEVLNILKQEVAPMHVWILVALEYY
RSKKYNDFVKVLNEANIHASVTYADSEKDQVKVLDMLANYYVKQASKEKT
KEKKRELFGQAAVHFTTADRIAMFDHNHLLSRAFFFLFEGDNWSQVDNQL
NFVLNSSPNNVPALLGKSCIAFNKKEYRSALSFYRKALRNHPKCPASVRL
GMGHCFFRLGNLEKAKFAFERALALDPECVGALVGLAVLELNEKTLESVH
HGVQKLSKAYMKDSNNPMVLNHLADHFFYAQQYKKVHTLALHAFHYTENE
LMRAQSCYQIARGFHKEENYDEAFQYYYQATQFASNNFVMPFYGLGQMYL
CRKDIENAISSFEKVLKVYPNNYETLKILGSLYAQSDKEDRREQAKKMFQ
NVTEIEPDDLEAWIEYAQLLKDDTASSLEAYTKAINLLRQENLDIPPEIL
NNVGVLHHMRKNYDETRKYYSEALERIEEVKTELSNNQDIKQDDVNYYIG
LSVTINYNQGRLFEAEYQTDEADLLYKKILTQFPEYLDCHLRLGCMSRDR
GQIYDASDWFKDALKVNQDHPDSWSLMGMLHLSKSEAGPAQKKFEFIVRQ
NPNDIFANVALGNIWLNTLFHPSRDKEKEKRHQERALTHYRNVLRVDPKN
ILAAHGIGAVLAHKGYINEARDVFAQVREATADFPDVWINIAHIYVEQKQ
YLAAIQMYENCIKKFNKQTNTELLLYLARAHFKCDQLKKCKQVLLKARHI
APWDPLIAYNLAFVQKRWALSVVPDEKSNFSSVLEGINDLNMAQCTFKYL
SILKDQINIPQLPNEIKDCQDLLSQARYYLDRATKREQQERYMRQKQVEE
RESIRKTQLTKQQEEENLKLEREKKLEEERNKFIEKAGPKIIIENKTEQT
TKKEKKAGQKRIKTEEFIDNNQSSNSDDNRVDTGGEPVKKKIRKDRGGKT
KSKKKRLQNADMADNNRGNRPKVISKETVSDSDDDSSANSNDEMQLDASN
RSKPKPTAVPVNIDQSSSDENEEANKSIGDGDDDDNSSSSSRKRKAQLQQ
PHKSSKSKHAKKRQLLESDSESQQENERRNGMMDYSSEEEVGNVVIQTTQ
TKSLKAVVEDSTSSESEEDKKNSSEKGEESDEQVSRMRMMQENESDSA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR031101Ctr9
IPR019734TPR_repeat
IPR003107HAT
IPR011990TPR-like_helical_dom_sf
IPR001440TPR_1
IPR013026TPR-contain_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: biological process
TermDefinition
GO:0006396RNA processing
GO:0006355regulation of transcription, DNA-templated
GO:0016570histone modification
Vocabulary: cellular component
TermDefinition
GO:0016593Cdc73/Paf1 complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 464..484
NoneNo IPR availableCOILSCoilCoilcoord: 855..888
NoneNo IPR availablePFAMPF13374TPR_10coord: 450..481
e-value: 0.0057
score: 16.5
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1020..1042
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 896..1149
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 896..918
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1047..1061
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 840..868
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1092..1111
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1112..1149
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 990..1019
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1062..1086
NoneNo IPR availableSUPERFAMILYSSF81901HCP-likecoord: 166..418
IPR019734Tetratricopeptide repeatSMARTSM00028tpr_5coord: 340..373
e-value: 3.3E-4
score: 30.0
coord: 504..537
e-value: 36.0
score: 10.1
coord: 162..195
e-value: 0.96
score: 18.5
coord: 197..230
e-value: 3.3E-6
score: 36.6
coord: 722..755
e-value: 130.0
score: 5.1
coord: 305..338
e-value: 0.0081
score: 25.4
coord: 686..719
e-value: 0.011
score: 24.9
coord: 374..410
e-value: 120.0
score: 5.5
coord: 538..571
e-value: 4.5
score: 16.3
coord: 572..605
e-value: 160.0
score: 4.4
coord: 448..481
e-value: 0.0092
score: 25.2
IPR019734Tetratricopeptide repeatPFAMPF13181TPR_8coord: 687..714
e-value: 0.0011
score: 19.1
coord: 305..337
e-value: 0.13
score: 12.5
coord: 163..191
e-value: 0.19
score: 12.0
coord: 344..373
e-value: 0.013
score: 15.6
IPR019734Tetratricopeptide repeatPROSITEPS50005TPRcoord: 618..651
score: 5.369
IPR019734Tetratricopeptide repeatPROSITEPS50005TPRcoord: 377..410
score: 5.9
IPR019734Tetratricopeptide repeatPROSITEPS50005TPRcoord: 305..338
score: 8.231
IPR019734Tetratricopeptide repeatPROSITEPS50005TPRcoord: 538..571
score: 6.903
IPR019734Tetratricopeptide repeatPROSITEPS50005TPRcoord: 340..373
score: 11.623
IPR019734Tetratricopeptide repeatPROSITEPS50005TPRcoord: 448..481
score: 7.788
IPR019734Tetratricopeptide repeatPROSITEPS50005TPRcoord: 162..195
score: 6.903
IPR019734Tetratricopeptide repeatPROSITEPS50005TPRcoord: 197..230
score: 11.358
IPR019734Tetratricopeptide repeatPROSITEPS50005TPRcoord: 504..537
score: 5.989
IPR019734Tetratricopeptide repeatPROSITEPS50005TPRcoord: 572..605
score: 7.847
IPR019734Tetratricopeptide repeatPROSITEPS50005TPRcoord: 686..719
score: 7.582
IPR019734Tetratricopeptide repeatPROSITEPS50005TPRcoord: 722..755
score: 5.015
IPR003107HAT (Half-A-TPR) repeatSMARTSM00386hat_new_1coord: 391..423
e-value: 19.0
score: 13.4
coord: 666..698
e-value: 210.0
score: 5.7
coord: 211..243
e-value: 54.0
score: 10.1
IPR011990Tetratricopeptide-like helical domain superfamilyGENE3DG3DSA:1.25.40.10coord: 628..778
e-value: 2.4E-21
score: 78.1
IPR011990Tetratricopeptide-like helical domain superfamilyGENE3DG3DSA:1.25.40.10coord: 25..292
e-value: 7.3E-23
score: 83.1
IPR011990Tetratricopeptide-like helical domain superfamilyGENE3DG3DSA:1.25.40.10coord: 501..627
e-value: 3.5E-13
score: 51.5
IPR011990Tetratricopeptide-like helical domain superfamilyGENE3DG3DSA:1.25.40.10coord: 293..392
e-value: 9.8E-23
score: 82.9
IPR011990Tetratricopeptide-like helical domain superfamilyGENE3DG3DSA:1.25.40.10coord: 393..497
e-value: 2.8E-10
score: 42.0
IPR011990Tetratricopeptide-like helical domain superfamilySUPERFAMILYSSF48452TPR-likecoord: 389..715
IPR001440Tetratricopeptide repeat 1PFAMPF00515TPR_1coord: 201..230
e-value: 9.9E-7
score: 28.3
IPR031101RNA polymerase-associated protein Ctr9PANTHERPTHR14027TPR REPEAT NUCLEAR PHOSPHOPROTEIN/CTR9coord: 2..1090
IPR013026Tetratricopeptide repeat-containing domainPROSITEPS50293TPR_REGIONcoord: 162..755
score: 50.525