Phosphoribosylformylglycinamidine synthase

Overview
NamePhosphoribosylformylglycinamidine synthase
Smed IDSMED30028144
Length (bp)4205
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Phosphoribosylformylglycinamidine synthase (SMED30028144) t-SNE clustered cells

Violin plots show distribution of expression levels for Phosphoribosylformylglycinamidine synthase (SMED30028144) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Phosphoribosylformylglycinamidine synthase (SMED30028144) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Phosphoribosylformylglycinamidine synthase (SMED30028144) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028144

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X2 cellSMED30028144SMESG000028663.1 SmedASXL_017595SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30028144SMESG000028663.1 dd_Smed_v4_5130_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30028144SMESG000028663.1 dd_Smed_v4_5130_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30028144SMESG000028663.1 dd_Smed_v4_5130_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30028144SMESG000028663.1 dd_Smed_v4_5130_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30028144SMESG000079285.1 SMESG000075221.1 SMESG000068853.1 SMESG000045075.1 SMESG000041559.1 SMESG000036247.1 SMESG000028663.1 SMESG000002595.1 SMESG000030970.1 Contig40240newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30028144SMESG000079285.1 SMESG000075221.1 SMESG000068853.1 SMESG000045075.1 SMESG000041559.1 SMESG000036247.1 SMESG000028663.1 SMESG000002595.1 SMESG000030970.1 Contig40240uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30028144SMESG000079285.1 SMESG000075221.1 SMESG000041559.1 SMESG000028663.1 Contig48646newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30028144SMESG000079285.1 SMESG000075221.1 SMESG000041559.1 SMESG000028663.1 Contig48646uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Phosphoribosylformylglycinamidine synthase vs. Ensembl Human
Match: PFAS (phosphoribosylformylglycinamidine synthase [Source:HGNC Symbol;Acc:HGNC:8863])

HSP 1 Score: 1187.56 bits (3071), Expect = 0.000e+0
Identity = 645/1271 (50.75%), Postives = 835/1271 (65.70%), Query Frame = 2
Query:  338 NMSIEIGPRLNFCTPLSTNAVCILKSLGFNMISRFEISHIYHFSSENDNLLSKRNDIIKNIHDKMTEMAYPHQINSFNLNVAPSPV-FTIDIMNEGIKALEEINKSMGLAMDEWDLLYYHDIFVNIMHRNPSNVECFDLAQSNSEHSRHWFFKGQMIIDGVEMEQSLFDILTETQKYSNQNNVIAFSDNSSAIKGFTTPILYINDPAYPSVYEIKDSFQNVCFTAETHNXXXXXXXXXXXXXXXXXRIRDIQAVGMGGYVVAGTAGYCFGNLRLPYYTLPWETDPCFKYPSNFAQASKIVIEASNGASDYGNEFGEPVINGFCRSFGMITHSGEWKEWIKPIMFSGGIGQLSSLHVNKSSPNVNQLVIKXXXXXXXXXXXXXAASSVEIQGDSSRDKELDLGAVQRGDAQMENKMNRVIRGCIDLRDLNPIKSIHDQGAGGNGNVLKELVDPLGAIIDASNFTLGDPTINLLELWGAEYQESNGLLIDERHLDQFKKICDRERCPINVVGKVTGDGNIRLINSVAL------EEELDPS-MPYIVDLDLSVVLGKMPKKKFYLKHVEKILSPLKLPLNLQVEDALSRVLRLPSVGSKRFLTNKVDRSVSGLVAQQQCVGPLHTPLADVAIVALSYFDIVGAATAIGEQPIKMLINVKEGAKLCVIEALTNLCMIPVTSFEDIKVSGNWMWPAKLPGEGAALWDACNAFCSLLKDLKIAIDGGKDSLSMAATVNDNTVVKSPGSLVVSAYVCCPDIRLAVTPDLK---GDGSLIWIRMN-SQYRLGGSALAQVYCQLGDKCPEFDNVGLFKKSWNCLQKIFMEKLASAAHDISDGGLIGCLLEMAFAGNVGIDVIINASIADCDASNSSAEISILFNEETGWIIEVPNNYLSTVINDLESNELLFSLIGHSCKRYEVTP--TVTLTVNELNIFSNFKLGEFRTMWEDTSYHLEKLQCNTECVNKEYQFYGNPNITSNPFVISDSWLKPY--NKINSKVFRVAILREEGSNGDREMAAAFIKSGFETWDITMQDLLSDLITLEEFNGLIFVGGFSFGDVLGSAKGWAAAIKYNEKIKKKFQNFKIREDTFSLGVCNGCQLMTWLGWLNDSHSLDNCEMKRD-------IILSHNDSNRFESRFSVVSIPQNTKSIMLSRLLGARLGVWVAHGEGKFEFTNQEFCSQALSDGLIALNYVNLDATNDDVVNYPFNPNGSISNVAGLCSKDGRHLAIMPHPERSFMWWQWAYTGDLDVSTEVSPWMCIFNSAYEWV 4081
            ++ +E+GPRLNF TP STN V + ++ G   + R E +  Y  S  +          +  +HD+MTE  +PH I SF+    P P+   I+I+ EG  ALE+ N+ +GLA+D WDL +Y   F   + RNPS VE FDLAQSNSEHSRHWFFKGQ+ +DG ++  SLF+ +  TQ+ SN NNV+ F DNSSAI+G     L   DP  PS ++ +   ++V FTAETHNFPTGV PF GA TGTGGRIRD+Q  G G +VVAGTAGYCFGNL +P Y LPWE DP F+YP NFA+  ++ IEASNGASDYGN+FGEPV+ GF RS G+    G+ +EWIKPIMFSGGIG + + H++K +P     V+K+GGPVYRIGVGGGAASSV++QGD++ D  LD GAVQRGD +ME KMNRVIR C++    NPI S+HDQGAGGNGNVLKEL DP GAII  S F LGDPT+N LE+WGAEYQESN LL+   + D    +  RERCP   VG +TGD  I L++          + +  P+ +P  VDL+L  VLGKMP+K+F+L+    +L PL LP  L V  AL RVLRLP+V SKR+LTNKVDRSV GLVAQQQCVGPL TPLADVA+VALS+ +++GAATA+GEQP+K L++ K  A+L V EALTNL    VT   D+K SGNWMW AKLPGEGAAL DAC A  +++  L +A+DGGKDSLSMAA V   T V++PGSLV+SAY  CPDI   VTPDLK   G G L+++ ++  Q+RLGG+ALAQ + QLG+  P+ D      ++++  Q +  ++L  + HD+SDGGL+ CLLEMAFAGN G+ V +               +S+LF EE G ++EV    L+ V+       L    +GH+    E  P   V ++VN   +     +GE R +WE+TS+ L++LQ    CV +E +  G        + +  ++ K     +      RVAILREEGSNGDREMA AF  +GFE WD+TMQDL S  I L+ F G+ FVGGFS+ DVLGSAKGWAAA+ ++ +   + + F+ R DTFSLGVCNGCQL+  LGW+    + D  EM  D       ++L HN S R+ESR++ V +     ++ML  + GA L VW AHGEG   F++ E  +Q  + GL  L++ + D    +   YP NPNGS   VAG+CS DGRHLA+MPHPER+   WQWA+      +   SPW+ +F +A  W 
Sbjct:   85 DLLLEVGPRLNFSTPTSTNIVSVCRATGLGPVDRVETTRRYRLSFAHPPSAEVEAIALATLHDRMTEQHFPHPIQSFSPESMPEPLNGPINILGEGRLALEKANQELGLALDSWDLDFYTKRFQE-LQRNPSTVEAFDLAQSNSEHSRHWFFKGQLHVDGQKLVHSLFESIMSTQESSNPNNVLKFCDNSSAIQGKEVRFLRPEDPTRPSRFQQQQGLRHVVFTAETHNFPTGVCPFSGATTGTGGRIRDVQCTGRGAHVVAGTAGYCFGNLHIPGYNLPWE-DPSFQYPGNFARPLEVAIEASNGASDYGNKFGEPVLAGFARSLGLQLPDGQRREWIKPIMFSGGIGSMEADHISKEAPEPGMEVVKVGGPVYRIGVGGGAASSVQVQGDNTSD--LDFGAVQRGDPEMEQKMNRVIRACVEAPKGNPICSLHDQGAGGNGNVLKELSDPAGAIIYTSRFQLGDPTLNALEIWGAEYQESNALLLRSPNRDFLTHVSARERCPACFVGTITGDRRIVLVDDRECPVRRNGQGDAPPTPLPTPVDLELEWVLGKMPRKEFFLQRKPPMLQPLALPPGLSVHQALERVLRLPAVASKRYLTNKVDRSVGGLVAQQQCVGPLQTPLADVAVVALSHEELIGAATALGEQPVKSLLDPKVAARLAVAEALTNLVFALVTDLRDVKCSGNWMWAAKLPGEGAALADACEAMVAVMAALGVAVDGGKDSLSMAARVGTET-VRAPGSLVISAYAVCPDITATVTPDLKHPEGRGHLLYVALSPGQHRLGGTALAQCFSQLGEHPPDLDLPENLVRAFSITQGLLKDRLLCSGHDVSDGGLVTCLLEMAFAGNCGLQVDV--------PVPRVDVLSVLFAEEPGLVLEVQEPDLAQVLKRYRDAGLHCLELGHTG---EAGPHAMVRVSVNGAVVLEE-PVGELRALWEETSFQLDRLQAEPRCVAEEER--GLRERMGPSYCLPPTFPKASVPREPGGPSPRVAILREEGSNGDREMADAFHLAGFEVWDVTMQDLCSGAIGLDTFRGVAFVGGFSYADVLGSAKGWAAAVTFHPRAGAELRRFRKRPDTFSLGVCNGCQLLALLGWVGGDPNEDAAEMGPDSQPARPGLLLRHNLSGRYESRWASVRV-GPGPALMLRGMEGAVLPVWSAHGEGYVAFSSPELQAQIEARGLAPLHWADDDGNPTE--QYPLNPNGSPGGVAGICSCDGRHLAVMPHPERAVRPWQWAWRPPPFDTLTTSPWLQLFINARNWT 1333          
BLAST of Phosphoribosylformylglycinamidine synthase vs. Ensembl Human
Match: PFAS (phosphoribosylformylglycinamidine synthase [Source:HGNC Symbol;Acc:HGNC:8863])

HSP 1 Score: 261.536 bits (667), Expect = 7.697e-77
Identity = 148/357 (41.46%), Postives = 206/357 (57.70%), Query Frame = 2
Query: 2756 IFMEKLASAAHDISDGGLIGCLLEMAFAGNVGIDVIINASIADCDASNSSAEISILFNEETGWIIEVPNNYLSTVINDLESNELLFSLIGHSCKRYEVTP--TVTLTVNELNIFSNFKLGEFRTMWEDTSYHLEKLQCNTECVNKEYQFYGNPNITSNPFVISDSWLKPY--NKINSKVFRVAILREEGSNGDREMAAAFIKSGFETWDITMQDLLSDLITLEEFNGLIFVGGFSFGDVLGSAKGWAAAIKYNEKIKKKFQNFKIREDTFSLGVCNGCQLMTWLGWLNDSHSLDNCEMKRD-------IILSHNDSNRFESRFSVVSIPQNTKSIMLSRLLGARLGVWVAHGEGKFE 3793
            +  ++L  + HD+SDGGL+ CLLEMAFAGN G+ V +               +S+LF EE G ++EV    L+ V+       L    +GH+    E  P   V ++VN   +     +GE R +WE+TS+ L++LQ    CV +E +  G        + +  ++ K     +      RVAILREEGSNGDREMA AF  +GFE WD+TMQDL S  I L+ F G+ FVGGFS+ DVLGSAKGWAAA+ ++ +   + + F+ R DTFSLGVCNGCQL+  LGW+    + D  EM  D       ++L HN S R+ESR++ V +     ++ML  + GA L VW AHGEG+ +
Sbjct:    2 LLKDRLLCSGHDVSDGGLVTCLLEMAFAGNCGLQVDV--------PVPRVDVLSVLFAEEPGLVLEVQEPDLAQVLKRYRDAGLHCLELGHTG---EAGPHAMVRVSVNGAVVLEE-PVGELRALWEETSFQLDRLQAEPRCVAEEER--GLRERMGPSYCLPPTFPKASVPREPGGPSPRVAILREEGSNGDREMADAFHLAGFEVWDVTMQDLCSGAIGLDTFRGVAFVGGFSYADVLGSAKGWAAAVTFHPRAGAELRRFRKRPDTFSLGVCNGCQLLALLGWVGGDPNEDAAEMGPDSQPARPGLLLRHNLSGRYESRWASVRV-GPGPALMLRGMEGAVLPVWSAHGEGQAQ 343          
BLAST of Phosphoribosylformylglycinamidine synthase vs. Ensembl Human
Match: PFAS (phosphoribosylformylglycinamidine synthase [Source:HGNC Symbol;Acc:HGNC:8863])

HSP 1 Score: 108.612 bits (270), Expect = 4.485e-27
Identity = 55/82 (67.07%), Postives = 64/82 (78.05%), Query Frame = 2
Query: 1481 AASSVEIQGDSSRDKELDLGAVQRGDAQMENKMNRVIRGCIDLRDLNPIKSIHDQGAGGNGNVLKELVDPLGAIIDASNFTL 1726
            AASSV++QGD++ D  LD GAVQRGD +ME KMNRVIR C++    NPI S+HDQGAGGNGNVLKEL DP GAII  S F +
Sbjct:   20 AASSVQVQGDNTSD--LDFGAVQRGDPEMEQKMNRVIRACVEAPKGNPICSLHDQGAGGNGNVLKELSDPAGAIIYTSRFQI 99          
BLAST of Phosphoribosylformylglycinamidine synthase vs. Ensembl Human
Match: PFAS (phosphoribosylformylglycinamidine synthase [Source:HGNC Symbol;Acc:HGNC:8863])

HSP 1 Score: 52.373 bits (124), Expect = 6.264e-8
Identity = 22/53 (41.51%), Postives = 35/53 (66.04%), Query Frame = 2
Query: 2732 KSWNCLQKIFMEKLASAAHDISDGGLIGCLLEMAFAGNVGIDVIINASIADCD 2890
            ++++  Q +  ++L  + HD+SDGGL+ CLLEMAFAGN G+ V +     D +
Sbjct:    5 RAFSITQGLLKDRLLCSGHDVSDGGLVTCLLEMAFAGNCGLQVDVPVPRVDAE 57          
BLAST of Phosphoribosylformylglycinamidine synthase vs. Ensembl Celegans
Match: pfas-1 (Probable phosphoribosylformylglycinamidine synthase [Source:UniProtKB/Swiss-Prot;Acc:Q19311])

HSP 1 Score: 1016.14 bits (2626), Expect = 0.000e+0
Identity = 602/1292 (46.59%), Postives = 807/1292 (62.46%), Query Frame = 2
Query:  332 KYNMSIEIGPRLNFCTPLSTNAVCILKSLGFNMISRFEISHIYHFSSENDNLLSKRNDIIKNIHDKMTEMAYPHQINSFNLNVAPSPVFTIDIMNEGIKALEEINKSMGLAMDEWDLLYYHDIFVNIMHRNPSNVECFDLAQSNSEHSRHWFFKGQMIIDGVEMEQSLFDILTETQKYSNQNNVIAFSDNSSAIKGFTTPI-LYINDPAYPSVYEIKDSFQNVCFTAETHNXXXXXXXXXXXXXXXXXRIRDIQAVGMGGYVVAGTAGYCFGNLRLPYYTLPWETDPCFKYPSNFAQASKIVIEASNGASDYGNEFGEPVINGFCRSFGMITHSGEWKEWIKPIMFSGGIGQLSSLHVNKSSPNVNQLVIKXXXXXXXXXXXXXAASSVEIQGDSSRDKELDLGAVQRGDAQMENKMNRVIRGCIDLRDLNPIKSIHDQGAGGNGNVLKELVDPLGAIIDASNFTLGDPTINLLELWGAEYQESNGLLIDERHLDQFKKICDRERCPINVVGKVTGDGNIRLINSVALEEELDPSMPYIVDLDLSVVLGKMPKKKFYLKHVEKILSPLKLPLNLQVEDALSRVLRLPSVGSKRFLTNKVDRSVSGLVAQQQCVGPLHTPLADVAIVALSYFDIVGAATAIGEQPIKMLINVKEGAKLCVIEALTNLCMIPVTSFEDIKVSGNWMWPAKLPGEGAALWDACNAFCSLLKDLKIAIDGGKDSLSMAATVNDNTVVKSPGSLVVSAYVCCPDIRLAVTPDLKG--DGSLIWIRMNS---QYRLGGSALAQVYCQLGDKCPEFDNVGLFKKSWNCLQKIF-MEKLAS--------AAHDISDGGLIGCLLEMAFAGNVGIDVIINASIADCDASNSSAEISILFNEETGWIIEVPNNYLSTVINDLESNELLFSLIGHSCKRYEVTPTVTLTVN-ELNIFSNFKLGEFRTMWEDTSYHLEKLQCNTECVNK---------------EYQFYGNPNITSNPFVISDSWLKPYNKINSKVFRVAILREEGSNGDREMAAAFIKSGFETWDITMQDLLSDLITLEEFNGLIFVGGFSFGDVLGSAKGWAAAIKYNEKIKKKFQNFKIREDTFSLGVCNGCQLMTWLGWLNDSHSLDNCEMKRDIILSHNDSNRFESRFSVVSIPQNTKSIMLSRLLGARLGVWVAHGEGKFEFTNQEFCSQALSDGLIALNYVN----LDATNDDV-VNYPFNPNGSISNVAGLCSKDGRHLAIMPHPERSFMWWQWAYTGDL-------DVSTEVSPWMCIFNSAYEW 4078
            ++  +IEIGPR    T   TN + I +S G   + R E    Y    + D      N+  +   DKMTE  Y + +   + +     VF ID++ E  + L + N+ +GLA+D+ DL +Y+D FVN + +NP++VE FDLAQS+SEHSRHWFF+G++ ID  + + SL   + ET   SN N++IAF DNSSAI+GF +   L  NDP   S         ++ ++AETHNFPT V PF GA TGTGGRIRDI A G G Y +AGT GY FGNL LP   LPWE D  F+YP++ ++ +KI IEASNGASDYGN+FGEPVI+GF RSFG    +GE  E++KPIMFSGGIG +    V K     +Q V+KIGGPVYRIGVGGGAASSV +QG+  R+ +LD  AVQRGDA+M  K++RV+R C +    NP+ +IHDQGAGGNGNV+KELV+  G  + +  F LGD +I+L ELW AEYQE++  L+D   LD  + I  RE+C ++VVG+V  +  ++L         L  S    VDLD +  LG+  KK F LK   ++L  L+LP NL V  AL RVL LPSV SKR+LT KVDRSV+GLVAQQQCVGPLHTPLADVA+VALS+FD VG A ++GEQPIKMLI+ ++GA++C+ E + NL   P+T  +D+K+SGNWMW AK  GEGA L DA  A C  L+++  AIDGGKDSLSMA T +   VVKSPG+LV+SAY  C ++   V P LK      ++WI++ S   + RLGGSALAQVY Q+GD CP+ +N     K ++ +Q++   E+LA         A HDISDGGL+  +LEMAFAGNV ID+ I         + +   I ILF EE G ++EV N     V++      +    IG +   +     V + VN  L I  N KL + R  WE     L + Q N + + +               ++ +Y NP    N             +  S   RVAI+REEGSNGDREMA+AF  +GF+T+D+TM D+L+   TLE + G+ FVGGFS+ DVLGSAKGWAA +++NE + K+F+ F+ R DTFS GVCNGCQLM  LGW+ D       +    + L  N+  RF+S F  V I +N  SIMLS +  + LG+W +HGEG+F + N +      ++G + + + +      A +  V + YP+NPNGSI +VA +CS+DGRHLA+MPH +RSF+ WQWA + ++         +  +SPW+ +F +AY W
Sbjct:   80 EHGKNIEIGPRTAVKTAACTNILSIFESSGIKNVERIERGIRYLVEDDVD-----VNEFFEIAADKMTEAIYGNDVKFDDESHQIEKVFLIDVL-ESKQNLIKANEELGLALDQLDLDFYYDFFVNKVKKNPTDVELFDLAQSDSEHSRHWFFRGEIWIDDRKRDGSLMKTIRETLDSSNDNSLIAFCDNSSAIRGFESVCRLRPNDPTTVSPMIAIFPPSHLIYSAETHNFPTAVCPFQGATTGTGGRIRDIHATGRGAYEIAGTVGYSFGNLNLPGLPLPWE-DETFEYPTSISEPAKIAIEASNGASDYGNKFGEPVISGFARSFGQRLENGERCEYLKPIMFSGGIGAIDKDEVRKEPCAPHQKVVKIGGPVYRIGVGGGAASSVSVQGN--RENQLDFAAVQRGDAEMGGKLHRVVRACAERIGGNPLMAIHDQGAGGNGNVIKELVEGCGVTVKSDTFQLGDESISLRELWTAEYQENDAALVDASLLDALQTISKREKCHVSVVGEVEKEQRVKL---------LGKSGEIAVDLD-TRQLGEREKKVFKLKSAPRVLKKLELPENLTVRKALKRVLMLPSVASKRYLTCKVDRSVTGLVAQQQCVGPLHTPLADVAVVALSHFDTVGGAVSLGEQPIKMLIDAEKGARMCIAETIMNLIWAPITDLKDVKMSGNWMWAAKCDGEGARLVDAVGALCRGLREIGCAIDGGKDSLSMAVTAH-GEVVKSPGTLVLSAYAPCTNVTKVVNPSLKAVPGSKILWIKIGSSEEKMRLGGSALAQVYSQIGDDCPDIENFSEISKVFSIVQQLLNREELAGPLRKPIILAGHDISDGGLLTAILEMAFAGNVSIDIDIKP------PNQNIKPIDILFAEECGILLEVSNP--ENVLHIFSEAGIKCQEIGKASAVFGPDAHVKIHVNGHLEI--NEKLVDLREEWELVGDRLGEFQTNPKSLKEAREVRRTCQKINYKCDFDWYYNPAFIHN------------EQYFSTAPRVAIIREEGSNGDREMASAFTLAGFQTFDVTMTDILAGH-TLEAYRGVAFVGGFSYADVLGSAKGWAAGVQFNESVSKQFEAFRSRPDTFSYGVCNGCQLMAQLGWIGDEE-----QKGPTVFLDENECGRFDSSFGPVKIEKNV-SIMLSGMENSVLGLWSSHGEGRFTYRNLQNFQNLKTNGQVCIRFCDDRGMTGADHGSVKLPYPWNPNGSIDDVAAICSRDGRHLAMMPHADRSFLTWQWAESSEVPWNARFDQKTVALSPWIKMFRNAYNW 1322          
BLAST of Phosphoribosylformylglycinamidine synthase vs. Ensembl Fly
Match: Pfas (gene:FBgn0000052 transcript:FBtr0079221)

HSP 1 Score: 1115.52 bits (2884), Expect = 0.000e+0
Identity = 634/1367 (46.38%), Postives = 844/1367 (61.74%), Query Frame = 2
Query:   98 MEVLHFYQIVSFSNKLKRNLVDN-NLLDGTIIATS-EICYNIEIKGXXXXXXXXXXXXXXITRS--DNINDISSKPINFQLKKYNMSIEIGPRLNFCTPLSTNAVCILKSLGFNMISRFEISHIYHFSSENDNLLSKRNDIIKNIHDKMTEMAYPHQIN---SFNLNVAPSPV--FTIDIMNEGIKALEEINKSMGLAMDEWDLLYYHDIFVNIMHRNPSNVECFDLAQSNSEHSRHWFFKGQMIIDGVEMEQSLFDILTETQKYSNQNNVIAFSDNSSAIKGFTTPILYINDPAYPSVYEIKDSFQNVCFTAETHNXXXXXXXXXXXXXXXXXRIRDIQAVGMGGYVVAGTAGYCFGNLRLPYYTLPWETDPC-FKYPSNFAQASKIVIEASNGASDYGNEFGEPVINGFCRSFGM--ITHSGEWKEWIKPIMFSGGIGQLSSLHVNKSSPNVNQLVIKXXXXXXXXXXXXXAASSVEIQGDSSRDKELDLGAVQRGDAQMENKMNRVIRGCIDLRDLNPIKSIHDQGAGGNGNVLKELVDP--LGAIIDASNFTLGDPTINLLELWGAEYQESNGLLIDERHLDQFKKICDRERCPINVVGKVTGDGNIRLINSVA---LEEELDPSMPYIV---DLDLSVVLGKMPKKKFYLKHVEKILSPLKLPLNLQVEDALSRVLRLPSVGSKRFLTNKVDRSVSGLVAQQQCVGPLHTPLADVAIVALSYFDIVGAATAIGEQPIKMLINVKEGAKLCVIEALTNLCMIPVTSFEDIKVSGNWMWPAKLPGEGAALWDACNAFCSLLKDLKIAIDGGKDSLSMAATVNDNTVVKSPGSLVVSAYVCCPDIRLAVTPDLKGDG-----SLIWIRMNSQYRLGGSALAQVYCQLGDKCPEFDNVGLFKKSWNCLQKIFMEKLASAAHDISDGGLIGCLLEMAFAGNVGIDVIINASIADCDASNSSA------EISILFNEETGWIIEVPNNYLSTVINDLESNELLFSLIGHSCKRYEVTPTVTLTVNELNIFSNFKLGEFRTMWEDTSYHLEKLQCNTECVNKEY---QFYGNPNITSNPFVISDSWLKPYNKINSKVFRVAILREEGSNGDREMAAAFIKSGFETWDITMQDLLSDLITLEEFNGLIFVGGFSFGDVLGSAKGWAAAIKYNEKIKKKFQNFKIREDTFSLGVCNGCQLMTWLGWLNDSHSLDNCEMKRDIILSHNDSNRFESRFSVVSIPQNTKSIMLSRLLGARLGVWVAHGEGKFEFTNQEFCSQALSDGLIALNYVNLDATNDDVVNYPFNPNGSISNVAGLCSKDGRHLAIMPHPERSFMWWQWAYTG---DLDVSTEVSPWMCIFNSAYEWVEK 4087
            M +L +Y + + S   + +++      DG +++   E CY++E          L  LL  + +        +S +P         + +EIGPR NF TP STN V I ++LG++ + R E S  Y  +    +   +    +  + D+MT+  Y  +     SF+  +         + ++ EG  ALE IN+ +GLA +++DL YYHD+F   + RNP+ VE FD AQSNSEHSRHWFF+G+M+IDGVE  +SL  ++ +TQ ++N NN I FSDNSSA+ GF    +  +    P    ++    ++ FTAETHN PT VAPF GA TGTGGR+RD+Q VG GG  +AGTAGYC G L +P Y  P+E  P  FKYP+ FA   +++IEASNGASDYGN+FGEPVI+GF  S+G+     + +  E++KPIMFSGG+G + +    K  P   QL+ KIGGPVYRIGVGGGAASSVEIQG  S D ELD  AVQRGDA+MENK+NRV+R C+DL + NPI +IHDQGAGGNGNVLKELV+P   GA+I +  F LGDPTI  LELWGAEYQE+N +L +    +  +KIC RERCPI+ VG VTGDG + L+   A   LE+ L+ S    V   DL+L  VLG MPK+ + LK  +  L  L LP  L +++AL RVL L +VGSKRFLTNKVDR V GL+AQQQCVGPL  PLAD A+  +S+F   G AT+IG QP+K L++    A++CV EAL+NL  + ++   D+K SGNWMW AKLPGEGA ++DAC   C +L++L IAIDGGKDSLSMAA V   T +KSPG+LV+S Y  CPD+RL VTPDLKG G     SL+WI + +  RLGGSALAQ Y Q G   P      +  K++   Q +  + L  A HD+SDGGL+ C+LEMA  G  G+ V ++  +A     + S       E+++LF EE GW++EV +  L  V +  E   +    +G + + + +   V L   +  +     L      WE TSY LEKLQ N EC   EY   ++   P       V ++  L    K +S   RVA+LREEG N +REM A  +++ FE  D+TM DLL    ++ ++ GLIF GGFS+ D LGSAKGWAA I +N ++  +F+ FK R+D FSLG+CNGCQLMT +G++  + S        D+ L HN S RFE R++ V IP N +SIML  +    LG WVAHGEG+F F +++  S   S+ L+ L YV  D        YP NPNGS   +AGLCS DGRHLA+MPHPER    +QW Y     ++  +   SPW  +FN+AY W  K
Sbjct:    1 MVILRYYDVQAHSAAEEESVLRRLREEDGAVVSVRMERCYHLEYSAQAEHSLALDELLVWLVKQPLSKGQSLSRQPALQSTGSSQLLLEIGPRFNFSTPYSTNCVNIFQNLGYSEVRRMETSTRYLVTFGEGSKAPEAARFVPLLGDRMTQCLYTEENTPKASFDEQLPERQANWHFVPVLEEGRAALERINQELGLAFNDYDLDYYHDLFAKELGRNPTTVELFDCAQSNSEHSRHWFFRGRMVIDGVEQPKSLIRMIMDTQAHTNPNNTIKFSDNSSAMVGFDHQTIVPSSVVAPGAVRLQSVQSDLIFTAETHNMPTAVAPFSGATTGTGGRLRDVQGVGRGGVPIAGTAGYCVGALHIPGYKQPYE--PLDFKYPATFAPPLQVLIEASNGASDYGNKFGEPVISGFALSYGLNSAADASQRDEYVKPIMFSGGLGTMPATMREKLPPARGQLLAKIGGPVYRIGVGGGAASSVEIQG--SGDAELDFNAVQRGDAEMENKLNRVVRACLDLGEQNPILAIHDQGAGGNGNVLKELVEPGFAGAVIFSKEFQLGDPTITALELWGAEYQENNAILCNADQRELLEKICRRERCPISFVGVVTGDGRVTLLEKPAPKDLEQALNASNRSEVSPFDLELKYVLGDMPKRTYDLKREQTPLKELSLPKGLLLDEALERVLSLVAVGSKRFLTNKVDRCVGGLIAQQQCVGPLQAPLADYALTTVSHFSHSGIATSIGTQPLKGLLDPAAMARMCVAEALSNLVFVKISELADVKCSGNWMWAAKLPGEGARMFDACKELCQILEELHIAIDGGKDSLSMAAKVGGET-IKSPGTLVISTYAPCPDVRLKVTPDLKGPGAGSKTSLLWINLENSARLGGSALAQAYAQQGKDTPNLTRSDVLGKAFAVTQSLLGDGLIQAGHDVSDGGLLVCVLEMAIGGLSGLRVDLSEPLAKLKNFDKSVEKLNRPELAVLFAEECGWVVEVLDTDLERVRSTYEKAGVPNYYLGVT-EGFGLDSRVVLKNGKSELLDQ-PLRVLYKKWERTSYELEKLQANPECAEAEYNSLEYRQAPQYRGPQNVQAELTL----KRSSAPVRVAVLREEGVNSEREMMACLLRANFEVHDVTMSDLLQGTASVSQYRGLIFPGGFSYADTLGSAKGWAANILHNPRLLPQFEAFKRRQDVFSLGICNGCQLMTLIGFVGSAKS--EVGADPDVALLHNKSQRFECRWATVKIPSN-RSIMLGSMKDLVLGCWVAHGEGRFAFRDEKLISHLQSEQLVTLQYV--DDVGKPTELYPLNPNGSPQGIAGLCSSDGRHLALMPHPERCSSMYQWPYVPSSFEVSPTQSESPWQIMFNNAYNWCVK 1351          
BLAST of Phosphoribosylformylglycinamidine synthase vs. Ensembl Fly
Match: Pfas (gene:FBgn0000052 transcript:FBtr0079220)

HSP 1 Score: 1115.52 bits (2884), Expect = 0.000e+0
Identity = 634/1367 (46.38%), Postives = 844/1367 (61.74%), Query Frame = 2
Query:   98 MEVLHFYQIVSFSNKLKRNLVDN-NLLDGTIIATS-EICYNIEIKGXXXXXXXXXXXXXXITRS--DNINDISSKPINFQLKKYNMSIEIGPRLNFCTPLSTNAVCILKSLGFNMISRFEISHIYHFSSENDNLLSKRNDIIKNIHDKMTEMAYPHQIN---SFNLNVAPSPV--FTIDIMNEGIKALEEINKSMGLAMDEWDLLYYHDIFVNIMHRNPSNVECFDLAQSNSEHSRHWFFKGQMIIDGVEMEQSLFDILTETQKYSNQNNVIAFSDNSSAIKGFTTPILYINDPAYPSVYEIKDSFQNVCFTAETHNXXXXXXXXXXXXXXXXXRIRDIQAVGMGGYVVAGTAGYCFGNLRLPYYTLPWETDPC-FKYPSNFAQASKIVIEASNGASDYGNEFGEPVINGFCRSFGM--ITHSGEWKEWIKPIMFSGGIGQLSSLHVNKSSPNVNQLVIKXXXXXXXXXXXXXAASSVEIQGDSSRDKELDLGAVQRGDAQMENKMNRVIRGCIDLRDLNPIKSIHDQGAGGNGNVLKELVDP--LGAIIDASNFTLGDPTINLLELWGAEYQESNGLLIDERHLDQFKKICDRERCPINVVGKVTGDGNIRLINSVA---LEEELDPSMPYIV---DLDLSVVLGKMPKKKFYLKHVEKILSPLKLPLNLQVEDALSRVLRLPSVGSKRFLTNKVDRSVSGLVAQQQCVGPLHTPLADVAIVALSYFDIVGAATAIGEQPIKMLINVKEGAKLCVIEALTNLCMIPVTSFEDIKVSGNWMWPAKLPGEGAALWDACNAFCSLLKDLKIAIDGGKDSLSMAATVNDNTVVKSPGSLVVSAYVCCPDIRLAVTPDLKGDG-----SLIWIRMNSQYRLGGSALAQVYCQLGDKCPEFDNVGLFKKSWNCLQKIFMEKLASAAHDISDGGLIGCLLEMAFAGNVGIDVIINASIADCDASNSSA------EISILFNEETGWIIEVPNNYLSTVINDLESNELLFSLIGHSCKRYEVTPTVTLTVNELNIFSNFKLGEFRTMWEDTSYHLEKLQCNTECVNKEY---QFYGNPNITSNPFVISDSWLKPYNKINSKVFRVAILREEGSNGDREMAAAFIKSGFETWDITMQDLLSDLITLEEFNGLIFVGGFSFGDVLGSAKGWAAAIKYNEKIKKKFQNFKIREDTFSLGVCNGCQLMTWLGWLNDSHSLDNCEMKRDIILSHNDSNRFESRFSVVSIPQNTKSIMLSRLLGARLGVWVAHGEGKFEFTNQEFCSQALSDGLIALNYVNLDATNDDVVNYPFNPNGSISNVAGLCSKDGRHLAIMPHPERSFMWWQWAYTG---DLDVSTEVSPWMCIFNSAYEWVEK 4087
            M +L +Y + + S   + +++      DG +++   E CY++E          L  LL  + +        +S +P         + +EIGPR NF TP STN V I ++LG++ + R E S  Y  +    +   +    +  + D+MT+  Y  +     SF+  +         + ++ EG  ALE IN+ +GLA +++DL YYHD+F   + RNP+ VE FD AQSNSEHSRHWFF+G+M+IDGVE  +SL  ++ +TQ ++N NN I FSDNSSA+ GF    +  +    P    ++    ++ FTAETHN PT VAPF GA TGTGGR+RD+Q VG GG  +AGTAGYC G L +P Y  P+E  P  FKYP+ FA   +++IEASNGASDYGN+FGEPVI+GF  S+G+     + +  E++KPIMFSGG+G + +    K  P   QL+ KIGGPVYRIGVGGGAASSVEIQG  S D ELD  AVQRGDA+MENK+NRV+R C+DL + NPI +IHDQGAGGNGNVLKELV+P   GA+I +  F LGDPTI  LELWGAEYQE+N +L +    +  +KIC RERCPI+ VG VTGDG + L+   A   LE+ L+ S    V   DL+L  VLG MPK+ + LK  +  L  L LP  L +++AL RVL L +VGSKRFLTNKVDR V GL+AQQQCVGPL  PLAD A+  +S+F   G AT+IG QP+K L++    A++CV EAL+NL  + ++   D+K SGNWMW AKLPGEGA ++DAC   C +L++L IAIDGGKDSLSMAA V   T +KSPG+LV+S Y  CPD+RL VTPDLKG G     SL+WI + +  RLGGSALAQ Y Q G   P      +  K++   Q +  + L  A HD+SDGGL+ C+LEMA  G  G+ V ++  +A     + S       E+++LF EE GW++EV +  L  V +  E   +    +G + + + +   V L   +  +     L      WE TSY LEKLQ N EC   EY   ++   P       V ++  L    K +S   RVA+LREEG N +REM A  +++ FE  D+TM DLL    ++ ++ GLIF GGFS+ D LGSAKGWAA I +N ++  +F+ FK R+D FSLG+CNGCQLMT +G++  + S        D+ L HN S RFE R++ V IP N +SIML  +    LG WVAHGEG+F F +++  S   S+ L+ L YV  D        YP NPNGS   +AGLCS DGRHLA+MPHPER    +QW Y     ++  +   SPW  +FN+AY W  K
Sbjct:    1 MVILRYYDVQAHSAAEEESVLRRLREEDGAVVSVRMERCYHLEYSAQAEHSLALDELLVWLVKQPLSKGQSLSRQPALQSTGSSQLLLEIGPRFNFSTPYSTNCVNIFQNLGYSEVRRMETSTRYLVTFGEGSKAPEAARFVPLLGDRMTQCLYTEENTPKASFDEQLPERQANWHFVPVLEEGRAALERINQELGLAFNDYDLDYYHDLFAKELGRNPTTVELFDCAQSNSEHSRHWFFRGRMVIDGVEQPKSLIRMIMDTQAHTNPNNTIKFSDNSSAMVGFDHQTIVPSSVVAPGAVRLQSVQSDLIFTAETHNMPTAVAPFSGATTGTGGRLRDVQGVGRGGVPIAGTAGYCVGALHIPGYKQPYE--PLDFKYPATFAPPLQVLIEASNGASDYGNKFGEPVISGFALSYGLNSAADASQRDEYVKPIMFSGGLGTMPATMREKLPPARGQLLAKIGGPVYRIGVGGGAASSVEIQG--SGDAELDFNAVQRGDAEMENKLNRVVRACLDLGEQNPILAIHDQGAGGNGNVLKELVEPGFAGAVIFSKEFQLGDPTITALELWGAEYQENNAILCNADQRELLEKICRRERCPISFVGVVTGDGRVTLLEKPAPKDLEQALNASNRSEVSPFDLELKYVLGDMPKRTYDLKREQTPLKELSLPKGLLLDEALERVLSLVAVGSKRFLTNKVDRCVGGLIAQQQCVGPLQAPLADYALTTVSHFSHSGIATSIGTQPLKGLLDPAAMARMCVAEALSNLVFVKISELADVKCSGNWMWAAKLPGEGARMFDACKELCQILEELHIAIDGGKDSLSMAAKVGGET-IKSPGTLVISTYAPCPDVRLKVTPDLKGPGAGSKTSLLWINLENSARLGGSALAQAYAQQGKDTPNLTRSDVLGKAFAVTQSLLGDGLIQAGHDVSDGGLLVCVLEMAIGGLSGLRVDLSEPLAKLKNFDKSVEKLNRPELAVLFAEECGWVVEVLDTDLERVRSTYEKAGVPNYYLGVT-EGFGLDSRVVLKNGKSELLDQ-PLRVLYKKWERTSYELEKLQANPECAEAEYNSLEYRQAPQYRGPQNVQAELTL----KRSSAPVRVAVLREEGVNSEREMMACLLRANFEVHDVTMSDLLQGTASVSQYRGLIFPGGFSYADTLGSAKGWAANILHNPRLLPQFEAFKRRQDVFSLGICNGCQLMTLIGFVGSAKS--EVGADPDVALLHNKSQRFECRWATVKIPSN-RSIMLGSMKDLVLGCWVAHGEGRFAFRDEKLISHLQSEQLVTLQYV--DDVGKPTELYPLNPNGSPQGIAGLCSSDGRHLALMPHPERCSSMYQWPYVPSSFEVSPTQSESPWQIMFNNAYNWCVK 1351          
BLAST of Phosphoribosylformylglycinamidine synthase vs. Ensembl Fly
Match: Pfas (gene:FBgn0000052 transcript:FBtr0079219)

HSP 1 Score: 1115.52 bits (2884), Expect = 0.000e+0
Identity = 634/1367 (46.38%), Postives = 844/1367 (61.74%), Query Frame = 2
Query:   98 MEVLHFYQIVSFSNKLKRNLVDN-NLLDGTIIATS-EICYNIEIKGXXXXXXXXXXXXXXITRS--DNINDISSKPINFQLKKYNMSIEIGPRLNFCTPLSTNAVCILKSLGFNMISRFEISHIYHFSSENDNLLSKRNDIIKNIHDKMTEMAYPHQIN---SFNLNVAPSPV--FTIDIMNEGIKALEEINKSMGLAMDEWDLLYYHDIFVNIMHRNPSNVECFDLAQSNSEHSRHWFFKGQMIIDGVEMEQSLFDILTETQKYSNQNNVIAFSDNSSAIKGFTTPILYINDPAYPSVYEIKDSFQNVCFTAETHNXXXXXXXXXXXXXXXXXRIRDIQAVGMGGYVVAGTAGYCFGNLRLPYYTLPWETDPC-FKYPSNFAQASKIVIEASNGASDYGNEFGEPVINGFCRSFGM--ITHSGEWKEWIKPIMFSGGIGQLSSLHVNKSSPNVNQLVIKXXXXXXXXXXXXXAASSVEIQGDSSRDKELDLGAVQRGDAQMENKMNRVIRGCIDLRDLNPIKSIHDQGAGGNGNVLKELVDP--LGAIIDASNFTLGDPTINLLELWGAEYQESNGLLIDERHLDQFKKICDRERCPINVVGKVTGDGNIRLINSVA---LEEELDPSMPYIV---DLDLSVVLGKMPKKKFYLKHVEKILSPLKLPLNLQVEDALSRVLRLPSVGSKRFLTNKVDRSVSGLVAQQQCVGPLHTPLADVAIVALSYFDIVGAATAIGEQPIKMLINVKEGAKLCVIEALTNLCMIPVTSFEDIKVSGNWMWPAKLPGEGAALWDACNAFCSLLKDLKIAIDGGKDSLSMAATVNDNTVVKSPGSLVVSAYVCCPDIRLAVTPDLKGDG-----SLIWIRMNSQYRLGGSALAQVYCQLGDKCPEFDNVGLFKKSWNCLQKIFMEKLASAAHDISDGGLIGCLLEMAFAGNVGIDVIINASIADCDASNSSA------EISILFNEETGWIIEVPNNYLSTVINDLESNELLFSLIGHSCKRYEVTPTVTLTVNELNIFSNFKLGEFRTMWEDTSYHLEKLQCNTECVNKEY---QFYGNPNITSNPFVISDSWLKPYNKINSKVFRVAILREEGSNGDREMAAAFIKSGFETWDITMQDLLSDLITLEEFNGLIFVGGFSFGDVLGSAKGWAAAIKYNEKIKKKFQNFKIREDTFSLGVCNGCQLMTWLGWLNDSHSLDNCEMKRDIILSHNDSNRFESRFSVVSIPQNTKSIMLSRLLGARLGVWVAHGEGKFEFTNQEFCSQALSDGLIALNYVNLDATNDDVVNYPFNPNGSISNVAGLCSKDGRHLAIMPHPERSFMWWQWAYTG---DLDVSTEVSPWMCIFNSAYEWVEK 4087
            M +L +Y + + S   + +++      DG +++   E CY++E          L  LL  + +        +S +P         + +EIGPR NF TP STN V I ++LG++ + R E S  Y  +    +   +    +  + D+MT+  Y  +     SF+  +         + ++ EG  ALE IN+ +GLA +++DL YYHD+F   + RNP+ VE FD AQSNSEHSRHWFF+G+M+IDGVE  +SL  ++ +TQ ++N NN I FSDNSSA+ GF    +  +    P    ++    ++ FTAETHN PT VAPF GA TGTGGR+RD+Q VG GG  +AGTAGYC G L +P Y  P+E  P  FKYP+ FA   +++IEASNGASDYGN+FGEPVI+GF  S+G+     + +  E++KPIMFSGG+G + +    K  P   QL+ KIGGPVYRIGVGGGAASSVEIQG  S D ELD  AVQRGDA+MENK+NRV+R C+DL + NPI +IHDQGAGGNGNVLKELV+P   GA+I +  F LGDPTI  LELWGAEYQE+N +L +    +  +KIC RERCPI+ VG VTGDG + L+   A   LE+ L+ S    V   DL+L  VLG MPK+ + LK  +  L  L LP  L +++AL RVL L +VGSKRFLTNKVDR V GL+AQQQCVGPL  PLAD A+  +S+F   G AT+IG QP+K L++    A++CV EAL+NL  + ++   D+K SGNWMW AKLPGEGA ++DAC   C +L++L IAIDGGKDSLSMAA V   T +KSPG+LV+S Y  CPD+RL VTPDLKG G     SL+WI + +  RLGGSALAQ Y Q G   P      +  K++   Q +  + L  A HD+SDGGL+ C+LEMA  G  G+ V ++  +A     + S       E+++LF EE GW++EV +  L  V +  E   +    +G + + + +   V L   +  +     L      WE TSY LEKLQ N EC   EY   ++   P       V ++  L    K +S   RVA+LREEG N +REM A  +++ FE  D+TM DLL    ++ ++ GLIF GGFS+ D LGSAKGWAA I +N ++  +F+ FK R+D FSLG+CNGCQLMT +G++  + S        D+ L HN S RFE R++ V IP N +SIML  +    LG WVAHGEG+F F +++  S   S+ L+ L YV  D        YP NPNGS   +AGLCS DGRHLA+MPHPER    +QW Y     ++  +   SPW  +FN+AY W  K
Sbjct:    1 MVILRYYDVQAHSAAEEESVLRRLREEDGAVVSVRMERCYHLEYSAQAEHSLALDELLVWLVKQPLSKGQSLSRQPALQSTGSSQLLLEIGPRFNFSTPYSTNCVNIFQNLGYSEVRRMETSTRYLVTFGEGSKAPEAARFVPLLGDRMTQCLYTEENTPKASFDEQLPERQANWHFVPVLEEGRAALERINQELGLAFNDYDLDYYHDLFAKELGRNPTTVELFDCAQSNSEHSRHWFFRGRMVIDGVEQPKSLIRMIMDTQAHTNPNNTIKFSDNSSAMVGFDHQTIVPSSVVAPGAVRLQSVQSDLIFTAETHNMPTAVAPFSGATTGTGGRLRDVQGVGRGGVPIAGTAGYCVGALHIPGYKQPYE--PLDFKYPATFAPPLQVLIEASNGASDYGNKFGEPVISGFALSYGLNSAADASQRDEYVKPIMFSGGLGTMPATMREKLPPARGQLLAKIGGPVYRIGVGGGAASSVEIQG--SGDAELDFNAVQRGDAEMENKLNRVVRACLDLGEQNPILAIHDQGAGGNGNVLKELVEPGFAGAVIFSKEFQLGDPTITALELWGAEYQENNAILCNADQRELLEKICRRERCPISFVGVVTGDGRVTLLEKPAPKDLEQALNASNRSEVSPFDLELKYVLGDMPKRTYDLKREQTPLKELSLPKGLLLDEALERVLSLVAVGSKRFLTNKVDRCVGGLIAQQQCVGPLQAPLADYALTTVSHFSHSGIATSIGTQPLKGLLDPAAMARMCVAEALSNLVFVKISELADVKCSGNWMWAAKLPGEGARMFDACKELCQILEELHIAIDGGKDSLSMAAKVGGET-IKSPGTLVISTYAPCPDVRLKVTPDLKGPGAGSKTSLLWINLENSARLGGSALAQAYAQQGKDTPNLTRSDVLGKAFAVTQSLLGDGLIQAGHDVSDGGLLVCVLEMAIGGLSGLRVDLSEPLAKLKNFDKSVEKLNRPELAVLFAEECGWVVEVLDTDLERVRSTYEKAGVPNYYLGVT-EGFGLDSRVVLKNGKSELLDQ-PLRVLYKKWERTSYELEKLQANPECAEAEYNSLEYRQAPQYRGPQNVQAELTL----KRSSAPVRVAVLREEGVNSEREMMACLLRANFEVHDVTMSDLLQGTASVSQYRGLIFPGGFSYADTLGSAKGWAANILHNPRLLPQFEAFKRRQDVFSLGICNGCQLMTLIGFVGSAKS--EVGADPDVALLHNKSQRFECRWATVKIPSN-RSIMLGSMKDLVLGCWVAHGEGRFAFRDEKLISHLQSEQLVTLQYV--DDVGKPTELYPLNPNGSPQGIAGLCSSDGRHLALMPHPERCSSMYQWPYVPSSFEVSPTQSESPWQIMFNNAYNWCVK 1351          
BLAST of Phosphoribosylformylglycinamidine synthase vs. Ensembl Zebrafish
Match: pfas (phosphoribosylformylglycinamidine synthase [Source:ZFIN;Acc:ZDB-GENE-030131-4420])

HSP 1 Score: 1236.86 bits (3199), Expect = 0.000e+0
Identity = 672/1346 (49.93%), Postives = 883/1346 (65.60%), Query Frame = 2
Query:   98 MEVLHFYQIVSFSNKLKRNLVDNNLLDGTIIATSEICYNIEIKGXXXXXXXXXXXXXXITRSDNINDISSKPINFQL--------KKYNMSIEIGPRLNFCTPLSTNAVCILKSLGFNMISRFEISHIYHFSSENDNLLSKRN----DIIKNIHDKMTEMAYPHQINSFNLNVAPSPVFTIDIMNEGIKALEEINKSMGLAMDEWDLLYYHDIFVNIMHRNPSNVECFDLAQSNSEHSRHWFFKGQMIIDGVEMEQSLFDILTETQKYSNQNNVIAFSDNSSAIKGFTTPILYINDPAYPSVYEIKDSFQNVCFTAETHNXXXXXXXXXXXXXXXXXRIRDIQAVGMGGYVVAGTAGYCFGNLRLPYYTLPWETDPCFKYPSNFAQASKIVIEASNGASDYGNEFGEPVINGFCRSFGMITHSGEWKEWIKPIMFSGGIGQLSSLHVNKSSPNVNQLVIKXXXXXXXXXXXXXAASSVEIQGDSSRDKELDLGAVQRGDAQMENKMNRVIRGCIDLRDLNPIKSIHDQGAGGNGNVLKELVDPLGAIIDASNFTLGDPTINLLELWGAEYQESNGLLIDERHLDQFKKICDRERCPINVVGKVTGDGNIRLINSVALEEELDPSMPYIVDLDLSVVLGKMPKKKFYLKHVEKILSPLKLPLNLQVEDALSRVLRLPSVGSKRFLTNKVDRSVSGLVAQQQCVGPLHTPLADVAIVALSYFDIVGAATAIGEQPIKMLINVKEGAKLCVIEALTNLCMIPVTSFEDIKVSGNWMWPAKLPGEGAALWDACNAFCSLLKDLKIAIDGGKDSLSMAATVNDNTVVKSPGSLVVSAYVCCPDIRLAVTPDL---KGDGSLIWIRMNS-QYRLGGSALAQVYCQLGDKCPEFDNVGLFKKSWNCLQKIFMEKLASAAHDISDGGLIGCLLEMAFAGNVGIDVIINASIADCDASNSSAEISILFNEETGWIIEVPNNYLSTVINDLESNELLFSLIGHSCKRYEVTPTVTLTVNELNIFSNFKLGEFRTMWEDTSYHLEKLQCNTECVNKEYQFYGNPNITSNPFVISDSWLKPYNKINSKVFRVAILREEGSNGDREMAAAFIKSGFETWDITMQDLLSDLITLEEFNGLIFVGGFSFGDVLGSAKGWAAAIKYNEKIKKKFQNFKIREDTFSLGVCNGCQLMTWLGWLNDSHSLDNCEMKRDIILSHNDSNRFESRFSVVSIPQNTKSIMLSRLLGARLGVWVAHGEGKFEFTNQEFCSQALSDGLIALNYVNLDATNDDVVNYPFNPNGSISNVAGLCSKDGRHLAIMPHPERSFMWWQWAYTGD-LDVSTEVSPWMCIFNSAYEWVE 4084
            M V+ FY+         R +     L   +I T+E+CYN+E+ G +            + + D +  + S P +  L        +     +EIGPRLNF T  STNAV I +S G + ++R E+S  +    +    +  ++     +I  ++D MTE  Y   I SF +++ P  VF +DI+ +G  ALE+ N  +GLA D WDL YY  +F  +  RNP++VECFDLAQSNSEHSRHWFF+G+M+IDG E +++LF ++  TQ++SNQNNVI F DNSS IKG     +Y  +PA  S YE +D+ ++V FTAETHNFPTGVAPF GA TGTGGRIRD+Q+ G GG+V+AGTAGYCFGNL +P + LPWE +  ++YPS+FA   ++ IEAS+GASDYGN+FGEPV+ GF RSFGM   +GE +EWIKPIMFSGG+G +   HV K        V+KIGGPVYRIGVGGGAASSV++QGD+S  +  DLGAVQRGDA+ME KMNR +R C++  + NPI SIHDQGAGGNGNVLKEL +P GA+I    F  GDPT+++LELWGAEYQESN LL+        +++C RE+CP++ VGK+TGDG I L++ +  + ++       VDL+L  VLGKMP+K+F L+H    L PL LP  L V  AL RVLRLP+V SKR+LTNKVDRSV+GLVAQQQCVGPLHTPLADVA+VALS F + GAATAIGEQPIK L++   GA++ V EALTNL    V++ +D+K SGNWMW AKLPGEGA LWDAC A C ++  L +A+DGGKDSLSMAA V+  T VK+PGSLV+S Y  CPDI   VTPDL   +G G L+++ +++ +YRLGGSALAQ + QLGD  P+ D        +N  Q +  ++L +A HD+SDGGLI CLLEMAFAGN GI+V +     D         +  LF+EE   ++EV     S+V        LL   IG +   +     V +++    +  N +L   R +WE TS+ LE+LQ N  CV +E Q   +            S      ++ +   RVA++REEGSNGDREM+A+   +GFE WD+TMQDL S   TL+ F  ++FVGGFS+ DVLGSAKGWAA + +N + +++F+ F+ REDT SLGVCNGCQL+  LGW+ +       +   D+ L+HN S RFESRF  V I   + +IML  + G+ LGVWVAHGEG  +F + E   + +   L  L YV+ D+ N   + YP NPNGS   VAG+CS DGRHLA+MPHPER+ + WQWA+    L  S E SPW+ +F +A  W +
Sbjct:    1 MPVVRFYRTEETGEA--RAIRRIAQLYPDVIITTELCYNVELDGPDSLS---------VAQKDILRWLFSPPYSVSLLEEPTLKAEHGARLVEIGPRLNFSTAWSTNAVSICQSAGLSQVTRVELSRRHLIKPQEGCKVGMKDGEMESLISCLYDSMTECIYAQPITSFAVDIRPQDVFEVDILGKGRAALEKANDELGLAFDSWDLDYYTALFQKV-KRNPTSVECFDLAQSNSEHSRHWFFRGRMVIDGKEQKETLFSLIMGTQQHSNQNNVIKFCDNSSGIKGMELRCMYPTNPAQASPYESRDTTRHVIFTAETHNFPTGVAPFSGATTGTGGRIRDVQSAGKGGHVIAGTAGYCFGNLHIPGFVLPWEEE-GWEYPSSFAPPLQVAIEASDGASDYGNKFGEPVLAGFARSFGMRLANGERREWIKPIMFSGGLGSIEDPHVRKDQAEPGMEVVKIGGPVYRIGVGGGAASSVQVQGDNSSAR--DLGAVQRGDAEMEQKMNRALRACLERVEGNPICSIHDQGAGGNGNVLKELSEPAGAVIYTEKFKRGDPTLSVLELWGAEYQESNALLLRPSDRSFLERVCQREKCPVDFVGKITGDGKIVLVDGLRKQNDVLEGARNPVDLELDWVLGKMPQKEFILEHRSVSLQPLTLPAGLSVLPALERVLRLPAVASKRYLTNKVDRSVTGLVAQQQCVGPLHTPLADVAVVALSPFSLQGAATAIGEQPIKGLLSPAAGARMAVGEALTNLVFARVSALKDVKCSGNWMWAAKLPGEGACLWDACQAMCEVMGQLGVAVDGGKDSLSMAARVSGET-VKAPGSLVISVYAVCPDITATVTPDLDNPEGKGVLLYVPVSAGKYRLGGSALAQCFGQLGDCSPDMDQPDKLSACFNTTQTLIQDRLLTAGHDVSDGGLISCLLEMAFAGNYGIEVDLPLEGVDV--------MEALFSEELSLVLEVCERNASSVCQRYTDAGLLCHRIG-TTSGFGPDAKVRVSLCGREVL-NERLPTLRAIWESTSFELERLQANPLCVQEEEQGLASRTQPYLKLTFDPSQTPIIKELATGKARVAVVREEGSNGDREMSASLFMAGFEVWDVTMQDLCSGSTTLDPFRAVVFVGGFSYADVLGSAKGWAATVTFNNRAREEFERFRKREDTLSLGVCNGCQLLALLGWVGERE-----DGGSDVTLTHNKSGRFESRFVSVGI-LPSPAIMLKGMEGSALGVWVAHGEGLMQFRSPEAQQKLIGSSLAPLRYVD-DSGNPTEI-YPINPNGSAQGVAGICSADGRHLAMMPHPERAVLSWQWAWAPQHLRGSLEPSPWLSMFRNAAAWCQ 1312          
BLAST of Phosphoribosylformylglycinamidine synthase vs. Ensembl Xenopus
Match: pfas (phosphoribosylformylglycinamidine synthase [Source:NCBI gene;Acc:100216263])

HSP 1 Score: 1260.74 bits (3261), Expect = 0.000e+0
Identity = 691/1350 (51.19%), Postives = 893/1350 (66.15%), Query Frame = 2
Query:   98 MEVLHFYQIVSFSNKLKRNLVDNNLLDGTIIATSEICYNIEIKGXXXXXXXXXXXXXXITR----SDNINDISSKPINFQLKKYNMSIEIGPRLNFCTPLSTNAVCILKSLGFNMISRFEISHIYHFSSENDNLLSKRNDIIKNIHDKMTEMAYPHQINSFNLNVAPSPVFTIDIMNEGIKALEEINKSMGLAMDEWDLLYYHDIFVNIMHRNPSNVECFDLAQSNSEHSRHWFFKGQMIIDGVEMEQSLFDILTETQKYSNQNNVIAFSDNSSAIKGFTTPILYINDPAYPSVYEIKDSFQNVCFTAETHNXXXXXXXXXXXXXXXXXRIRDIQAVGMGGYVVAGTAGYCFGNLRLPYYTLPWETDPCFKYPSNFAQASKIVIEASNGASDYGNEFGEPVINGFCRSFGMITHSGEWKEWIKPIMFSGGIGQLSSLHVNKSSPNVNQLVIKXXXXXXXXXXXXXAASSVEIQGDSSRDKELDLGAVQRGDAQMENKMNRVIRGCIDLRDLNPIKSIHDQGAGGNGNVLKELVDPLGAIIDASNFTLGDPTINLLELWGAEYQESNGLLIDERHLDQFKKICDRERCPINVVGKVTGDGNIRLINSVALEEELDPS----MPYIVDLDLSVVLGKMPKKKFYLKHVEKILSPLKLPLNLQVEDALSRVLRLPSVGSKRFLTNKVDRSVSGLVAQQQCVGPLHTPLADVAIVALSYFDIVGAATAIGEQPIKMLINVKEGAKLCVIEALTNLCMIPVTSFEDIKVSGNWMWPAKLPGEGAALWDACNAFCSLLKDLKIAIDGGKDSLSMAATVNDNTVVKSPGSLVVSAYVCCPDIRLAVTPDLKGDGS---LIWIRM-NSQYRLGGSALAQVYCQLGDKCPEFDNVGLFKKSWNCLQKIFMEKLASAAHDISDGGLIGCLLEMAFAGNVGIDVIINASIADCDASNSSAEISILFNEETGWIIEVPNNYLSTVINDLESNELLFSLIGHSCKRYEVTPTVTLTVNELNIFSNFKLGEFRTMWEDTSYHLEKLQCNTECVNKE---YQFYGNP--NITSNPFVISDSWLKPYNKINSKVFRVAILREEGSNGDREMAAAFIKSGFETWDITMQDLLSDLITLEEFNGLIFVGGFSFGDVLGSAKGWAAAIKYNEKIKKKFQNFKIREDTFSLGVCNGCQLMTWLGWLNDSHSLDNCE--MKRDIILSHNDSNRFESRFSVVSIPQNTKSIMLSRLLGARLGVWVAHGEGKFEFTNQEFCSQALSDGLIALNYVNLDATNDDVVNYPFNPNGSISNVAGLCSKDGRHLAIMPHPERSFMWWQWAYTGD-LDVSTEVSPWMCIFNSAYEWVEK 4087
            M VLHFY+ +  S++  R     N+         E+CYN+   G      Q    L  +        +I+D SS       +  ++ +EIGPRLNF T  STNAV I +S+G   + R E S  Y    +     S+  +++ +++D+MTE  YP  + SF ++V P  V+ +DI+ +G  ALE+ N  +GLA D WDL YY  +F  +  RNPS+VECFDLAQSNSEHSRHWFFKG++ +DG E E SLFD++ +TQ  SN NNVI F DNSSAI+G     L   DP+    Y +  S +++ FTAETHNFPTGVAPF GA TGTGGRIRD+Q+ G G +V+AGTAGYCFGNL +P Y+LPWE D  ++YP  FA+  ++ IEASNGASDYGN+FGEPV+ GF RSFG+   SGE +EW+KPIMFSGGIG +  +H  K +P     V+K+GGPVYRIGVGGGAASS+++QGD++   ELD GAVQRGDA+ME KMNR +R C++    NPI SIHDQGAGGNGNVLKEL +P GA+I   +F LGDPT+++LE+WGAEYQESN LL+     +  + +C RER P++ VGK+TGDG I LIN    +   D +    +P  VDL L  VLGKMP+K+F L  V   L PL LP  L V  AL RVLRLPSV SKR+LTNKVDRSV+GLVAQQQCVGPLHTPLADVA+V+LSY DIVG ATAIGEQPIK L+N   GA+L V EALTNL    VT  +D+K SGNWMW AKLPGEGA L+DAC A C ++  L +AIDGGKDSLSMAA V   T VK+PGSLV+S Y  CPDI   VTPDLK  G    L+++ +   Q+RLGGSALAQ Y QLG+  P+ D+       +N  Q++  +++ SA HD+SDGGL+ C+LEMAFAGN G+D+ I++S  +         + +LF EE G ++EV    +  V+    +  +    IG + +R   +  V +  N   +  N KLG  R +WE+TS+ LE+LQ N  CV++E    +    P  ++T NP  I    L P + +     RVA++REEGSNGDREMAA+ + +GF+ WD+TM+DLL+   TL+ F GL+FVGGFS+ DVLGSAKGWAA++K+N  ++++F+NF+ R DTFSLGVCNGCQLM  LGW+   +  D       + ++LSHN S RFESRF  + I Q + SI+L  + G+ LGVWVAHGEG   F + +      S+ L  L YV  D        YP NPNGS   +AGLCS DGRHLA+MPHPER  M WQW +  +    S +VSPWM +F + Y W ++
Sbjct:    1 MVVLHFYRSLQNSSETLRLPGAENIQS----LQRELCYNVNWTGPAAPSSQETDALRWLFSCPFDPQSISDTSS----LHSEPSDLLVEIGPRLNFSTATSTNAVSICRSVGLTNVDRIECSKRYLIKFQTRPQGSEEQELLASLYDRMTECVYPEPVRSFEVSVRPEKVYEVDILGQGRAALEKANTELGLAFDSWDLDYYSSLFQRV-GRNPSSVECFDLAQSNSEHSRHWFFKGKLKVDGQEKEMSLFDMIMKTQDTSNPNNVIKFCDNSSAIQGREVASLIPTDPSCAGPYHLCRSTRHLIFTAETHNFPTGVAPFSGATTGTGGRIRDVQSTGRGAHVIAGTAGYCFGNLHIPGYSLPWE-DLAYQYPVQFARPLEVAIEASNGASDYGNKFGEPVLAGFARSFGLRLPSGERREWVKPIMFSGGIGSMEDVHRTKEAPEPGMHVVKVGGPVYRIGVGGGAASSIQVQGDNA--SELDFGAVQRGDAEMEQKMNRAVRACVERGGKNPICSIHDQGAGGNGNVLKELSEPQGAVIYTKSFQLGDPTLSVLEIWGAEYQESNALLLRPDDAEFLRSVCRRERSPVDFVGKITGDGRIVLINGSDTDPAPDSTDRNAVP--VDLQLEWVLGKMPRKEFVLNRVAPNLQPLVLPSGLTVGQALDRVLRLPSVASKRYLTNKVDRSVTGLVAQQQCVGPLHTPLADVAVVSLSYSDIVGGATAIGEQPIKSLLNPAAGARLAVAEALTNLLFAQVTDLKDVKCSGNWMWAAKLPGEGALLYDACAAMCDVMAQLGVAIDGGKDSLSMAARVGTET-VKAPGSLVISVYAVCPDITTTVTPDLKNPGQKGVLLYLPLCPGQHRLGGSALAQCYSQLGETPPDLDDPQTLISCFNVTQQLLRDRVLSAGHDVSDGGLVTCILEMAFAGNCGLDIEISSSCTNV--------LELLFAEEPGLVLEVAEQSVELVMERYRAAGVECVRIGCTKERGPAS-MVRIRANGQEVV-NEKLGSLRAVWEETSFQLERLQANPSCVSQEEAGLRVREGPSYHLTFNPSEIP---LVPPS-VGGNQPRVAVVREEGSNGDREMAASLLMAGFQVWDVTMEDLLAGGTTLDSFRGLVFVGGFSYADVLGSAKGWAASVKFNASVREQFENFRRRADTFSLGVCNGCQLMALLGWVGPDNPTDTVGDLPTQGVLLSHNLSGRFESRFVTLKI-QQSPSILLRGMAGSTLGVWVAHGEGYMRFRSPKVQDYVTSNHLAPLCYV--DDGGKPTEEYPMNPNGSPLGIAGLCSADGRHLAMMPHPERCVMKWQWPWMPESWRHSLDVSPWMRLFQNGYRWCQE 1318          
BLAST of Phosphoribosylformylglycinamidine synthase vs. Ensembl Xenopus
Match: pfas (phosphoribosylformylglycinamidine synthase [Source:NCBI gene;Acc:100216263])

HSP 1 Score: 1251.5 bits (3237), Expect = 0.000e+0
Identity = 675/1282 (52.65%), Postives = 870/1282 (67.86%), Query Frame = 2
Query:  287 NINDISSKPINFQLKKYNMSIEIGPRLNFCTPLSTNAVCILKSLGFNMISRFEISHIYHFSSENDNLLSKRNDIIKNIHDKMTEMAYPHQINSFNLNVAPSPVFTIDIMNEGIKALEEINKSMGLAMDEWDLLYYHDIFVNIMHRNPSNVECFDLAQSNSEHSRHWFFKGQMIIDGVEMEQSLFDILTETQKYSNQNNVIAFSDNSSAIKGFTTPILYINDPAYPSVYEIKDSFQNVCFTAETHNXXXXXXXXXXXXXXXXXRIRDIQAVGMGGYVVAGTAGYCFGNLRLPYYTLPWETDPCFKYPSNFAQASKIVIEASNGASDYGNEFGEPVINGFCRSFGMITHSGEWKEWIKPIMFSGGIGQLSSLHVNKSSPNVNQLVIKXXXXXXXXXXXXXAASSVEIQGDSSRDKELDLGAVQRGDAQMENKMNRVIRGCIDLRDLNPIKSIHDQGAGGNGNVLKELVDPLGAIIDASNFTLGDPTINLLELWGAEYQESNGLLIDERHLDQFKKICDRERCPINVVGKVTGDGNIRLINSVALEEELDPS----MPYIVDLDLSVVLGKMPKKKFYLKHVEKILSPLKLPLNLQVEDALSRVLRLPSVGSKRFLTNKVDRSVSGLVAQQQCVGPLHTPLADVAIVALSYFDIVGAATAIGEQPIKMLINVKEGAKLCVIEALTNLCMIPVTSFEDIKVSGNWMWPAKLPGEGAALWDACNAFCSLLKDLKIAIDGGKDSLSMAATVNDNTVVKSPGSLVVSAYVCCPDIRLAVTPDLKGDGS---LIWIRM-NSQYRLGGSALAQVYCQLGDKCPEFDNVGLFKKSWNCLQKIFMEKLASAAHDISDGGLIGCLLEMAFAGNVGIDVIINASIADCDASNSSAEISILFNEETGWIIEVPNNYLSTVINDLESNELLFSLIGHSCKRYEVTPTVTLTVNELNIFSNFKLGEFRTMWEDTSYHLEKLQCNTECVNKE---YQFYGNP--NITSNPFVISDSWLKPYNKINSKVFRVAILREEGSNGDREMAAAFIKSGFETWDITMQDLLSDLITLEEFNGLIFVGGFSFGDVLGSAKGWAAAIKYNEKIKKKFQNFKIREDTFSLGVCNGCQLMTWLGWLNDSHSLDNCEMK-RDIILSHNDSNRFESRFSVVSIPQNTKSIMLSRLLGARLGVWVAHGEGKFEFTNQEFCSQALSDGLIALNYVNLDATNDDVVNYPFNPNGSISNVAGLCSKDGRHLAIMPHPERSFMWWQWAYTGD-LDVSTEVSPWMCIFNSAYEWVEK 4087
            +I+D SS       +  ++ +EIGPRLNF T  STNAV I +S+G   + R E S  Y     N +      +++ +++D+MTE  YP  + SF ++V P  V+ +DI+ +G  ALE+ N  +GLA D WDL YY  +F  +  RNPS+VECFDLAQSNSEHSRHWFFKG++ +DG E E SLFD++ +TQ  SN NNVI F DNSSAI+G     L   DP+    Y +  S +++ FTAETHNFPTGVAPF GA TGTGGRIRD+Q+ G G +V+AGTAGYCFGNL +P Y+LPWE D  ++YP  FA+  ++ IEASNGASDYGN+FGEPV+ GF RSFG+   SGE +EW+KPIMFSGGIG +  +H  K +P     V+K+GGPVYRIGVGGGAASS+++QGD++   ELD GAVQRGDA+ME KMNR +R C++    NPI SIHDQGAGGNGNVLKEL +P GA+I   +F LGDPT+++LE+WGAEYQESN LL+     +  + +C RER P++ VGK+TGDG I LIN    +   D +    +P  VDL L  VLGKMP+K+F L  V   L PL LP  L V  AL RVLRLPSV SKR+LTNKVDRSV+GLVAQQQCVGPLHTPLADVA+V+LSY DIVG ATAIGEQPIK L+N   GA+L V EALTNL    VT  +D+K SGNWMW AKLPGEGA L+DAC A C ++  L +AIDGGKDSLSMAA V   T VK+PGSLV+S Y  CPDI   VTPDLK  G    L+++ +   Q+RLGGSALAQ Y QLG+  P+ D+       +N  Q++  +++ SA HD+SDGGL+ C+LEMAFAGN G+D+ I++S  +         + +LF EE G ++EV    +  V+    +  +    IG + +R   +  V +  N   +  N KLG  R +WE+TS+ LE+LQ N  CV++E    +    P  ++T NP  I    L P + +     RVA++REEGSNGDREMAA+ + +GF+ WD+TM+DLL+   TL+ F GL+FVGGFS+ DVLGSAKGWAA++K+N  ++++F+NF+ R DTFSLGVCNGCQLM  LGW+   +  D  ++  + ++LSHN S RFESRF  + I Q + SI+L  + G+ LGVWVAHGEG   F + +      S+ L  L YV  D        YP NPNGS   +AGLCS DGRHLA+MPHPER  M WQW +  +    S +VSPWM +F + Y W ++
Sbjct:   38 SISDTSS----LHSEPSDLLVEIGPRLNFSTATSTNAVSICRSVGLTNVDRIECSKRYLIKVGNPS-----QELLASLYDRMTECVYPEPVRSFEVSVRPEKVYEVDILGQGRAALEKANTELGLAFDSWDLDYYSSLFQRV-GRNPSSVECFDLAQSNSEHSRHWFFKGKLKVDGQEKEMSLFDMIMKTQDTSNPNNVIKFCDNSSAIQGREVASLIPTDPSCAGPYHLCRSTRHLIFTAETHNFPTGVAPFSGATTGTGGRIRDVQSTGRGAHVIAGTAGYCFGNLHIPGYSLPWE-DLAYQYPVQFARPLEVAIEASNGASDYGNKFGEPVLAGFARSFGLRLPSGERREWVKPIMFSGGIGSMEDVHRTKEAPEPGMHVVKVGGPVYRIGVGGGAASSIQVQGDNA--SELDFGAVQRGDAEMEQKMNRAVRACVERGGKNPICSIHDQGAGGNGNVLKELSEPQGAVIYTKSFQLGDPTLSVLEIWGAEYQESNALLLRPDDAEFLRSVCRRERSPVDFVGKITGDGRIVLINGSDTDPAPDSTDRNAVP--VDLQLEWVLGKMPRKEFVLNRVAPNLQPLVLPSGLTVGQALDRVLRLPSVASKRYLTNKVDRSVTGLVAQQQCVGPLHTPLADVAVVSLSYSDIVGGATAIGEQPIKSLLNPAAGARLAVAEALTNLLFAQVTDLKDVKCSGNWMWAAKLPGEGALLYDACAAMCDVMAQLGVAIDGGKDSLSMAARVGTET-VKAPGSLVISVYAVCPDITTTVTPDLKNPGQKGVLLYLPLCPGQHRLGGSALAQCYSQLGETPPDLDDPQTLISCFNVTQQLLRDRVLSAGHDVSDGGLVTCILEMAFAGNCGLDIEISSSCTNV--------LELLFAEEPGLVLEVAEQSVELVMERYRAAGVECVRIGCTKERGPAS-MVRIRANGQEVV-NEKLGSLRAVWEETSFQLERLQANPSCVSQEEAGLRVREGPSYHLTFNPSEIP---LVPPS-VGGNQPRVAVVREEGSNGDREMAASLLMAGFQVWDVTMEDLLAGGTTLDSFRGLVFVGGFSYADVLGSAKGWAASVKFNASVREQFENFRRRADTFSLGVCNGCQLMALLGWVGPDNPTDTGDLPTQGVLLSHNLSGRFESRFVTLKI-QQSPSILLRGMAGSTLGVWVAHGEGYMRFRSPKVQDYVTSNHLAPLCYV--DDGGKPTEEYPMNPNGSPLGIAGLCSADGRHLAMMPHPERCVMKWQWPWMPESWRHSLDVSPWMRLFQNGYRWCQE 1286          
BLAST of Phosphoribosylformylglycinamidine synthase vs. Ensembl Xenopus
Match: pfas (phosphoribosylformylglycinamidine synthase [Source:NCBI gene;Acc:100216263])

HSP 1 Score: 1250.73 bits (3235), Expect = 0.000e+0
Identity = 676/1283 (52.69%), Postives = 871/1283 (67.89%), Query Frame = 2
Query:  287 NINDISSKPINFQLKKYNMSIEIGPRLNFCTPLSTNAVCILKSLGFNMISRFEISHIYHFSSENDNLLSKRNDIIKNIHDKMTEMAYPHQINSFNLNVAPSPVFTIDIMNEGIKALEEINKSMGLAMDEWDLLYYHDIFVNIMHRNPSNVECFDLAQSNSEHSRHWFFKGQMIIDGVEMEQSLFDILTETQKYSNQNNVIAFSDNSSAIKGFTTPILYINDPAYPSVYEIKDSFQNVCFTAETHNXXXXXXXXXXXXXXXXXRIRDIQAVGMGGYVVAGTAGYCFGNLRLPYYTLPWETDPCFKYPSNFAQASKIVIEASNGASDYGNEFGEPVINGFCRSFGMITHSGEWKEWIKPIMFSGGIGQLSSLHVNKSSPNVNQLVIKXXXXXXXXXXXXXAASSVEIQGDSSRDKELDLGAVQRGDAQMENKMNRVIRGCIDLRDLNPIKSIHDQGAGGNGNVLKELVDPLGAIIDASNFTLGDPTINLLELWGAEYQESNGLLIDERHLDQFKKICDRERCPINVVGKVTGDGNIRLINSVALEEELDPS----MPYIVDLDLSVVLGKMPKKKFYLKHVEKILSPLKLPLNLQVEDALSRVLRLPSVGSKRFLTNKVDRSVSGLVAQQQCVGPLHTPLADVAIVALSYFDIVGAATAIGEQPIKMLINVKEGAKLCVIEALTNLCMIPVTSFEDIKVSGNWMWPAKLPGEGAALWDACNAFCSLLKDLKIAIDGGKDSLSMAATVNDNTVVKSPGSLVVSAYVCCPDIRLAVTPDLKGDGS---LIWIRM-NSQYRLGGSALAQVYCQLGDKCPEFDNVGLFKKSWNCLQKIFMEKLASAAHDISDGGLIGCLLEMAFAGNVGIDVIINASIADCDASNSSAEISILFNEETGWIIEVPNNYLSTVINDLESNELLFSLIGHSCKRYEVTPTVTLTVNELNIFSNFKLGEFRTMWEDTSYHLEKLQCNTECVNKE---YQFYGNP--NITSNPFVISDSWLKPYNKINSKVFRVAILREEGSNGDREMAAAFIKSGFETWDITMQDLLSDLITLEEFNGLIFVGGFSFGDVLGSAKGWAAAIKYNEKIKKKFQNFKIREDTFSLGVCNGCQLMTWLGWLNDSHSLDNCE--MKRDIILSHNDSNRFESRFSVVSIPQNTKSIMLSRLLGARLGVWVAHGEGKFEFTNQEFCSQALSDGLIALNYVNLDATNDDVVNYPFNPNGSISNVAGLCSKDGRHLAIMPHPERSFMWWQWAYTGD-LDVSTEVSPWMCIFNSAYEWVEK 4087
            +I+D SS       +  ++ +EIGPRLNF T  STNAV I +S+G   + R E S  Y     N +  S+  +++ +++D+MTE  YP  + SF ++V P  V+ +DI+ +G  ALE+ N  +GLA D WDL YY  +F  +  RNPS+VECFDLAQSNSEHSRHWFFKG++ +DG E E SLFD++ +TQ  SN NNVI F DNSSAI+G     L   DP+    Y +  S +++ FTAETHNFPTGVAPF GA TGTGGRIRD+Q+ G G +V+AGTAGYCFGNL +P Y+LPWE D  ++YP  FA+  ++ IEASNGASDYGN+FGEPV+ GF RSFG+   SGE +EW+KPIMFSGGIG +  +H  K +P     V+K+GGPVYRIGVGGGAASS+++QGD++   ELD GAVQRGDA+ME KMNR +R C++    NPI SIHDQGAGGNGNVLKEL +P GA+I   +F LGDPT+++LE+WGAEYQESN LL+     +  + +C RER P++ VGK+TGDG I LIN    +   D +    +P  VDL L  VLGKMP+K+F L  V   L PL LP  L V  AL RVLRLPSV SKR+LTNKVDRSV+GLVAQQQCVGPLHTPLADVA+V+LSY DIVG ATAIGEQPIK L+N   GA+L V EALTNL    VT  +D+K SGNWMW AKLPGEGA L+DAC A C ++  L +AIDGGKDSLSMAA V   T VK+PGSLV+S Y  CPDI   VTPDLK  G    L+++ +   Q+RLGGSALAQ Y QLG+  P+ D+       +N  Q++  +++ SA HD+SDGGL+ C+LEMAFAGN G+D+ I++S  +         + +LF EE G ++EV    +  V+    +  +    IG + +R   +  V +  N   +  N KLG  R +WE+TS+ LE+LQ N  CV++E    +    P  ++T NP   S+  L P + +     RVA++REEGSNGDREMAA+ + +GF+ WD+TM+DLL+   TL+ F GL+FVGGFS+ DVLGSAKGWAA++K+N  ++++F+NF+ R DTFSLGVCNGCQLM  LGW+   +  D       + ++LSHN S RFESRF  + I Q + SI+L  + G+ LGVWVAHGEG   F + +      S+ L  L YV  D        YP NPNGS   +AGLCS DGRHLA+MPHPER  M WQW +  +    S +VSPWM +F + Y W ++
Sbjct:   49 SISDTSS----LHSEPSDLLVEIGPRLNFSTATSTNAVSICRSVGLTNVDRIECSKRYLIKVGNPSG-SEEQELLASLYDRMTECVYPEPVRSFEVSVRPEKVYEVDILGQGRAALEKANTELGLAFDSWDLDYYSSLFQRV-GRNPSSVECFDLAQSNSEHSRHWFFKGKLKVDGQEKEMSLFDMIMKTQDTSNPNNVIKFCDNSSAIQGREVASLIPTDPSCAGPYHLCRSTRHLIFTAETHNFPTGVAPFSGATTGTGGRIRDVQSTGRGAHVIAGTAGYCFGNLHIPGYSLPWE-DLAYQYPVQFARPLEVAIEASNGASDYGNKFGEPVLAGFARSFGLRLPSGERREWVKPIMFSGGIGSMEDVHRTKEAPEPGMHVVKVGGPVYRIGVGGGAASSIQVQGDNA--SELDFGAVQRGDAEMEQKMNRAVRACVERGGKNPICSIHDQGAGGNGNVLKELSEPQGAVIYTKSFQLGDPTLSVLEIWGAEYQESNALLLRPDDAEFLRSVCRRERSPVDFVGKITGDGRIVLINGSDTDPAPDSTDRNAVP--VDLQLEWVLGKMPRKEFVLNRVAPNLQPLVLPSGLTVGQALDRVLRLPSVASKRYLTNKVDRSVTGLVAQQQCVGPLHTPLADVAVVSLSYSDIVGGATAIGEQPIKSLLNPAAGARLAVAEALTNLLFAQVTDLKDVKCSGNWMWAAKLPGEGALLYDACAAMCDVMAQLGVAIDGGKDSLSMAARVGTET-VKAPGSLVISVYAVCPDITTTVTPDLKNPGQKGVLLYLPLCPGQHRLGGSALAQCYSQLGETPPDLDDPQTLISCFNVTQQLLRDRVLSAGHDVSDGGLVTCILEMAFAGNCGLDIEISSSCTNV--------LELLFAEEPGLVLEVAEQSVELVMERYRAAGVECVRIGCTKERGPAS-MVRIRANGQEVV-NEKLGSLRAVWEETSFQLERLQANPSCVSQEEAGLRVREGPSYHLTFNP---SEIPLVPPS-VGGNQPRVAVVREEGSNGDREMAASLLMAGFQVWDVTMEDLLAGGTTLDSFRGLVFVGGFSYADVLGSAKGWAASVKFNASVREQFENFRRRADTFSLGVCNGCQLMALLGWVGPDNPTDTVGDLPTQGVLLSHNLSGRFESRFVTLKI-QQSPSILLRGMAGSTLGVWVAHGEGYMRFRSPKVQDYVTSNHLAPLCYV--DDGGKPTEEYPMNPNGSPLGIAGLCSADGRHLAMMPHPERCVMKWQWPWMPESWRHSLDVSPWMRLFQNGYRWCQE 1302          
BLAST of Phosphoribosylformylglycinamidine synthase vs. Ensembl Xenopus
Match: pfas (phosphoribosylformylglycinamidine synthase [Source:NCBI gene;Acc:100216263])

HSP 1 Score: 1246.49 bits (3224), Expect = 0.000e+0
Identity = 688/1356 (50.74%), Postives = 891/1356 (65.71%), Query Frame = 2
Query:   98 MEVLHFYQIVSFSNKLKRNLVDNNLLDGTIIATSEICYNIEIKGXXXXXXXXXXXXXXITR----SDNINDISSKPINFQLKKYNMSIEIGPRLNFCTPLSTNAVCILKSLGFNMISRFEISHIYHFSSENDNLLSKRNDIIKNIHDKMTEMAYPHQINSFNLNVAPSPVFTIDIMNEGIKALEEINKSMGLAMDEWDLLYYHDIFVNIMHRNPSNVECFDLAQSNSEHSRHWFFKGQMIIDGVEMEQSLFDILTETQKYSNQNNVIAFSDNSSAIKGFTTPILYINDPAYPSVYEIKDSFQNVCFTAETHNXXXXXXXXXXXXXXXXXRIRDIQAVGMGGYVVAGTAGYCFGNLRLPYYTLPWETDPCFKYPSNFAQASKIVIEASNGASDYGNEFGEPVINGFCRSFGMITHSGEWKEWIKPIMFSGGIGQLSSLHVNKSSPNVNQLVIKXXXXXXXXXXXXXAASSVEIQGDSSRDKELDLGAVQRGDAQMENKMNRVIRGCIDLRDLNPIKSIHDQGAGGNGNVLKELVDPLGAIIDASNFTLGDPTINLLELWGAEYQESNGLLIDERHLDQFKKICDRERCPINVVGKVTGDGNIRLINSVALEEELDPS----MPYIVDLDLSVVLGKMPKKKFYLKHVEKILSPLKLPLNLQVEDALSRVLRLPSVGSKRFLTNKVDRSVSGLVAQQQCVGPLHTPLADVAIVALSYFDIVGAATAIGEQPIKMLINVKEGAKLCVIEALTNLCMIPVTSFEDIKVSGNWMWPAKLPGEGAALWDACNAFCSLLKDLKIAIDGGKDSLSMAATVNDNTVVKSPGSLVVSAYVCCPDIRLAVTPDLKGDGS---LIWIRM-NSQYRLGGSALAQVYCQLGDKCPEFDNVGLFKKSWNCLQKIFMEKLASAAHDISDGGLIGCLLEMAFAGNVGIDVIINASIADCDASNSSAEISILFNEETGWIIEVPNNYLSTVINDLESNELLFSLIGHSCKRYEVTPTVTLTVNELNIFSNFKLGEFRTMWEDTSYHLEKLQCNTECVNKE---YQFYGNP--NITSNPFVISDSWLKPYNKINSKVFRVAILREEGSNGDREMAAAFIKSGFETWDITMQDLLSDLITLEEFNGLIFVGGFSFGDVLGSAKGWAAAIKYNEKIKKKFQNFKIREDTFSLGVCNGCQLMTWLGWLNDSHSLDNCEM--------KRDIILSHNDSNRFESRFSVVSIPQNTKSIMLSRLLGARLGVWVAHGEGKFEFTNQEFCSQALSDGLIALNYVNLDATNDDVVNYPFNPNGSISNVAGLCSKDGRHLAIMPHPERSFMWWQWAYTGD-LDVSTEVSPWMCIFNSAYEWVEK 4087
            M VLHFY+ +  S++  R     N+         E+CYN+   G      Q    L  +        +I+D SS       +  ++ +EIGPRLNF T  STNAV I +S+G   + R E S  Y    +     S+  +++ +++D+MTE  YP  + SF ++V P  V+ +DI+ +G  ALE+ N  +GLA D WDL YY  +F  +  RNPS+VECFDLAQSNS   RHWFFKG++ +DG E E SLFD++ +TQ  SN NNVI F DNSSAI+G     L   DP+    Y +  S +++ FTAETHNFPTGVAPF GA TGTGGRIRD+Q+ G G +V+AGTAGYCFGNL +P Y+LPWE D  ++YP  FA+  ++ IEASNGASDYGN+FGEPV+ GF RSFG+   SGE +EW+KPIMFSGGIG +  +H  K +P     V+K+GGPVYRIGVGGGAASS+++QGD++   ELD GAVQRGDA+ME KMNR +R C++    NPI SIHDQGAGGNGNVLKEL +P GA+I   +F LGDPT+++LE+WGAEYQESN LL+     +  + +C RER P++ VGK+TGDG I LIN    +   D +    +P  VDL L  VLGKMP+K+F L  V   L PL LP  L V  AL RVLRLPSV SKR+LTNKVDRSV+GLVAQQQCVGPLHTPLADVA+V+LSY DIVG ATAIGEQPIK L+N   GA+L V EALTNL    VT  +D+K SGNWMW AKLPGEGA L+DAC A C ++  L +AIDGGKDSLSMAA V   T VK+PGSLV+S Y  CPDI   VTPDLK  G    L+++ +   Q+RLGGSALAQ Y QLG+  P+ D+       +N  Q++  +++ SA HD+SDGGL+ C+LEMAFAGN G+D+ I++S  +         + +LF EE G ++EV    +  V+    +  +    IG + +R   +  V +  N   +  N KLG  R +WE+TS+ LE+LQ N  CV++E    +    P  ++T NP  I    L P + +     RVA++REEGSNGDREMAA+ + +GF+ WD+TM+DLL+   TL+ F GL+FVGGFS+ DVLGSAKGWAA++K+N  ++++F+NF+ R DTFSLGVCNGCQLM  LGW+   +  D  +          + ++LSHN S RFESRF  + I Q + SI+L  + G+ LGVWVAHGEG   F + +      S+ L  L YV  D        YP NPNGS   +AGLCS DGRHLA+MPHPER  M WQW +  +    S +VSPWM +F + Y W ++
Sbjct:   25 MVVLHFYRSLQNSSETLRLPGAENIQS----LQRELCYNVNWTGPAAPSSQETDALRWLFSCPFDPQSISDTSS----LHSEPSDLLVEIGPRLNFSTATSTNAVSICRSVGLTNVDRIECSKRYLIKFQTRPQGSEEQELLASLYDRMTECVYPEPVRSFEVSVRPEKVYEVDILGQGRAALEKANTELGLAFDSWDLDYYSSLFQRV-GRNPSSVECFDLAQSNS---RHWFFKGKLKVDGQEKEMSLFDMIMKTQDTSNPNNVIKFCDNSSAIQGREVASLIPTDPSCAGPYHLCRSTRHLIFTAETHNFPTGVAPFSGATTGTGGRIRDVQSTGRGAHVIAGTAGYCFGNLHIPGYSLPWE-DLAYQYPVQFARPLEVAIEASNGASDYGNKFGEPVLAGFARSFGLRLPSGERREWVKPIMFSGGIGSMEDVHRTKEAPEPGMHVVKVGGPVYRIGVGGGAASSIQVQGDNA--SELDFGAVQRGDAEMEQKMNRAVRACVERGGKNPICSIHDQGAGGNGNVLKELSEPQGAVIYTKSFQLGDPTLSVLEIWGAEYQESNALLLRPDDAEFLRSVCRRERSPVDFVGKITGDGRIVLINGSDTDPAPDSTDRNAVP--VDLQLEWVLGKMPRKEFVLNRVAPNLQPLVLPSGLTVGQALDRVLRLPSVASKRYLTNKVDRSVTGLVAQQQCVGPLHTPLADVAVVSLSYSDIVGGATAIGEQPIKSLLNPAAGARLAVAEALTNLLFAQVTDLKDVKCSGNWMWAAKLPGEGALLYDACAAMCDVMAQLGVAIDGGKDSLSMAARVGTET-VKAPGSLVISVYAVCPDITTTVTPDLKNPGQKGVLLYLPLCPGQHRLGGSALAQCYSQLGETPPDLDDPQTLISCFNVTQQLLRDRVLSAGHDVSDGGLVTCILEMAFAGNCGLDIEISSSCTNV--------LELLFAEEPGLVLEVAEQSVELVMERYRAAGVECVRIGCTKERGPAS-MVRIRANGQEVV-NEKLGSLRAVWEETSFQLERLQANPSCVSQEEAGLRVREGPSYHLTFNPSEIP---LVPPS-VGGNQPRVAVVREEGSNGDREMAASLLMAGFQVWDVTMEDLLAGGTTLDSFRGLVFVGGFSYADVLGSAKGWAASVKFNASVREQFENFRRRADTFSLGVCNGCQLMALLGWVGPDNPTDTGKYVFPVGDLPTQGVLLSHNLSGRFESRFVTLKI-QQSPSILLRGMAGSTLGVWVAHGEGYMRFRSPKVQDYVTSNHLAPLCYV--DDGGKPTEEYPMNPNGSPLGIAGLCSADGRHLAMMPHPERCVMKWQWPWMPESWRHSLDVSPWMRLFQNGYRWCQE 1345          
BLAST of Phosphoribosylformylglycinamidine synthase vs. Ensembl Xenopus
Match: pfas (phosphoribosylformylglycinamidine synthase [Source:NCBI gene;Acc:100216263])

HSP 1 Score: 1242.25 bits (3213), Expect = 0.000e+0
Identity = 673/1293 (52.05%), Postives = 870/1293 (67.29%), Query Frame = 2
Query:  287 NINDISSKPINFQLKKYNMSIEIGPRLNFCTPLSTNAVCILKSLGFNMISRFEISHIYHFSSENDNLLSKRNDIIKNIHDKMTEMAYPHQINSFNLNVAPSPVFTIDIMNEGIKALEEINKSMGLAMDEWDLLYYHDIFVNIMHRNPSNVECFDLAQSNSEHSRHWFFKGQMIIDGVEMEQSLFDILTETQKYSNQNNVIAFSDNSSAIKGFTTPILYINDPAYPSVYEIKDSFQNVCFTAETHNXXXXXXXXXXXXXXXXXRIRDIQAVGMGGYVVAGTAGYCFGNLRLPYYTLPWETDPCFKYPSNFAQASKIVIEASNGASDYGNEFGEPVINGFCRSFGMITHSGEWKEWIKPIMFSGGIGQLSSLHVNKSSPNVNQLVIKXXXXXXXXXXXXXAASSVEIQGDSSRDKELDLGAVQRGDAQMENKMNRVIRGCIDLRDLNPIKSIHDQGAGGNGNVLKELVDPLGAIIDASNFTLGDPTINLLELWGAEYQESNGLLIDERHLDQFKKICDRERCPINVVGKVTGDGNIR--------LINSVALEEELDP------SMPYIVDLDLSVVLGKMPKKKFYLKHVEKILSPLKLPLNLQVEDALSRVLRLPSVGSKRFLTNKVDRSVSGLVAQQQCVGPLHTPLADVAIVALSYFDIVGAATAIGEQPIKMLINVKEGAKLCVIEALTNLCMIPVTSFEDIKVSGNWMWPAKLPGEGAALWDACNAFCSLLKDLKIAIDGGKDSLSMAATVNDNTVVKSPGSLVVSAYVCCPDIRLAVTPDLKGDGS---LIWIRM-NSQYRLGGSALAQVYCQLGDKCPEFDNVGLFKKSWNCLQKIFMEKLASAAHDISDGGLIGCLLEMAFAGNVGIDVIINASIADCDASNSSAEISILFNEETGWIIEVPNNYLSTVINDLESNELLFSLIGHSCKRYEVTPTVTLTVNELNIFSNFKLGEFRTMWEDTSYHLEKLQCNTECVNKE---YQFYGNP--NITSNPFVISDSWLKPYNKINSKVFRVAILREEGSNGDREMAAAFIKSGFETWDITMQDLLSDLITLEEFNGLIFVGGFSFGDVLGSAKGWAAAIKYNEKIKKKFQNFKIREDTFSLGVCNGCQLMTWLGWLNDSHSLDNCE--MKRDIILSHNDSNRFESRFSVVSIPQNTKSIMLSRLLGARLGVWVAHGEGKFEFTNQEFCSQALSDGLIALNYVNLDATNDDVVNYPFNPNGSISNVAGLCSKDGRHLAIMPHPERSFMWWQWAYTGD-LDVSTEVSPWMCIFNSAYEWVEK 4087
            +I+D SS       +  ++ +EIGPRLNF T  STNAV I +S+G   + R E S  Y          S+  +++ +++D+MTE  YP  + SF ++V P  V+ +DI+ +G  ALE+ N  +GLA D WDL YY  +F  +  RNPS+VECFDLAQSNSEHSRHWFFKG++ +DG E E SLFD++ +TQ  SN NNVI F DNSSAI+G     L   DP+    Y +  S +++ FTAETHNFPTGVAPF GA TGTGGRIRD+Q+ G G +V+AGTAGYCFGNL +P Y+LPWE D  ++YP  FA+  ++ IEASNGASDYGN+FGEPV+ GF RSFG+   SGE +EW+KPIMFSGGIG +  +H  K +P     V+K+GGPVYRIGVGGGAASS+++QGD++   ELD GAVQRGDA+ME KMNR +R C++    NPI SIHDQGAGGNGNVLKEL +P GA+I   +F LGDPT+++LE+WGAEYQESN LL+     +  + +C RER P++ VGK+TGDG +          IN   ++ +  P      ++P  VDL L  VLGKMP+K+F L  V   L PL LP  L V  AL RVLRLPSV SKR+LTNKVDRSV+GLVAQQQCVGPLHTPLADVA+V+LSY DIVG ATAIGEQPIK L+N   GA+L V EALTNL    VT  +D+K SGNWMW AKLPGEGA L+DAC A C ++  L +AIDGGKDSLSMAA V   T VK+PGSLV+S Y  CPDI   VTPDLK  G    L+++ +   Q+RLGGSALAQ Y QLG+  P+ D+       +N  Q++  +++ SA HD+SDGGL+ C+LEMAFAGN G+D+ I++S+           + +LF EE G ++EV    +  V+    +  +    IG + +R   +  V +  N   +  N KLG  R +WE+TS+ LE+LQ N  CV++E    +    P  ++T NP   S+  L P + +     RVA++REEGSNGDREMAA+ + +GF+ WD+TM+DLL+   TL+ F GL+FVGGFS+ DVLGSAKGWAA++K+N  ++++F+NF+ R DTFSLGVCNGCQLM  LGW+   +  D       + ++LSHN S RFESRF  + I Q + SI+L  + G+ LGVWVAHGEG   F + +      S+ L  L YV  D        YP NPNGS   +AGLCS DGRHLA+MPHPER  M WQW +  +    S +VSPWM +F + Y W ++
Sbjct:   59 SISDTSS----LHSEPSDLLVEIGPRLNFSTATSTNAVSICRSVGLTNVDRIECSKRYLIKG------SEEQELLASLYDRMTECVYPEPVRSFEVSVRPEKVYEVDILGQGRAALEKANTELGLAFDSWDLDYYSSLFQRV-GRNPSSVECFDLAQSNSEHSRHWFFKGKLKVDGQEKEMSLFDMIMKTQDTSNPNNVIKFCDNSSAIQGREVASLIPTDPSCAGPYHLCRSTRHLIFTAETHNFPTGVAPFSGATTGTGGRIRDVQSTGRGAHVIAGTAGYCFGNLHIPGYSLPWE-DLAYQYPVQFARPLEVAIEASNGASDYGNKFGEPVLAGFARSFGLRLPSGERREWVKPIMFSGGIGSMEDVHRTKEAPEPGMHVVKVGGPVYRIGVGGGAASSIQVQGDNA--SELDFGAVQRGDAEMEQKMNRAVRACVERGGKNPICSIHDQGAGGNGNVLKELSEPQGAVIYTKSFQLGDPTLSVLEIWGAEYQESNALLLRPDDAEFLRSVCRRERSPVDFVGKITGDGRVTAQEQICPVFINDPPIDTDPAPDSTDRNAVP--VDLQLEWVLGKMPRKEFVLNRVAPNLQPLVLPSGLTVGQALDRVLRLPSVASKRYLTNKVDRSVTGLVAQQQCVGPLHTPLADVAVVSLSYSDIVGGATAIGEQPIKSLLNPAAGARLAVAEALTNLLFAQVTDLKDVKCSGNWMWAAKLPGEGALLYDACAAMCDVMAQLGVAIDGGKDSLSMAARVGTET-VKAPGSLVISVYAVCPDITTTVTPDLKNPGQKGVLLYLPLCPGQHRLGGSALAQCYSQLGETPPDLDDPQTLISCFNVTQQLLRDRVLSAGHDVSDGGLVTCILEMAFAGNCGLDIEISSSL-----------LELLFAEEPGLVLEVAEQSVELVMERYRAAGVECVRIGCTKERGPAS-MVRIRANGQEVV-NEKLGSLRAVWEETSFQLERLQANPSCVSQEEAGLRVREGPSYHLTFNP---SEIPLVPPS-VGGNQPRVAVVREEGSNGDREMAASLLMAGFQVWDVTMEDLLAGGTTLDSFRGLVFVGGFSYADVLGSAKGWAASVKFNASVREQFENFRRRADTFSLGVCNGCQLMALLGWVGPDNPTDTVGDLPTQGVLLSHNLSGRFESRFVTLKI-QQSPSILLRGMAGSTLGVWVAHGEGYMRFRSPKVQDYVTSNHLAPLCYV--DDGGKPTEEYPMNPNGSPLGIAGLCSADGRHLAMMPHPERCVMKWQWPWMPESWRHSLDVSPWMRLFQNGYRWCQE 1314          
BLAST of Phosphoribosylformylglycinamidine synthase vs. Ensembl Mouse
Match: Pfas (phosphoribosylformylglycinamidine synthase (FGAR amidotransferase) [Source:MGI Symbol;Acc:MGI:2684864])

HSP 1 Score: 1198.73 bits (3100), Expect = 0.000e+0
Identity = 673/1362 (49.41%), Postives = 868/1362 (63.73%), Query Frame = 2
Query:  104 VLHFYQIVS-----FSNKLKRNLVDNNLLDGTIIATSEICYNIEIKGXXXXXXXXXXXXXXITRSDNINDISSKPINFQLKKYNMSIEIGPRLNFCTPLSTNAVCILKSLGFNMISRFEISHIYHFSSENDNLLSKRNDIIKNIHDKMTEMAYPHQINSFNLNVAPSPV-FTIDIMNEGIKALEEINKSMGLAMDEWDLLYYHDIFVNIMHRNPSNVECFDLAQSNSEHSRHWFFKGQMIIDGVEMEQSLFDILTETQKYSNQNNVIAFSDNSSAIKGFTTPILYINDPAYPSVYEIKDSFQNVCFTAETHNXXXXXXXXXXXXXXXXXRIRDIQAVGMGGYVVAGTAGYCFGNLRLPYYTLPWETDPCFKYPSNFAQASKIVIEASNGASDYGNEFGEPVINGFCRSFGMITHSGEWKEWIKPIMFSGGIGQLSSLHVNKSSPNVNQLVIKXXXXXXXXXXXXXAASSVEIQGDSSRDKELDLGAVQRGDAQMENKMNRVIRGCIDLRDLNPIKSIHDQGAGGNGNVLKELVDPLGAIIDASNFTLGDPTINLLELWGAEYQESNGLLIDERHLDQFKKICDRERCPINVVGKVTGDGNIRLINSVAL--------EEELDPSMPYIVDLDLSVVLGKMPKKKFYLKHVEKILSPLKLPLNLQVEDALSRVLRLPSVGSKRFLTNKVDRSVSGLVAQQQCVGPLHTPLADVAIVALSYFDIVGAATAIGEQPIKMLINVKEGAKLCVIEALTNLCMIPVTSFEDIKVSGNWMWPAKLPGEGAALWDACNAFCSLLKDLKIAIDGGKDSLSMAATVNDNTVVKSPGSLVVSAYVCCPDIRLAVTPDLK---GDGSLIWIRMN-SQYRLGGSALAQVYCQLGDKCPEFDNVGLFKKSWNCLQKIFMEKLASAAHDISDGGLIGCLLEMAFAGNVGIDVIINASIADCDASNSSAEISILFNEETGWIIEVPNNYLSTVINDLESNELLFSLIGHSCKRYEVTPT--VTLTVNELNIFSNFKLGEFRTMWEDTSYHLEKLQCNTECVNKEYQFYG---NPNITSNP-FVISDSWLKPYNKINSKVFRVAILREEGSNGDREMAAAFIKSGFETWDITMQDLLSDLITLEEFNGLIFVGGFSFGDVLGSAKGWAAAIKYNEKIKKKFQNFKIREDTFSLGVCNGCQLMTWLGWLNDSHSLDNCEMKRD-------IILSHNDSNRFESRFSVVSIPQNTKSIMLSRLLGARLGVWVAHGEGKFEFTNQEFCSQALSDGLIALNYVNLDATNDDVVNYPFNPNGSISNVAGLCSKDGRHLAIMPHPERSFMWWQWAYTGDLDVSTEVSPWMCIFNSAYEWVEKL*C 4096
            VLHFY   S      S ++ R L +   L       +E+CYN+    + L   +  + L  +     + D  ++         ++ +E+GPRLNF TP STN V + ++ G   + R E +  Y  S  +          +  +HD+MTE  YP  I SF+    P+P+  +IDI+ EG  ALE+ N+ +GLA+D WDL +Y   F   + RNPS VE FDLAQSNSEHSRHWFFKGQ+ +DG ++  SLF+ +  TQ  SN NNV+ F DNSSAI+G     L   D   PS ++ +   ++V FTAETHNFPTGVAPF GA TGTGGRIRD+Q  G G +VVAGTAGYCFGNL +P Y LPWE DP F+YP NFA+  ++ IEASNGASDYGN+FGEPV+ GF RS G+    G+ +EWIKPIMFSGGIG + + HV K  P     V+K+GGPVYRIGVGGGAASSV++QGD++ D  LD GAVQRGD +ME KMNRVIR C++    NPI S+HDQGAGGNGNVLKEL DP GAII  S F LGDPT+N LE+WGAEYQESN LL+     D   +   RERCP   VG +TGD  I L++            +  L P  P  VDLDL  VLGKMP+K+F+L+    +L PL LP  L V  AL+RVLRLP+V SKR+LTNKVDRSV GLVAQQQCVGPL TPLADVA+VALS+ + +GAATA+GEQP+K L++ K  A+L V EALTNL    VT   D+K SGNWMW AKLPGEGAAL DAC A  +++  L +A+DGGKDSLSMAA V   T V++PGSLV+SAY  CPDI   VTPDLK   G G L+++ ++  Q+RLGG+ALAQ + QLG+  P+ D      ++++  Q +  E    + HD+SDGGL+ CLLEMAFAGN GI+V       D  A    A + +LF EE G ++EV    ++ V    ES  L    +GH+    E  P     ++VN+  +     +GE R +WE+TS+ L+ LQ    CV +E Q       P+    P F ++    KP       V RVAILREEGSNGDREMA AF  +GFE WD+TMQDL S  I L+ F G+ FVGGFS+ DVLGSAKGWAAA+ +N + +++   F+ R DTFSLGVCNGCQL+  LGW+    S +  E  +D       ++L HN S RFESR++ V + +   ++ML  + G+ L VW AHGEG   F++ E  ++  + GL+ L++ + D    +   YP NPNGS   +AG+CS+DGRHLA+MPHPER+   WQWA+          SPW+ +F +A  W ++  C
Sbjct:    4 VLHFYVRPSGHEGAASGRVFRRLQEK--LPTLQSVETELCYNVHWAAETLPWAEEMKKLMWLFGCPLVRDDVAQEPWLVPGSNDLLLEVGPRLNFSTPASTNIVSVCQAAGLRAVDRVETTRRYRLSFTDHPTAEMEAISLAALHDRMTEQHYPDPIQSFSPQSIPAPLKGSIDILAEGRPALEKANQELGLALDSWDLDFYTKRFQE-LQRNPSTVEVFDLAQSNSEHSRHWFFKGQLHVDGKKLAHSLFESIMSTQASSNPNNVLKFCDNSSAIQGKKVKFLRPEDSTRPSCFQQQQGLRHVVFTAETHNFPTGVAPFSGATTGTGGRIRDVQCTGRGAHVVAGTAGYCFGNLHIPDYNLPWE-DPSFQYPGNFARPLEVAIEASNGASDYGNKFGEPVLAGFARSLGLQLPDGQRREWIKPIMFSGGIGSMEAKHVGKKPPEPGMEVVKVGGPVYRIGVGGGAASSVQVQGDNTSD--LDFGAVQRGDPEMEQKMNRVIRACVEAPGGNPICSLHDQGAGGNGNVLKELSDPEGAIIYTSRFQLGDPTLNALEIWGAEYQESNALLLRPSDRDFLSRASARERCPACFVGTITGDKRIVLVDDRECLVGKTGQGDAPLTPPTP--VDLDLDWVLGKMPQKEFFLQRKPPVLQPLALPPELSVRQALNRVLRLPAVASKRYLTNKVDRSVGGLVAQQQCVGPLQTPLADVAVVALSHQECIGAATALGEQPVKSLLDPKAAARLAVSEALTNLVFALVTDLRDVKCSGNWMWAAKLPGEGAALADACEAMVAVMAALGVAVDGGKDSLSMAARVGTET-VQAPGSLVISAYAVCPDITATVTPDLKHPGGKGHLLYVPLSPGQHRLGGTALAQCFSQLGEHPPDLDLPENLVRAFHITQGLLKECRLCSGHDVSDGGLVTCLLEMAFAGNCGIEV-------DVPAPGIHA-LPVLFAEEPGLVLEVQEADVAGVRQRYESAGLRCLELGHTG---EAGPQAMARISVNKAVVVEE-PVGELRALWEETSFQLDLLQAEPRCVIEEKQGLKERTGPSYYLPPTFPVASVPCKP----GGPVPRVAILREEGSNGDREMADAFHLAGFEVWDVTMQDLCSGAIRLDTFRGVAFVGGFSYADVLGSAKGWAAAVTFNPQAREELGRFRRRPDTFSLGVCNGCQLLALLGWVGSDPSEEQAEPGQDSQPTQPGLLLRHNLSGRFESRWATVRV-EPGPALMLRGMEGSVLPVWSAHGEGYMAFSSPELQAKIEAKGLVPLHWADDDGNPTE--QYPLNPNGSPGGIAGICSQDGRHLALMPHPERAVRLWQWAWRPSPFDVLPTSPWLQLFINARNWTQEDSC 1337          
BLAST of Phosphoribosylformylglycinamidine synthase vs. Ensembl Mouse
Match: Pfas (phosphoribosylformylglycinamidine synthase (FGAR amidotransferase) [Source:MGI Symbol;Acc:MGI:2684864])

HSP 1 Score: 339.347 bits (869), Expect = 1.452e-103
Identity = 195/483 (40.37%), Postives = 268/483 (55.49%), Query Frame = 2
Query: 2780 AAHDISDGGLIGCLLEMAFAGNVGIDVIINASIADCDASNSSAEISILFNEETGWIIEVPNNYLSTVINDLESNELLFSLIGHSCKRYEVTPTV--TLTVNELNIFSNFKLGEFRTMWEDTSYHLEKLQCNTECVNKEYQFYG---NPNITSNP-FVISDSWLKPYNKINSKVFRVAILREEGSNGDREMAAAFIKSGFETWDITMQDLLSDLITLEEFNGLIFVGGFSFGDVLGSAKGWAAAIKYNEKIKKKFQNFKIREDTFSLGVCNGCQLMTWLGWLNDSHSLDNCEMKRD-------IILSHNDSNRFESRFSVVSIPQNTKSIMLSRLLGARLGVWVAHGEGK-------------------------------FEFTNQEFCSQALSDGLIALNYVNLDATNDDVVNYPFNPNGSISNVAGLCSKDGRHLAIMPHPERSFMWWQWAYTGDLDVSTEVSPWMCIFNSAYEWVEKL*C 4096
            + HD+SDGGL+ CLLEMAFAGN GI+V       D  A    A + +LF EE G ++EV    ++ V    ES  L    +GH+    E  P     ++VN+  +     +GE R +WE+TS+ L+ LQ    CV +E Q       P+    P F ++    KP       V RVAILREEGSNGDREMA AF  +GFE WD+TMQDL S  I L+ F G+ FVGGFS+ DVLGSAKGWAAA+ +N + +++   F+ R DTFSLGVCNGCQL+  LGW+    S +  E  +D       ++L HN S RFESR++ V + +   ++ML  + G+ L VW AHGEG+                                 F++ E  ++  + GL+ L++ + D    +   YP NPNGS   +AG+CS+DGRHLA+MPHPER+   WQWA+          SPW+ +F +A  W ++  C
Sbjct:   10 SGHDVSDGGLVTCLLEMAFAGNCGIEV-------DVPAPGIHA-LPVLFAEEPGLVLEVQEADVAGVRQRYESAGLRCLELGHTG---EAGPQAMARISVNKAVVVEE-PVGELRALWEETSFQLDLLQAEPRCVIEEKQGLKERTGPSYYLPPTFPVASVPCKP----GGPVPRVAILREEGSNGDREMADAFHLAGFEVWDVTMQDLCSGAIRLDTFRGVAFVGGFSYADVLGSAKGWAAAVTFNPQAREELGRFRRRPDTFSLGVCNGCQLLALLGWVGSDPSEEQAEPGQDSQPTQPGLLLRHNLSGRFESRWATVRV-EPGPALMLRGMEGSVLPVWSAHGEGQAGKAGEGLQAGAGAGPEGTWPSLSSPSLPGYMAFSSPELQAKIEAKGLVPLHWADDDGNPTE--QYPLNPNGSPGGIAGICSQDGRHLALMPHPERAVRLWQWAWRPSPFDVLPTSPWLQLFINARNWTQEDSC 473          
BLAST of Phosphoribosylformylglycinamidine synthase vs. Ensembl Mouse
Match: Pfas (phosphoribosylformylglycinamidine synthase (FGAR amidotransferase) [Source:MGI Symbol;Acc:MGI:2684864])

HSP 1 Score: 108.227 bits (269), Expect = 4.372e-27
Identity = 55/82 (67.07%), Postives = 64/82 (78.05%), Query Frame = 2
Query: 1481 AASSVEIQGDSSRDKELDLGAVQRGDAQMENKMNRVIRGCIDLRDLNPIKSIHDQGAGGNGNVLKELVDPLGAIIDASNFTL 1726
            AASSV++QGD++ D  LD GAVQRGD +ME KMNRVIR C++    NPI S+HDQGAGGNGNVLKEL DP GAII  S F +
Sbjct:   20 AASSVQVQGDNTSD--LDFGAVQRGDPEMEQKMNRVIRACVEAPGGNPICSLHDQGAGGNGNVLKELSDPEGAIIYTSRFQI 99          
BLAST of Phosphoribosylformylglycinamidine synthase vs. UniProt/SwissProt
Match: sp|Q5SUR0|PUR4_MOUSE (Phosphoribosylformylglycinamidine synthase OS=Mus musculus OX=10090 GN=Pfas PE=1 SV=1)

HSP 1 Score: 1198.73 bits (3100), Expect = 0.000e+0
Identity = 673/1362 (49.41%), Postives = 868/1362 (63.73%), Query Frame = 2
Query:  104 VLHFYQIVS-----FSNKLKRNLVDNNLLDGTIIATSEICYNIEIKGXXXXXXXXXXXXXXITRSDNINDISSKPINFQLKKYNMSIEIGPRLNFCTPLSTNAVCILKSLGFNMISRFEISHIYHFSSENDNLLSKRNDIIKNIHDKMTEMAYPHQINSFNLNVAPSPV-FTIDIMNEGIKALEEINKSMGLAMDEWDLLYYHDIFVNIMHRNPSNVECFDLAQSNSEHSRHWFFKGQMIIDGVEMEQSLFDILTETQKYSNQNNVIAFSDNSSAIKGFTTPILYINDPAYPSVYEIKDSFQNVCFTAETHNXXXXXXXXXXXXXXXXXRIRDIQAVGMGGYVVAGTAGYCFGNLRLPYYTLPWETDPCFKYPSNFAQASKIVIEASNGASDYGNEFGEPVINGFCRSFGMITHSGEWKEWIKPIMFSGGIGQLSSLHVNKSSPNVNQLVIKXXXXXXXXXXXXXAASSVEIQGDSSRDKELDLGAVQRGDAQMENKMNRVIRGCIDLRDLNPIKSIHDQGAGGNGNVLKELVDPLGAIIDASNFTLGDPTINLLELWGAEYQESNGLLIDERHLDQFKKICDRERCPINVVGKVTGDGNIRLINSVAL--------EEELDPSMPYIVDLDLSVVLGKMPKKKFYLKHVEKILSPLKLPLNLQVEDALSRVLRLPSVGSKRFLTNKVDRSVSGLVAQQQCVGPLHTPLADVAIVALSYFDIVGAATAIGEQPIKMLINVKEGAKLCVIEALTNLCMIPVTSFEDIKVSGNWMWPAKLPGEGAALWDACNAFCSLLKDLKIAIDGGKDSLSMAATVNDNTVVKSPGSLVVSAYVCCPDIRLAVTPDLK---GDGSLIWIRMN-SQYRLGGSALAQVYCQLGDKCPEFDNVGLFKKSWNCLQKIFMEKLASAAHDISDGGLIGCLLEMAFAGNVGIDVIINASIADCDASNSSAEISILFNEETGWIIEVPNNYLSTVINDLESNELLFSLIGHSCKRYEVTPT--VTLTVNELNIFSNFKLGEFRTMWEDTSYHLEKLQCNTECVNKEYQFYG---NPNITSNP-FVISDSWLKPYNKINSKVFRVAILREEGSNGDREMAAAFIKSGFETWDITMQDLLSDLITLEEFNGLIFVGGFSFGDVLGSAKGWAAAIKYNEKIKKKFQNFKIREDTFSLGVCNGCQLMTWLGWLNDSHSLDNCEMKRD-------IILSHNDSNRFESRFSVVSIPQNTKSIMLSRLLGARLGVWVAHGEGKFEFTNQEFCSQALSDGLIALNYVNLDATNDDVVNYPFNPNGSISNVAGLCSKDGRHLAIMPHPERSFMWWQWAYTGDLDVSTEVSPWMCIFNSAYEWVEKL*C 4096
            VLHFY   S      S ++ R L +   L       +E+CYN+    + L   +  + L  +     + D  ++         ++ +E+GPRLNF TP STN V + ++ G   + R E +  Y  S  +          +  +HD+MTE  YP  I SF+    P+P+  +IDI+ EG  ALE+ N+ +GLA+D WDL +Y   F   + RNPS VE FDLAQSNSEHSRHWFFKGQ+ +DG ++  SLF+ +  TQ  SN NNV+ F DNSSAI+G     L   D   PS ++ +   ++V FTAETHNFPTGVAPF GA TGTGGRIRD+Q  G G +VVAGTAGYCFGNL +P Y LPWE DP F+YP NFA+  ++ IEASNGASDYGN+FGEPV+ GF RS G+    G+ +EWIKPIMFSGGIG + + HV K  P     V+K+GGPVYRIGVGGGAASSV++QGD++ D  LD GAVQRGD +ME KMNRVIR C++    NPI S+HDQGAGGNGNVLKEL DP GAII  S F LGDPT+N LE+WGAEYQESN LL+     D   +   RERCP   VG +TGD  I L++            +  L P  P  VDLDL  VLGKMP+K+F+L+    +L PL LP  L V  AL+RVLRLP+V SKR+LTNKVDRSV GLVAQQQCVGPL TPLADVA+VALS+ + +GAATA+GEQP+K L++ K  A+L V EALTNL    VT   D+K SGNWMW AKLPGEGAAL DAC A  +++  L +A+DGGKDSLSMAA V   T V++PGSLV+SAY  CPDI   VTPDLK   G G L+++ ++  Q+RLGG+ALAQ + QLG+  P+ D      ++++  Q +  E    + HD+SDGGL+ CLLEMAFAGN GI+V       D  A    A + +LF EE G ++EV    ++ V    ES  L    +GH+    E  P     ++VN+  +     +GE R +WE+TS+ L+ LQ    CV +E Q       P+    P F ++    KP       V RVAILREEGSNGDREMA AF  +GFE WD+TMQDL S  I L+ F G+ FVGGFS+ DVLGSAKGWAAA+ +N + +++   F+ R DTFSLGVCNGCQL+  LGW+    S +  E  +D       ++L HN S RFESR++ V + +   ++ML  + G+ L VW AHGEG   F++ E  ++  + GL+ L++ + D    +   YP NPNGS   +AG+CS+DGRHLA+MPHPER+   WQWA+          SPW+ +F +A  W ++  C
Sbjct:    4 VLHFYVRPSGHEGAASGRVFRRLQEK--LPTLQSVETELCYNVHWAAETLPWAEEMKKLMWLFGCPLVRDDVAQEPWLVPGSNDLLLEVGPRLNFSTPASTNIVSVCQAAGLRAVDRVETTRRYRLSFTDHPTAEMEAISLAALHDRMTEQHYPDPIQSFSPQSIPAPLKGSIDILAEGRPALEKANQELGLALDSWDLDFYTKRFQE-LQRNPSTVEVFDLAQSNSEHSRHWFFKGQLHVDGKKLAHSLFESIMSTQASSNPNNVLKFCDNSSAIQGKKVKFLRPEDSTRPSCFQQQQGLRHVVFTAETHNFPTGVAPFSGATTGTGGRIRDVQCTGRGAHVVAGTAGYCFGNLHIPDYNLPWE-DPSFQYPGNFARPLEVAIEASNGASDYGNKFGEPVLAGFARSLGLQLPDGQRREWIKPIMFSGGIGSMEAKHVGKKPPEPGMEVVKVGGPVYRIGVGGGAASSVQVQGDNTSD--LDFGAVQRGDPEMEQKMNRVIRACVEAPGGNPICSLHDQGAGGNGNVLKELSDPEGAIIYTSRFQLGDPTLNALEIWGAEYQESNALLLRPSDRDFLSRASARERCPACFVGTITGDKRIVLVDDRECLVGKTGQGDAPLTPPTP--VDLDLDWVLGKMPQKEFFLQRKPPVLQPLALPPELSVRQALNRVLRLPAVASKRYLTNKVDRSVGGLVAQQQCVGPLQTPLADVAVVALSHQECIGAATALGEQPVKSLLDPKAAARLAVSEALTNLVFALVTDLRDVKCSGNWMWAAKLPGEGAALADACEAMVAVMAALGVAVDGGKDSLSMAARVGTET-VQAPGSLVISAYAVCPDITATVTPDLKHPGGKGHLLYVPLSPGQHRLGGTALAQCFSQLGEHPPDLDLPENLVRAFHITQGLLKECRLCSGHDVSDGGLVTCLLEMAFAGNCGIEV-------DVPAPGIHA-LPVLFAEEPGLVLEVQEADVAGVRQRYESAGLRCLELGHTG---EAGPQAMARISVNKAVVVEE-PVGELRALWEETSFQLDLLQAEPRCVIEEKQGLKERTGPSYYLPPTFPVASVPCKP----GGPVPRVAILREEGSNGDREMADAFHLAGFEVWDVTMQDLCSGAIRLDTFRGVAFVGGFSYADVLGSAKGWAAAVTFNPQAREELGRFRRRPDTFSLGVCNGCQLLALLGWVGSDPSEEQAEPGQDSQPTQPGLLLRHNLSGRFESRWATVRV-EPGPALMLRGMEGSVLPVWSAHGEGYMAFSSPELQAKIEAKGLVPLHWADDDGNPTE--QYPLNPNGSPGGIAGICSQDGRHLALMPHPERAVRLWQWAWRPSPFDVLPTSPWLQLFINARNWTQEDSC 1337          
BLAST of Phosphoribosylformylglycinamidine synthase vs. UniProt/SwissProt
Match: sp|O15067|PUR4_HUMAN (Phosphoribosylformylglycinamidine synthase OS=Homo sapiens OX=9606 GN=PFAS PE=1 SV=4)

HSP 1 Score: 1187.56 bits (3071), Expect = 0.000e+0
Identity = 645/1271 (50.75%), Postives = 835/1271 (65.70%), Query Frame = 2
Query:  338 NMSIEIGPRLNFCTPLSTNAVCILKSLGFNMISRFEISHIYHFSSENDNLLSKRNDIIKNIHDKMTEMAYPHQINSFNLNVAPSPV-FTIDIMNEGIKALEEINKSMGLAMDEWDLLYYHDIFVNIMHRNPSNVECFDLAQSNSEHSRHWFFKGQMIIDGVEMEQSLFDILTETQKYSNQNNVIAFSDNSSAIKGFTTPILYINDPAYPSVYEIKDSFQNVCFTAETHNXXXXXXXXXXXXXXXXXRIRDIQAVGMGGYVVAGTAGYCFGNLRLPYYTLPWETDPCFKYPSNFAQASKIVIEASNGASDYGNEFGEPVINGFCRSFGMITHSGEWKEWIKPIMFSGGIGQLSSLHVNKSSPNVNQLVIKXXXXXXXXXXXXXAASSVEIQGDSSRDKELDLGAVQRGDAQMENKMNRVIRGCIDLRDLNPIKSIHDQGAGGNGNVLKELVDPLGAIIDASNFTLGDPTINLLELWGAEYQESNGLLIDERHLDQFKKICDRERCPINVVGKVTGDGNIRLINSVAL------EEELDPS-MPYIVDLDLSVVLGKMPKKKFYLKHVEKILSPLKLPLNLQVEDALSRVLRLPSVGSKRFLTNKVDRSVSGLVAQQQCVGPLHTPLADVAIVALSYFDIVGAATAIGEQPIKMLINVKEGAKLCVIEALTNLCMIPVTSFEDIKVSGNWMWPAKLPGEGAALWDACNAFCSLLKDLKIAIDGGKDSLSMAATVNDNTVVKSPGSLVVSAYVCCPDIRLAVTPDLK---GDGSLIWIRMN-SQYRLGGSALAQVYCQLGDKCPEFDNVGLFKKSWNCLQKIFMEKLASAAHDISDGGLIGCLLEMAFAGNVGIDVIINASIADCDASNSSAEISILFNEETGWIIEVPNNYLSTVINDLESNELLFSLIGHSCKRYEVTP--TVTLTVNELNIFSNFKLGEFRTMWEDTSYHLEKLQCNTECVNKEYQFYGNPNITSNPFVISDSWLKPY--NKINSKVFRVAILREEGSNGDREMAAAFIKSGFETWDITMQDLLSDLITLEEFNGLIFVGGFSFGDVLGSAKGWAAAIKYNEKIKKKFQNFKIREDTFSLGVCNGCQLMTWLGWLNDSHSLDNCEMKRD-------IILSHNDSNRFESRFSVVSIPQNTKSIMLSRLLGARLGVWVAHGEGKFEFTNQEFCSQALSDGLIALNYVNLDATNDDVVNYPFNPNGSISNVAGLCSKDGRHLAIMPHPERSFMWWQWAYTGDLDVSTEVSPWMCIFNSAYEWV 4081
            ++ +E+GPRLNF TP STN V + ++ G   + R E +  Y  S  +          +  +HD+MTE  +PH I SF+    P P+   I+I+ EG  ALE+ N+ +GLA+D WDL +Y   F   + RNPS VE FDLAQSNSEHSRHWFFKGQ+ +DG ++  SLF+ +  TQ+ SN NNV+ F DNSSAI+G     L   DP  PS ++ +   ++V FTAETHNFPTGV PF GA TGTGGRIRD+Q  G G +VVAGTAGYCFGNL +P Y LPWE DP F+YP NFA+  ++ IEASNGASDYGN+FGEPV+ GF RS G+    G+ +EWIKPIMFSGGIG + + H++K +P     V+K+GGPVYRIGVGGGAASSV++QGD++ D  LD GAVQRGD +ME KMNRVIR C++    NPI S+HDQGAGGNGNVLKEL DP GAII  S F LGDPT+N LE+WGAEYQESN LL+   + D    +  RERCP   VG +TGD  I L++          + +  P+ +P  VDL+L  VLGKMP+K+F+L+    +L PL LP  L V  AL RVLRLP+V SKR+LTNKVDRSV GLVAQQQCVGPL TPLADVA+VALS+ +++GAATA+GEQP+K L++ K  A+L V EALTNL    VT   D+K SGNWMW AKLPGEGAAL DAC A  +++  L +A+DGGKDSLSMAA V   T V++PGSLV+SAY  CPDI   VTPDLK   G G L+++ ++  Q+RLGG+ALAQ + QLG+  P+ D      ++++  Q +  ++L  + HD+SDGGL+ CLLEMAFAGN G+ V +               +S+LF EE G ++EV    L+ V+       L    +GH+    E  P   V ++VN   +     +GE R +WE+TS+ L++LQ    CV +E +  G        + +  ++ K     +      RVAILREEGSNGDREMA AF  +GFE WD+TMQDL S  I L+ F G+ FVGGFS+ DVLGSAKGWAAA+ ++ +   + + F+ R DTFSLGVCNGCQL+  LGW+    + D  EM  D       ++L HN S R+ESR++ V +     ++ML  + GA L VW AHGEG   F++ E  +Q  + GL  L++ + D    +   YP NPNGS   VAG+CS DGRHLA+MPHPER+   WQWA+      +   SPW+ +F +A  W 
Sbjct:   85 DLLLEVGPRLNFSTPTSTNIVSVCRATGLGPVDRVETTRRYRLSFAHPPSAEVEAIALATLHDRMTEQHFPHPIQSFSPESMPEPLNGPINILGEGRLALEKANQELGLALDSWDLDFYTKRFQE-LQRNPSTVEAFDLAQSNSEHSRHWFFKGQLHVDGQKLVHSLFESIMSTQESSNPNNVLKFCDNSSAIQGKEVRFLRPEDPTRPSRFQQQQGLRHVVFTAETHNFPTGVCPFSGATTGTGGRIRDVQCTGRGAHVVAGTAGYCFGNLHIPGYNLPWE-DPSFQYPGNFARPLEVAIEASNGASDYGNKFGEPVLAGFARSLGLQLPDGQRREWIKPIMFSGGIGSMEADHISKEAPEPGMEVVKVGGPVYRIGVGGGAASSVQVQGDNTSD--LDFGAVQRGDPEMEQKMNRVIRACVEAPKGNPICSLHDQGAGGNGNVLKELSDPAGAIIYTSRFQLGDPTLNALEIWGAEYQESNALLLRSPNRDFLTHVSARERCPACFVGTITGDRRIVLVDDRECPVRRNGQGDAPPTPLPTPVDLELEWVLGKMPRKEFFLQRKPPMLQPLALPPGLSVHQALERVLRLPAVASKRYLTNKVDRSVGGLVAQQQCVGPLQTPLADVAVVALSHEELIGAATALGEQPVKSLLDPKVAARLAVAEALTNLVFALVTDLRDVKCSGNWMWAAKLPGEGAALADACEAMVAVMAALGVAVDGGKDSLSMAARVGTET-VRAPGSLVISAYAVCPDITATVTPDLKHPEGRGHLLYVALSPGQHRLGGTALAQCFSQLGEHPPDLDLPENLVRAFSITQGLLKDRLLCSGHDVSDGGLVTCLLEMAFAGNCGLQVDV--------PVPRVDVLSVLFAEEPGLVLEVQEPDLAQVLKRYRDAGLHCLELGHTG---EAGPHAMVRVSVNGAVVLEE-PVGELRALWEETSFQLDRLQAEPRCVAEEER--GLRERMGPSYCLPPTFPKASVPREPGGPSPRVAILREEGSNGDREMADAFHLAGFEVWDVTMQDLCSGAIGLDTFRGVAFVGGFSYADVLGSAKGWAAAVTFHPRAGAELRRFRKRPDTFSLGVCNGCQLLALLGWVGGDPNEDAAEMGPDSQPARPGLLLRHNLSGRYESRWASVRV-GPGPALMLRGMEGAVLPVWSAHGEGYVAFSSPELQAQIEARGLAPLHWADDDGNPTE--QYPLNPNGSPGGVAGICSCDGRHLAVMPHPERAVRPWQWAWRPPPFDTLTTSPWLQLFINARNWT 1333          
BLAST of Phosphoribosylformylglycinamidine synthase vs. UniProt/SwissProt
Match: sp|P35421|PUR4_DROME (Phosphoribosylformylglycinamidine synthase OS=Drosophila melanogaster OX=7227 GN=Pfas PE=1 SV=2)

HSP 1 Score: 1115.52 bits (2884), Expect = 0.000e+0
Identity = 634/1367 (46.38%), Postives = 844/1367 (61.74%), Query Frame = 2
Query:   98 MEVLHFYQIVSFSNKLKRNLVDN-NLLDGTIIATS-EICYNIEIKGXXXXXXXXXXXXXXITRS--DNINDISSKPINFQLKKYNMSIEIGPRLNFCTPLSTNAVCILKSLGFNMISRFEISHIYHFSSENDNLLSKRNDIIKNIHDKMTEMAYPHQIN---SFNLNVAPSPV--FTIDIMNEGIKALEEINKSMGLAMDEWDLLYYHDIFVNIMHRNPSNVECFDLAQSNSEHSRHWFFKGQMIIDGVEMEQSLFDILTETQKYSNQNNVIAFSDNSSAIKGFTTPILYINDPAYPSVYEIKDSFQNVCFTAETHNXXXXXXXXXXXXXXXXXRIRDIQAVGMGGYVVAGTAGYCFGNLRLPYYTLPWETDPC-FKYPSNFAQASKIVIEASNGASDYGNEFGEPVINGFCRSFGM--ITHSGEWKEWIKPIMFSGGIGQLSSLHVNKSSPNVNQLVIKXXXXXXXXXXXXXAASSVEIQGDSSRDKELDLGAVQRGDAQMENKMNRVIRGCIDLRDLNPIKSIHDQGAGGNGNVLKELVDP--LGAIIDASNFTLGDPTINLLELWGAEYQESNGLLIDERHLDQFKKICDRERCPINVVGKVTGDGNIRLINSVA---LEEELDPSMPYIV---DLDLSVVLGKMPKKKFYLKHVEKILSPLKLPLNLQVEDALSRVLRLPSVGSKRFLTNKVDRSVSGLVAQQQCVGPLHTPLADVAIVALSYFDIVGAATAIGEQPIKMLINVKEGAKLCVIEALTNLCMIPVTSFEDIKVSGNWMWPAKLPGEGAALWDACNAFCSLLKDLKIAIDGGKDSLSMAATVNDNTVVKSPGSLVVSAYVCCPDIRLAVTPDLKGDG-----SLIWIRMNSQYRLGGSALAQVYCQLGDKCPEFDNVGLFKKSWNCLQKIFMEKLASAAHDISDGGLIGCLLEMAFAGNVGIDVIINASIADCDASNSSA------EISILFNEETGWIIEVPNNYLSTVINDLESNELLFSLIGHSCKRYEVTPTVTLTVNELNIFSNFKLGEFRTMWEDTSYHLEKLQCNTECVNKEY---QFYGNPNITSNPFVISDSWLKPYNKINSKVFRVAILREEGSNGDREMAAAFIKSGFETWDITMQDLLSDLITLEEFNGLIFVGGFSFGDVLGSAKGWAAAIKYNEKIKKKFQNFKIREDTFSLGVCNGCQLMTWLGWLNDSHSLDNCEMKRDIILSHNDSNRFESRFSVVSIPQNTKSIMLSRLLGARLGVWVAHGEGKFEFTNQEFCSQALSDGLIALNYVNLDATNDDVVNYPFNPNGSISNVAGLCSKDGRHLAIMPHPERSFMWWQWAYTG---DLDVSTEVSPWMCIFNSAYEWVEK 4087
            M +L +Y + + S   + +++      DG +++   E CY++E          L  LL  + +        +S +P         + +EIGPR NF TP STN V I ++LG++ + R E S  Y  +    +   +    +  + D+MT+  Y  +     SF+  +         + ++ EG  ALE IN+ +GLA +++DL YYHD+F   + RNP+ VE FD AQSNSEHSRHWFF+G+M+IDGVE  +SL  ++ +TQ ++N NN I FSDNSSA+ GF    +  +    P    ++    ++ FTAETHN PT VAPF GA TGTGGR+RD+Q VG GG  +AGTAGYC G L +P Y  P+E  P  FKYP+ FA   +++IEASNGASDYGN+FGEPVI+GF  S+G+     + +  E++KPIMFSGG+G + +    K  P   QL+ KIGGPVYRIGVGGGAASSVEIQG  S D ELD  AVQRGDA+MENK+NRV+R C+DL + NPI +IHDQGAGGNGNVLKELV+P   GA+I +  F LGDPTI  LELWGAEYQE+N +L +    +  +KIC RERCPI+ VG VTGDG + L+   A   LE+ L+ S    V   DL+L  VLG MPK+ + LK  +  L  L LP  L +++AL RVL L +VGSKRFLTNKVDR V GL+AQQQCVGPL  PLAD A+  +S+F   G AT+IG QP+K L++    A++CV EAL+NL  + ++   D+K SGNWMW AKLPGEGA ++DAC   C +L++L IAIDGGKDSLSMAA V   T +KSPG+LV+S Y  CPD+RL VTPDLKG G     SL+WI + +  RLGGSALAQ Y Q G   P      +  K++   Q +  + L  A HD+SDGGL+ C+LEMA  G  G+ V ++  +A     + S       E+++LF EE GW++EV +  L  V +  E   +    +G + + + +   V L   +  +     L      WE TSY LEKLQ N EC   EY   ++   P       V ++  L    K +S   RVA+LREEG N +REM A  +++ FE  D+TM DLL    ++ ++ GLIF GGFS+ D LGSAKGWAA I +N ++  +F+ FK R+D FSLG+CNGCQLMT +G++  + S        D+ L HN S RFE R++ V IP N +SIML  +    LG WVAHGEG+F F +++  S   S+ L+ L YV  D        YP NPNGS   +AGLCS DGRHLA+MPHPER    +QW Y     ++  +   SPW  +FN+AY W  K
Sbjct:    1 MVILRYYDVQAHSAAEEESVLRRLREEDGAVVSVRMERCYHLEYSAQAEHSLALDELLVWLVKQPLSKGQSLSRQPALQSTGSSQLLLEIGPRFNFSTPYSTNCVNIFQNLGYSEVRRMETSTRYLVTFGEGSKAPEAARFVPLLGDRMTQCLYTEENTPKASFDEQLPERQANWHFVPVLEEGRAALERINQELGLAFNDYDLDYYHDLFAKELGRNPTTVELFDCAQSNSEHSRHWFFRGRMVIDGVEQPKSLIRMIMDTQAHTNPNNTIKFSDNSSAMVGFDHQTIVPSSVVAPGAVRLQSVQSDLIFTAETHNMPTAVAPFSGATTGTGGRLRDVQGVGRGGVPIAGTAGYCVGALHIPGYKQPYE--PLDFKYPATFAPPLQVLIEASNGASDYGNKFGEPVISGFALSYGLNSAADASQRDEYVKPIMFSGGLGTMPATMREKLPPARGQLLAKIGGPVYRIGVGGGAASSVEIQG--SGDAELDFNAVQRGDAEMENKLNRVVRACLDLGEQNPILAIHDQGAGGNGNVLKELVEPGFAGAVIFSKEFQLGDPTITALELWGAEYQENNAILCNADQRELLEKICRRERCPISFVGVVTGDGRVTLLEKPAPKDLEQALNASNRSEVSPFDLELKYVLGDMPKRTYDLKREQTPLKELSLPKGLLLDEALERVLSLVAVGSKRFLTNKVDRCVGGLIAQQQCVGPLQAPLADYALTTVSHFSHSGIATSIGTQPLKGLLDPAAMARMCVAEALSNLVFVKISELADVKCSGNWMWAAKLPGEGARMFDACKELCQILEELHIAIDGGKDSLSMAAKVGGET-IKSPGTLVISTYAPCPDVRLKVTPDLKGPGAGSKTSLLWINLENSARLGGSALAQAYAQQGKDTPNLTRSDVLGKAFAVTQSLLGDGLIQAGHDVSDGGLLVCVLEMAIGGLSGLRVDLSEPLAKLKNFDKSVEKLNRPELAVLFAEECGWVVEVLDTDLERVRSTYEKAGVPNYYLGVT-EGFGLDSRVVLKNGKSELLDQ-PLRVLYKKWERTSYELEKLQANPECAEAEYNSLEYRQAPQYRGPQNVQAELTL----KRSSAPVRVAVLREEGVNSEREMMACLLRANFEVHDVTMSDLLQGTASVSQYRGLIFPGGFSYADTLGSAKGWAANILHNPRLLPQFEAFKRRQDVFSLGICNGCQLMTLIGFVGSAKS--EVGADPDVALLHNKSQRFECRWATVKIPSN-RSIMLGSMKDLVLGCWVAHGEGRFAFRDEKLISHLQSEQLVTLQYV--DDVGKPTELYPLNPNGSPQGIAGLCSSDGRHLALMPHPERCSSMYQWPYVPSSFEVSPTQSESPWQIMFNNAYNWCVK 1351          
BLAST of Phosphoribosylformylglycinamidine synthase vs. UniProt/SwissProt
Match: sp|Q9M8D3|PUR4_ARATH (Probable phosphoribosylformylglycinamidine synthase, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At1g74260 PE=2 SV=3)

HSP 1 Score: 1109.75 bits (2869), Expect = 0.000e+0
Identity = 640/1356 (47.20%), Postives = 848/1356 (62.54%), Query Frame = 2
Query:  101 EVLHFYQIVSFSNKLKRNL---VDNNLLDGTIIATSEICYNI--EIKGXXXXXXXXXXXXXXITRSDNINDISSKPINFQLKKYNMSIEIGPRLNFCTPLSTNAVCILKSLGFNMISRFEISHIYHFSSENDNLLSKRNDIIKNIHDKMTEMAYPHQINSFNLNVAPSPVFTIDIMNEGIKALEEINKSMGLAMDEWDLLYYHDIFVNIMHRNPSNVECFDLAQSNSEHSRHWFFKGQMIIDGVEMEQSLFDILTETQKYSNQNNVIAFSDNSSAIKGFTTPILYINDPAYPSVYEIKDSFQNVCFTAETHNXXXXXXXXXXXXXXXXXRIRDIQAVGMGGYVVAGTAGYCFGNLRLPYYTLPWETDPCFKYPSNFAQASKIVIEASNGASDYGNEFGEPVINGFCRSFGMITHSGEWKEWIKPIMFSGGIGQLSSLHVNKSSPNVNQLVIKXXXXXXXXXXXXXAASSVEIQGDSSRDKELDLGAVQRGDAQMENKMNRVIRGCIDLRDLNPIKSIHDQGAGGNGNVLKELVDPLGAIIDASNFTLGDPTINLLELWGAEYQESNGLLIDERHLDQFKKICDRERCPINVVGKVTGDGNIRLINSVAL---EEELDPSMPYIVDLDLSVVLGKMPKKKFYLKHVEKILSPLKLPLNLQVEDALSRVLRLPSVGSKRFLTNKVDRSVSGLVAQQQCVGPLHTPLADVAIVALSYFDIVGAATAIGEQPIKMLINVKEGAKLCVIEALTNLCMIPVTSFEDIKVSGNWMWPAKLPGEGAALWDACNAFCSLLKDLKIAIDGGKDSLSMAATVNDNTVVKSPGSLVVSAYVCCPDIRLAVTPDLK---GDGSLIWIRM-NSQYRLGGSALAQVYCQLGDKCPEFDNVGLFKKSWNCLQKIFMEKLASAAHDISDGGLIGCLLEMAFAGNVGIDVIINASIADCDASNSSAEISILFNEETGWIIEVPNNYLSTVINDLESNELLFSLIGHSCKRYEVTPTVTLTVNELNIFSNFKLGEFRTMWEDTSYHLEKLQCNTECVNKE---YQFYGNPN--------ITSNPFVISDSWLKPYNKINSKVFRVAILREEGSNGDREMAAAFIKSGFETWDITMQDLLSDLITLEEFNGLIFVGGFSFGDVLGSAKGWAAAIKYNEKIKKKFQNFKIREDTFSLGVCNGCQLMTWLGWLNDSH---SLDNCEMKRDIILSHNDSNRFESRFSVVSIPQNTKSIMLSRLLGARLGVWVAHGEGKFEFTNQEFCSQALSDGLIALNYVNLDATNDDVVNYPFNPNGSISNVAGLCSKDGRHLAIMPHPERSFMWWQWA-YTGDLDVSTE-VSPWMCIFNSAYEWVE 4084
            EV+HFY++          L   V   + +  +  T+E  +NI  E K  +     L+ +L      +N+   S      Q   + + +E+GPRL+F T  STNAV I ++ G + ++R E S  Y   S+   L ++  +    +HD+MTE  Y  ++ SF  NV P  V  + +M +G KALEEIN+ MGLA DE DL YY  +F   + R+P+NVE FD+AQSNSEHSRHWFF G M+IDG  M++SL  I+  T + +  N+VI F DNSSAI+GF    L    P    + ++     ++ FTAETHNFP  VAP+PGA TG GGRIRD  A G G +VVA T+GYC GNL +     PWE D  F+YPSN A   +I+I+ASNGASDYGN+FGEP+I G+ R+FGM   SG+ +EW+KPIMFS GIGQ+   H+ K  P V  LV+KIGGP YRIG+GGGAASS+ + G +  D ELD  AVQRGDA+M  K+ RV+R CI++ + NPI SIHDQGAGGN NV+KE++ P GA ID     +GD T+++LE+WGAEYQE + +L+     +  + IC RER  + V+G + G G   LI+S A     +E  P  P  VDL+L  VLG MPKK F    +     PL +   + + DAL RVLRLPSV SKRFLT KVDR V+GLVAQQQ VGPL   LADVA++A ++ D+ G A AIGEQPIK L++ K  A+L V EALTNL    VT+  D+K SGNWM+ AKL GEG+A++DA  A    + +L IAIDGGKDSLSMAA   D  VVK+PG+LV+SAYV CPDI   VTPDLK    DG L+ + +   + RLGGSALAQV+ Q+G+ CP+ D+V   K  ++ +Q +  E L SA HDISDGGL+   LEMAFAGN GI++ +        ASN  +    LF+EE G ++E+    L  V+  L + ++   +IG+       +P + + V+ +   S  K    R MWEDTS+ LEKLQ    CV  E    +F   PN         T+N ++  D  +KP         +VA++REEGSNGDREM+AAF  +GFE WD+T+ DLL+  ITL++F G++FVGGFS+ DVL SAKGWAA+I++NE +  +FQ F  R DTFSLG+CNGCQLM  LGW+       SLD  + +      HN+S RFE RF+ V+I +++ SIML  + G+ LGVW AHGEG+  F ++      L   L  L Y + D    +   YPFN NGS   +A +CS DGRHLA+MPHPER F+ WQ+  Y    DV     SPW+ +F +A +W+E
Sbjct:   86 EVIHFYRVPLIQESANAELLKAVQTKISNQIVSLTTEQSFNIGLESKLKDEKLSVLKWILQETYEPENLGTDSFLERKKQEGLHAVIVEVGPRLSFTTAWSTNAVSICRACGLDEVTRLERSRRYLLFSKEPLLENQIKEFAAMVHDRMTECVYTQKLVSFETNVVPEEVKYVPVMEKGRKALEEINQEMGLAFDEQDLQYYTRLFREDIKRDPTNVELFDIAQSNSEHSRHWFFAGNMVIDGKPMDKSLMQIVKSTWEANRNNSVIGFKDNSSAIRGFLVNQLRPLLPGSVCLLDVSARDLDILFTAETHNFPCAVAPYPGAETGAGGRIRDTHATGRGSFVVASTSGYCVGNLNMEGSYAPWE-DSSFQYPSNLASPLQILIDASNGASDYGNKFGEPMIQGYTRTFGMRLPSGDRREWLKPIMFSAGIGQIDHTHITKGEPEVGMLVVKIGGPAYRIGMGGGAASSM-VSGQN--DAELDFNAVQRGDAEMSQKLYRVVRACIEMGEKNPIISIHDQGAGGNCNVVKEIIYPQGAEIDIRAVVVGDHTMSVLEIWGAEYQEQDAILVKAESREILQSICKRERLSMAVIGTINGGGRCTLIDSTAAAKCSKEGLPPPPPAVDLELEKVLGDMPKKTFKFNRIAYAREPLDIAPGITLMDALKRVLRLPSVSSKRFLTTKVDRCVTGLVAQQQTVGPLQITLADVAVIAQTFTDLTGGACAIGEQPIKGLLDPKAMARLAVGEALTNLVWAKVTALSDVKASGNWMYAAKLEGEGSAMYDAAIALSEAMIELGIAIDGGKDSLSMAAHA-DGEVVKAPGNLVISAYVTCPDITKTVTPDLKLGGDDGILLHVDLAKGKRRLGGSALAQVFGQIGNDCPDLDDVPYLKNVFDGVQALIAENLVSAGHDISDGGLVVTALEMAFAGNKGINLDL--------ASNGISLFETLFSEELGLVLEISKTNLDAVMEKLRAFDVTAEIIGNVTD----SPLIEVKVDGITHLSE-KTSFLRDMWEDTSFQLEKLQRLASCVEMEKEGLKFRHEPNWKLSFIPSSTNNNYMSQD--VKP---------KVAVIREEGSNGDREMSAAFYAAGFEPWDVTVSDLLAGDITLDQFRGIVFVGGFSYADVLDSAKGWAASIRFNEPVLSQFQEFYKRPDTFSLGICNGCQLMALLGWVPGPQVGGSLDTSQPR----FVHNESGRFECRFTSVTI-KDSPSIMLKGMEGSTLGVWAAHGEGRAYFPDEGVLDHMLHSDLAPLRYCDDDGNVTEA--YPFNLNGSPLGIAAICSPDGRHLAMMPHPERCFLMWQFPWYPTSWDVEKAGPSPWLKMFQNARDWLE 1405          
BLAST of Phosphoribosylformylglycinamidine synthase vs. UniProt/SwissProt
Match: sp|Q54JC8|PUR4_DICDI (Phosphoribosylformylglycinamidine synthase OS=Dictyostelium discoideum OX=44689 GN=purL PE=1 SV=1)

HSP 1 Score: 1055.05 bits (2727), Expect = 0.000e+0
Identity = 623/1293 (48.18%), Postives = 810/1293 (62.65%), Query Frame = 2
Query:  353 IGPRLNFCTPLSTNAVCILKSLGFNMISRFEISHIYHFSSENDNLLSKRNDIIKNIHDKMTEMAYPHQINSFNLNVAPSPVFTIDIMNEGIKALEEINKSMGLAMDEWDLLYYHDIFVNIMHRNPSNVECFDLAQSNSEHSRHWFFKGQMIIDGVEMEQSLFDILTETQKYSNQNNVIAFSDNSSAIKGFTTPILYINDPAYPSVYEIKDSFQNVCFTAETHNXXXXXXXXXXXXXXXXXRIRDIQAVGMGGYVVAGTAGYCFGNLRLPYYTLPWETDPCFKYPSNFAQASKIVIEASNGASDYGNEFGEPVINGFCRSFGMITHSGEWKEWIKPIMFSGGIGQLSSLHVNKSSPNVNQLVIKXXXXXXXXXXXXXAASSVEIQGDSSRDKELDLGAVQRGDAQMENKMNRVIRGCIDLR---DLNPIKSIHDQGAGGNGNVLKELVDPLGAIIDASNFTLGDPTINLLELWGAEYQESNGLLIDERHLDQFKKICDRERCPINVVGKVTGDGNIRLINSVALEEELDPSMPYIVDLDLSVVLGKMPKKKFYLKHVEKILSPLKLPLNLQVED-------ALSRVLRLPSVGSKRFLTNKVDRSVSGLVAQQQCVGPLHTPLADVAIVALSYFDIVGAATAIGEQPIKMLINVKEGAKLCVIEALTNLCMIPVTSFEDIKVSGNWMWPAKLPGEGAALWDACNAFCSLLKDLKIAIDGGKDSLSMAATV----NDNTVVKSPGSLVVSAYVCCPDIRLAVTPDL----KGDGSLIWIRMN-SQYRLGGSALAQVYCQLGDKCPEFDNVGLFKKSWNCLQKIFMEKLASAAHDISDGGLIGCLLEMAFAGNVGIDVIINASIADCDASNSS--AEISILFNEETGWIIEVPNNYLSTVINDLESNELLFSLIGHSCKRYEVTPTVTLTVNELNIFS-------NFKLGEFRTMWEDTSYHLEKLQCNTECVNKEYQFY----------GNPNITSNPFVISDSWLKPYNKINSKVFRVAILREEGSNGDREMAAAFIKSGFETWDITMQDLLSDLITLEE-FNGLIFVGGFSFGDVLGSAKGWAAAIKYNEKIKKKFQNFKIREDTFSLGVCNGCQLMTWLGWLNDSHSLDNCEMKRDIILSHNDSNRFESRFSVVSIPQNTKSIMLSRLLGARLGVWVAHGEGKFEFTNQEFCSQALSDGLIALNYVNLDATNDDVVNYPFNPNGSISNVAGLCSKDGRHLAIMPHPERSFMWWQWAY--------TGDLDVSTEVSPWMCIFNSAYEWVEKL 4090
            +GPR+NF T  S+NA  I KS   ++I R E S  Y   S +     + +  ++ IHD+MTE  YP  I SF+  + P  V  I ++ EG  ALE +NK MGLA DE DL  Y D+F N + RNPS+VECFD+ QSNSEHSRHWFF G++I+DG   +++LF I+  T K + QN++IAFSDNSS+IKGF T +L        S Y   +  Q + FTAETHNFPTG+APF GA TGTGGR+RD  A G G  VVAGT GYC GNL +P Y LPWE    + YP N A   KI IEASNGASDYGN+FGEPVI GF RS+G    +GE +EWIKPIMFSGGIG +   H+ K  P +  +V+K GGP YRIG+GGG+ASS+ + GD+    ELD  AVQRGDA+M  K+NR++R C++       NPI S+HDQGAGG GNVLKE+VDPLGA I       GDPT++ +E+WGAEYQE++ LLI   H D  KK+ +RER PI  VG VTGDG  +LI         D   P  V+L L  VL KMP K F L HVEK L P  LP  L V D        L+RVLRL SVGSKRFL NKVDR+V+GLVA+QQCVGPLHTP+++VA+++  YF   GAAT+IGEQPIK  I+ K  A L V EALTNL    +T   D+K SGNWMW AKL GEG  L+DA      ++ +L IAIDGGKDSLSMAA          +VK+PG+LVVS YV C DI L VTPDL    K D  ++++ +  +   +GGSAL QV+ Q+G+  P   N  L K ++  +QK+  ++L SA HD SDGGLI  L+EM+ +GN G+++    ++ D   S+ S  + I +LF+EE G ++E+  +    V++ L+   +   +IG++            +  +L I         N KL +    WE+TSY LE LQ N   V  E +             N N+T     IS    K    + +K  +VA++REEGSNGDREMAAAF  +GF+ +D+TM DLL+  I L+E F G+ FVGGFS+GDV+ SAKGWA +I++N+++ K+F +F  R DTFSLG+CNGCQLM  LGW+     ++     R I   HN S RFESR+  V I   + +++L  + G+ LGVW  HGEG+F   +Q   +   ++ L  + YV+ D   +   +YPFNP+G+    A LCSKDGRHLAIMPHPERSF+ WQW +         G LD   + SPW+ IF +A  + + L
Sbjct:   94 VGPRMNFTTTYSSNATSICKSCNLSIIDRIERSRRYLVKSVSKLSEKQIDQFLELIHDRMTECLYPTPIKSFDTGIIPKAVVYIPVVEEGRAALERVNKEMGLAFDEQDLALYTDLFQNQLKRNPSDVECFDIGQSNSEHSRHWFFNGKLIVDGNMSDKTLFQIVKNTLKANPQNSLIAFSDNSSSIKGFKTKVLIPKSQIEASEYLEGEREQPIIFTAETHNFPTGIAPFEGAETGTGGRLRDTHATGRGSLVVAGTVGYCVGNLNIPGYELPWENKE-YNYPDNMANPLKIEIEASNGASDYGNKFGEPVIIGFTRSYGNTLPNGERREWIKPIMFSGGIGFMDERHLKKEQPEIGMVVVKAGGPAYRIGMGGGSASSM-VGGDNKH--ELDFSAVQRGDAEMGQKLNRIVRSCVESEIHGGCNPIVSVHDQGAGGAGNVLKEIVDPLGAKIYLDRIISGDPTLSAMEIWGAEYQENDALLIKAEHKDYLKKVSERERLPIAFVGDVTGDGIAQLITK-------DGETP--VNLPLDKVLQKMPPKTFVLDHVEKQLKPFTLPKELLVGDHQTCFNECLNRVLRLLSVGSKRFLINKVDRAVTGLVARQQCVGPLHTPVSNVAVISSGYFGKSGAATSIGEQPIKGFISAKSMAYLTVGEALTNLMWASITDLGDVKCSGNWMWAAKLKGEGVELYDAAIEMHDVMVELGIAIDGGKDSLSMAAKAPKSDGSQELVKAPGALVVSTYVPCDDITLTVTPDLKLSSKDDSVILYLDLGCANNFIGGSALTQVFNQVGNDEPHH-NTPLLKNTFMAIQKLVKQQLISAGHDRSDGGLITTLIEMSLSGNRGLEI----NLPDTHNSDQSPLSIIKLLFSEELGAVLEIKKSNQQIVLDILKQFNVPTQVIGNTSCNNNNNNNNNGSDEDLFIVKVGDKLIYNIKLSQLSKQWEETSYQLELLQANPTFVESEMKNLLKRATGKGKGPNYNMTYKISPIS----KELALLANKAPKVAVIREEGSNGDREMAAAFHFAGFQAFDVTMSDLLNGNIQLDERFKGVAFVGGFSYGDVMDSAKGWAGSIRFNQQVSKQFDHFYGRNDTFSLGLCNGCQLMALLGWV-PYRGIEQTHQPRFI---HNASGRFESRWVNVKI-MPSPALLLKGMEGSVLGVWSQHGEGRFWSEDQSIVNDIKANNLSPIRYVDDDG--EITESYPFNPSGTQEGFASLCSKDGRHLAIMPHPERSFLSWQWPFMPENIKQNVGGLD---QPSPWIKIFQNAKSFCDSL 1354          
BLAST of Phosphoribosylformylglycinamidine synthase vs. TrEMBL
Match: A0A3B3WI83 (Phosphoribosylformylglycinamidine synthase OS=Poecilia mexicana OX=48701 PE=3 SV=1)

HSP 1 Score: 1275.38 bits (3299), Expect = 0.000e+0
Identity = 687/1341 (51.23%), Postives = 888/1341 (66.22%), Query Frame = 2
Query:   98 MEVLHFYQIVSFSNKLKRNLVDNNLLDGTIIATSEICYNIEIKGXXXXXXXXXXXXXXITRSDNINDISSKPINFQLKKYNMS----IEIGPRLNFCTPLSTNAVCILKSLGFNMISRFEISHIYHFSSENDN----LLSKRNDIIKNIHDKMTEMAYPHQINSFNLNVAPSPVFTIDIMNEGIKALEEINKSMGLAMDEWDLLYYHDIFVNIMHRNPSNVECFDLAQSNSEHSRHWFFKGQMIIDGVEMEQSLFDILTETQKYSNQNNVIAFSDNSSAIKGFTTPILYINDPAYPSVYEIKDSFQNVCFTAETHNXXXXXXXXXXXXXXXXXRIRDIQAVGMGGYVVAGTAGYCFGNLRLPYYTLPWETD-PCFKYPSNFAQASKIVIEASNGASDYGNEFGEPVINGFCRSFGMITHSGEWKEWIKPIMFSGGIGQLSSLHVNKSSPNVNQLVIKXXXXXXXXXXXXXAASSVEIQGDSSRDKELDLGAVQRGDAQMENKMNRVIRGCIDLRDLNPIKSIHDQGAGGNGNVLKELVDPLGAIIDASNFTLGDPTINLLELWGAEYQESNGLLIDERHLDQFKKICDRERCPINVVGKVTGDGNIRLINSVALEEELDPSMPYIVDLDLSVVLGKMPKKKFYLKHVEKILSPLKLPLNLQVEDALSRVLRLPSVGSKRFLTNKVDRSVSGLVAQQQCVGPLHTPLADVAIVALSYFDIVGAATAIGEQPIKMLINVKEGAKLCVIEALTNLCMIPVTSFEDIKVSGNWMWPAKLPGEGAALWDACNAFCSLLKDLKIAIDGGKDSLSMAATVNDNTVVKSPGSLVVSAYVCCPDIRLAVTPDLK---GDGSLIWIRMN-SQYRLGGSALAQVYCQLGDKCPEFDNVGLFKKSWNCLQKIFMEKLASAAHDISDGGLIGCLLEMAFAGNVGIDVIINASIADCDASNSSAEISILFNEETGWIIEVPNNYLSTVINDLESNELLFSLIGHSCKRYEVTPTVTLTVNELNIFSNFKLGEFRTMWEDTSYHLEKLQCNTECVNKEYQFYGNPNITSNPFVISDSWLKPYNKINSKVFRVAILREEGSNGDREMAAAFIKSGFETWDITMQDLLSDLITLEEFNGLIFVGGFSFGDVLGSAKGWAAAIKYNEKIKKKFQNFKIREDTFSLGVCNGCQLMTWLGWLNDSHSLDNCEMKRDIILSHNDSNRFESRFSVVSIPQNTKSIMLSRLLGARLGVWVAHGEGKFEFTNQEFCSQALSDGLIALNYVNLDATNDDVVNYPFNPNGSISNVAGLCSKDGRHLAIMPHPERSFMWWQWAYTG-DLDVSTEVSPWMCIFNSAYEW 4078
            M VL FY   S    + R L     L   +  T+E+CYN+E+ G E  +     +L  + R      + ++P++ Q +    S    +EIGPRLNF T  STNAV I +S G + ++R E S  +   +EN      L +   ++I+ +HD MTE  Y H I SF +  AP PVF +D++ +G  ALE  N  +GLA D WDL YY  +F  I +RNP++VECFDLAQSNSEHSRHWFF+G+M+IDG E   +LF ++ +TQ++SNQNNVI F DNSS I+G     +Y  DP+  S YE + S ++V FTAETHNFPTGVAPF GA TGTGGRIRD+Q+ G GG+V+AGTAGYCFGNL +P Y+LPWE +   ++YPS+FA   ++ IEAS+GASDYGN+FGEPV++GF RSFGM   +GE +EWIKPIMFSGG+G +   +V K        V+KIGGPVYRIGVGGGAASSV++QGD+  ++  DLGAVQRGDA+ME KMNR +R C++  + NPI SIHDQGAGGNGNVLKEL +P GA+I  S F  GDPT+++LELWGAEYQESN LL+        +++C RE+CP++ VG++TGDG I L++    + +    + + VDL L  VLGKMP+K+F ++ +   L PL LP  L V DAL RVLRLP+V SKR+LTNKVDRSV+GLVAQQQCVGPLHTPLADVA+VALS F + GAATAIGEQP+K L+    GA++ V EALTNL    VT+ +D+K SGNWMW AKLPGEGA LWDAC A C ++  L +AIDGGKDSLSMAA V   T VK+PG+LV+SAY  CPDI   VTPDL+   G G L+W+ ++  ++RLGGSALAQ Y QLGD CP+ D        +   QK+  ++L SA HDISDGGL+ CLLEMAFAGN G DV ++        S+ S  + +LF+EE G ++EV    L  V        L    IG +C  +    TV + V+   + S   L + R +WE TS+ LE+LQ +  CV +E +                S      ++ + + RVA++REEGSNGDREM+ +   +GFE WD+TMQDL S  +TL+ F  ++FVGGFS+ DVLGSAKGWAA + YN K K +F+ F+ REDT SLGVCNGCQL+T LGW+ +     + E    ++L+HN S RFESRF  V I Q++ SI L  + G+ LGVWVAHGEG   F +        S GL  + Y  LD        YP NPNGS   +AGLCS+DGRHLA+MPHPER  + WQW +   DL  +   SPW+ +F +A  W
Sbjct:    1 MAVLRFY---SGEALIGRALQRAAKLFPHLSITTELCYNVELTGCERLDAAQTEVLLWLFRPP----LQAEPLSDQPRLTEGSGDKLVEIGPRLNFSTAWSTNAVSICQSAGLSNVTRVERSRRFLIKAENGRSAGELSTDVKELIECLHDSMTECVYQHPITSFAVETAPQPVFEVDVLGKGCAALETANSELGLAFDSWDLDYYTSMFQRI-NRNPTSVECFDLAQSNSEHSRHWFFRGRMVIDGQEQPATLFSLIMDTQRHSNQNNVIKFCDNSSGIRGGELRCIYPADPSEASPYETRRSVRHVIFTAETHNFPTGVAPFSGATTGTGGRIRDVQSAGRGGHVIAGTAGYCFGNLHIPGYSLPWEQEGEGWEYPSSFAPPLQVAIEASDGASDYGNKFGEPVLSGFARSFGMRLANGERREWIKPIMFSGGLGSIEDNYVKKEEAEAGMEVVKIGGPVYRIGVGGGAASSVQVQGDNCSER--DLGAVQRGDAEMEQKMNRALRACLERSNGNPICSIHDQGAGGNGNVLKELSEPAGAVIYCSKFKKGDPTLSVLELWGAEYQESNALLLRPSDKSYLQRVCQREKCPVDFVGRITGDGKIVLVDDEGSDGDRADGVRHPVDLQLEWVLGKMPQKEFRMERLAPTLLPLSLPAELTVRDALQRVLRLPAVASKRYLTNKVDRSVTGLVAQQQCVGPLHTPLADVAVVALSPFGLQGAATAIGEQPVKGLVCPAAGARMAVGEALTNLLFARVTALKDVKCSGNWMWAAKLPGEGACLWDACKAMCEVMGQLGVAIDGGKDSLSMAARVGTET-VKAPGALVISAYAVCPDITATVTPDLEDPDGKGVLLWVPVSPGRHRLGGSALAQCYSQLGDVCPDLDRPEFLSACFTTTQKLIEDRLLSAGHDISDGGLVSCLLEMAFAGNRGFDVELS--------SDGSGVMELLFSEELGLVLEVSQTDLEAVCQRYRDGGLRCHRIGRTCG-FGPEATVRVRVDGQEVLSE-SLPDLRAVWEATSFQLERLQADELCVKQEEEGLSKRTQPYFKLTFDPSETPSIRQLAAGLPRVAVVREEGSNGDREMSVSLFMAGFEVWDVTMQDLCSGSVTLQPFKAVVFVGGFSYADVLGSAKGWAATVAYNPKAKAEFERFQRREDTLSLGVCNGCQLLTLLGWVGEGEEGADSE----VVLTHNRSGRFESRFVSVGI-QSSPSIWLRGMEGSALGVWVAHGEGLMRFRSPWAQDLITSSGLAPVRY--LDDQGSPTEEYPLNPNGSPQGIAGLCSRDGRHLAMMPHPERCTLGWQWPWAPRDLRPALSPSPWLRMFRNAAAW 1313          
BLAST of Phosphoribosylformylglycinamidine synthase vs. TrEMBL
Match: A0A3B5R4I6 (Phosphoribosylformylglycinamidine synthase OS=Xiphophorus maculatus OX=8083 PE=3 SV=1)

HSP 1 Score: 1274.61 bits (3297), Expect = 0.000e+0
Identity = 692/1345 (51.45%), Postives = 885/1345 (65.80%), Query Frame = 2
Query:   98 MEVLHFYQIVSFSNKLKRNLVDNNLLDGTIIATSEICYNIEIKGXXXXXXXXXXXXXXITRSDNINDISSKPINFQLKKYNMS----IEIGPRLNFCTPLSTNAVCILKSLGFNMISRFEISHIYHFSSENDNLLSKRNDIIKNI----HDKMTEMAYPHQINSFNLNVAPSPVFTIDIMNEGIKALEEINKSMGLAMDEWDLLYYHDIFVNIMHRNPSNVECFDLAQSNSEHSRHWFFKGQMIIDGVEMEQSLFDILTETQKYSNQNNVIAFSDNSSAIKGFTTPILYINDPAYPSVYEIKDSFQNVCFTAETHNXXXXXXXXXXXXXXXXXRIRDIQAVGMGGYVVAGTAGYCFGNLRLPYYTLPWETD-PCFKYPSNFAQASKIVIEASNGASDYGNEFGEPVINGFCRSFGMITHSGEWKEWIKPIMFSGGIGQLSSLHVNKSSPNVNQLVIKXXXXXXXXXXXXXAASSVEIQGDSSRDKELDLGAVQRGDAQMENKMNRVIRGCIDLRDLNPIKSIHDQGAGGNGNVLKELVDPLGAIIDASNFTLGDPTINLLELWGAEYQESNGLLIDERHLDQFKKICDRERCPINVVGKVTGDGNIRLINSVALEEELDPSMPYIVDLDLSVVLGKMPKKKFYLKHVEKILSPLKLPLNLQVEDALSRVLRLPSVGSKRFLTNKVDRSVSGLVAQQQCVGPLHTPLADVAIVALSYFDIVGAATAIGEQPIKMLINVKEGAKLCVIEALTNLCMIPVTSFEDIKVSGNWMWPAKLPGEGAALWDACNAFCSLLKDLKIAIDGGKDSLSMAATVNDNTVVKSPGSLVVSAYVCCPDIRLAVTPDLK---GDGSLIWIRMN-SQYRLGGSALAQVYCQLGDKCPEFDNVGLFKKSWNCLQKIFMEKLASAAHDISDGGLIGCLLEMAFAGNVGIDVIINASIADCDASNSSAEISILFNEETGWIIEVPNNYLSTVINDLESNELLFSLIGHSCKRYEVTPTVTLTVNELNIFSNFKLGEFRTMWEDTSYHLEKLQCNTECVNKEYQFYGNPNITSNPFVISDSWLKPYNKINSKVFRVAILREEGSNGDREMAAAFIKSGFETWDITMQDLLSDLITLEEFNGLIFVGGFSFGDVLGSAKGWAAAIKYNEKIKKKFQNFKIREDTFSLGVCNGCQLMTWLGWLNDSHSLDNCEMKRDIILSHNDSNRFESRFSVVSIPQNTKSIMLSRLLGARLGVWVAHGEGKFEFTNQEFCSQALSDGLIALNYVNLDATNDDVVNYPFNPNGSISNVAGLCSKDGRHLAIMPHPERSFMWWQWAYTG-DLDVSTEVSPWMCIFNSAYEWVEKL 4090
            M VL FY   S    + R L     L   +  T+E+CYN+E+ G E  + + + +L  + R      + ++P++ Q +    S    +EIGPRLNF T  STNAV I +S G   I+R E S  +   +EN   +S+    IK +    HD MTE  Y H I SF +   P PVF +DI+ +G  ALE  N+ +GLA D WDL YY  +F  I +RNP++VECFDLAQSNSEHSRHWFF+G+M+IDG E + +LF ++ +TQ++SNQNNVI F DNSS I+G     +Y  DP+  S YE + S ++V FTAETHNFPTGVAPF GA TGTGGRIRD+Q+ G GG+VVAGTAGYCFGNL +P Y+LPWE +   ++YPS+FA   ++ IEAS+GASDYGN+FGEPV++GF RSFGM   +GE +EWIKPIMFSGG+G +   +V K        V+KIGGPVYRIGVGGGAASSV++QGD+  ++  DLGAVQRGDA+ME KMNR +R C++  + NPI SIHDQGAGGNGNVLKEL +P GA+I    F  GDPT+++LELWGAEYQESN LL+        +++C RE+CP++ VG +TGDG I L+N    + +    + + VDL L  VLGKMP+K+F ++ +   L PL LP  L V DAL RVLRLP+V SKR+LTNKVDRSV+GLVAQQQCVGPLHTPLADVA+VA+S F + GAATAIGEQP+K L+    GA++ V EALTNL    VT+ +D+K SGNWMW AKLPGEGA LW+AC A C ++  L +AIDGGKDSLSMAA V   T VK+PG+LV+SAY  CPDI   VTPDL+   G G L+W+ ++   +RLGGSALAQ Y QLGD CP+ D        +   QK+  ++L SA HDISDGGLI CLLEMAFAGN G DV +         S+ S  + +LF+EE G ++EV    L  V        L    IG +C  +    TV + V+E  + S   L   R +WE TS+ LE+LQ + +CV +E +                S +    ++ + + RVA++REEGSNGDREM+ +   +GFE WD+TMQDL S  +TL+ F  ++FVGGFS+ DVLGSAKGWAA + YN K K +F+ F+ REDT SLGVCNGCQL+  LGW+       + E    ++L+HN S RFESRF  V I Q + SI L  + G+ LGVWVAHGEG   F +        S GL  + Y  LD        YP NPNGS   +AGLCSKDGRHLA+MPHPER  + WQW +   DL  +   SPWM +F +A  W   L
Sbjct:    1 MAVLRFY---SSEALIGRALQRAAKLFPHLSITTELCYNVELTGCERLDAEQKEVLLWLFRPP----LQAEPLSDQPRLTEGSGDKLVEIGPRLNFSTAWSTNAVSICQSAGLANITRVEQSRRFLIKAENGRSMSELGADIKELVGCLHDSMTECVYQHPITSFAVETTPQPVFEVDILGKGRAALETANRELGLAFDSWDLDYYTSMFQRI-NRNPTSVECFDLAQSNSEHSRHWFFRGRMVIDGQEQQATLFSLIMDTQRHSNQNNVIKFCDNSSGIRGGELRCIYPADPSEASPYETRRSLRHVIFTAETHNFPTGVAPFSGATTGTGGRIRDVQSAGRGGHVVAGTAGYCFGNLHIPGYSLPWEQEGEGWEYPSSFAPPLQVAIEASDGASDYGNKFGEPVLSGFARSFGMRLANGERREWIKPIMFSGGLGSIEDGYVKKEEAEAGMEVVKIGGPVYRIGVGGGAASSVQVQGDNCSER--DLGAVQRGDAEMEQKMNRALRACLERSNGNPICSIHDQGAGGNGNVLKELSEPAGAVIYCGKFKKGDPTLSVLELWGAEYQESNALLLRPSDKSYLERVCQREKCPVDFVGLITGDGKIVLVNDEGSDGDRADGVRHPVDLQLEWVLGKMPQKEFQMERLAPTLRPLSLPAELTVRDALQRVLRLPAVASKRYLTNKVDRSVTGLVAQQQCVGPLHTPLADVAVVAMSPFGLQGAATAIGEQPVKGLVCPAAGARMAVGEALTNLLFARVTALKDVKCSGNWMWAAKLPGEGACLWEACKAMCEVMGQLGVAIDGGKDSLSMAARVGTET-VKAPGALVISAYAVCPDITATVTPDLEDPDGKGVLLWVPVSPGHHRLGGSALAQCYSQLGDVCPDLDQPEFLIACFTTTQKLIEDRLLSAGHDISDGGLISCLLEMAFAGNRGFDVEL--------PSDGSGVMELLFSEELGLVLEVSQTDLEAVCQRYRDGGLRCHRIGRTCG-FGPEATVRVRVDEQEVLSE-SLPVLRAVWEATSFQLERLQADEQCVKQEEEGLSKRTQPYFNLTFDPSEIPSIRQLAAGLPRVAVIREEGSNGDREMSVSLFMAGFEVWDVTMQDLCSGSLTLKPFKAVVFVGGFSYADVLGSAKGWAATVAYNPKAKAEFERFQRREDTLSLGVCNGCQLLALLGWVGGGEEGADSE----VVLTHNRSGRFESRFVSVGI-QKSPSIWLRGMEGSALGVWVAHGEGLMRFCSPRAQDLITSSGLAPVRY--LDDQGSPTEEYPLNPNGSPQGIAGLCSKDGRHLAMMPHPERCTLGWQWPWAPRDLRPALSPSPWMRMFRNAAAWCSNL 1317          
BLAST of Phosphoribosylformylglycinamidine synthase vs. TrEMBL
Match: A0A3Q1J1K8 (Phosphoribosylformylglycinamidine synthase OS=Anabas testudineus OX=64144 PE=3 SV=1)

HSP 1 Score: 1266.14 bits (3275), Expect = 0.000e+0
Identity = 686/1341 (51.16%), Postives = 882/1341 (65.77%), Query Frame = 2
Query:   98 MEVLHFYQIVSFSNKLKRNLVDNNLLDGTIIATSEICYNIEIKGXXXXXXXXXXXXXXITRSD-NINDISSKPINFQLKKYNMSIEIGPRLNFCTPLSTNAVCILKSLGFNMISRFEISHIYHFSSENDNLLSKRNDIIKNI----HDKMTEMAYPHQINSFNLNVAPSPVFTIDIMNEGIKALEEINKSMGLAMDEWDLLYYHDIFVNIMHRNPSNVECFDLAQSNSEHSRHWFFKGQMIIDGVEMEQSLFDILTETQKYSNQNNVIAFSDNSSAIKGFTTPILYINDPAYPSVYEIKDSFQNVCFTAETHNXXXXXXXXXXXXXXXXXRIRDIQAVGMGGYVVAGTAGYCFGNLRLPYYTLPWETD-PCFKYPSNFAQASKIVIEASNGASDYGNEFGEPVINGFCRSFGMITHSGEWKEWIKPIMFSGGIGQLSSLHVNKSSPNVNQLVIKXXXXXXXXXXXXXAASSVEIQGDSSRDKELDLGAVQRGDAQMENKMNRVIRGCIDLRDLNPIKSIHDQGAGGNGNVLKELVDPLGAIIDASNFTLGDPTINLLELWGAEYQESNGLLIDERHLDQFKKICDRERCPINVVGKVTGDGNIRLINSVALEEELDPSMPYIVDLDLSVVLGKMPKKKFYLKHVEKILSPLKLPLNLQVEDALSRVLRLPSVGSKRFLTNKVDRSVSGLVAQQQCVGPLHTPLADVAIVALSYFDIVGAATAIGEQPIKMLINVKEGAKLCVIEALTNLCMIPVTSFEDIKVSGNWMWPAKLPGEGAALWDACNAFCSLLKDLKIAIDGGKDSLSMAATVNDNTVVKSPGSLVVSAYVCCPDIRLAVTPDLK---GDGSLIWIRMN-SQYRLGGSALAQVYCQLGDKCPEFDNVGLFKKSWNCLQKIFMEKLASAAHDISDGGLIGCLLEMAFAGNVGIDVIINASIADCDASNSSAEISILFNEETGWIIEVPNNYLSTVINDLESNELLFSLIGHSCKRYEVTPTVTLTVNELNIFSNFKLGEFRTMWEDTSYHLEKLQCNTECVNKEYQFYGNPNITSNPFVISDSWLKPYNKINSKVFRVAILREEGSNGDREMAAAFIKSGFETWDITMQDLLSDLITLEEFNGLIFVGGFSFGDVLGSAKGWAAAIKYNEKIKKKFQNFKIREDTFSLGVCNGCQLMTWLGWLNDSHSLDNCEMKRDIILSHNDSNRFESRFSVVSIPQNTKSIMLSRLLGARLGVWVAHGEGKFEFTNQEFCSQALSDGLIALNYVNLDATNDDVVNYPFNPNGSISNVAGLCSKDGRHLAIMPHPERSFMWWQWAYTG-DLDVSTEVSPWMCIFNSAYEWVEK 4087
            M V+ FY   +      R L     L   +  T+E+CYN+E+ G E   ++ + +L  + R       +S KP N         +EIGPRLNF T  STNAV + +S G   ++R E+S  +    ++       N  +K +    +D MTE  Y H I SF +   P PVF +DI+  G  ALE  N  +GLA D WDL YY  +F  I  RNP++VECFDLAQSNSEHSRHWFF+G+M+ID  E +++LF ++ +TQ++SNQNNVI F DNSS IKG     +Y  DP+  S YE + S ++V FTAETHNFPTGVAPF GA TGTGGRIRD+Q+ G GG+V+AGTAGYCFGNL +P Y LPWE +   ++YPS+FA   ++ IEAS+GASDYGN+FGEPV++GF RSFGM   +GE +EWIKPIMFSGG+G +   HV K        V+KIGGPVYRIGVGGGAASSV++QGD+S D+  DLGAVQRGDA+ME KMNR +R C++    NPI SIHDQGAGGNGNVLKEL +P GAII  S F  GDPT+++LELWGAEYQESN LL+        +++C RE+CP++ VG +TGDG I L++      +L       VDL L  VLGKMP+K+F ++ +      L LP  L V+DAL+RVLRLP+V SKR+LTNKVDRSV+GLVAQQQCVGPLHTPLADVA+VALS F I G ATAIGEQPIK L+    GA++ V EALTNL    VT+ +D+K SGNWMW AKLPGEGA+LW+AC A C ++  L IAIDGGKDSLSMAA V   T VK+PG+LV+SAY  CPDI   VTPDL+   G G L+W+ ++   +RLGGSALAQ Y QLGD  P+ D   L    +N  Q +  ++L SA HDISDGGLI CLLEMAFAGN GIDV         + S  +  + +LF+EE G ++EV  +++ TV        +    IG +C  +     V++ V+   +    KL   R +WEDTS+ LE+LQ N  CV +E +                S     ++++S   RVA++REEGSNGDREM+ +   +GFE WD+TMQDL S  +TLE+F  ++FVGGFS+ DVLGSAKGWAA + YN K K +F  F  R+DT SLGVCNGCQL+  LGW+ +       E    ++L+HN+S RFESRF  V I + + S+ L  + G+ LGVWVAHGEG  +F + +  ++ +S GL  L Y++      +V  YP NPNGS   +AGLCS+DGRHLA+MPHPER  + WQW +   D   S + SPW+ +F +A  W  K
Sbjct:    1 MAVVRFYSNEAVQG---RALQRAAKLYPQLSITTELCYNVELTGCESLSEEQKEVLLWLFRPPLQAEPLSEKP-NLSAGSGERLVEIGPRLNFSTAWSTNAVSMCRSAGLTNVTRVELSRRFLIKPQHGESTQDVNGDVKKLIECLYDGMTECIYQHPITSFTVETKPQPVFEVDILGNGRAALEAANDELGLAFDSWDLDYYTSMFQRI-KRNPTSVECFDLAQSNSEHSRHWFFRGRMVIDKQEQKETLFSLIMDTQQHSNQNNVIKFCDNSSGIKGMELDCVYPKDPSQASPYETRRSLRHVIFTAETHNFPTGVAPFSGATTGTGGRIRDVQSAGRGGHVIAGTAGYCFGNLHIPGYVLPWEPEGEGWEYPSSFAPPLQVAIEASDGASDYGNKFGEPVLSGFARSFGMRLANGERREWIKPIMFSGGLGSIEDTHVKKEEAETGMEVVKIGGPVYRIGVGGGAASSVQVQGDNSNDR--DLGAVQRGDAEMEQKMNRALRACLERSGGNPICSIHDQGAGGNGNVLKELSEPAGAIIYCSRFKKGDPTLSVLELWGAEYQESNALLLQPADRSFLERVCQREKCPVDFVGNITGDGKIVLVDDEGGSRDLADRGRCPVDLQLDWVLGKMPQKEFRMERLTPTHQALTLPAGLTVKDALTRVLRLPAVASKRYLTNKVDRSVTGLVAQQQCVGPLHTPLADVAVVALSPFSIEGVATAIGEQPIKGLVCPAAGARMAVGEALTNLVFARVTALKDVKCSGNWMWAAKLPGEGASLWEACKAMCEVMGQLGIAIDGGKDSLSMAARVGKET-VKAPGALVISAYAVCPDITATVTPDLEDPDGKGMLLWVPLSPGHHRLGGSALAQCYSQLGDCSPDLDKPYLLTSCFNTTQTLIHDRLLSAGHDISDGGLISCLLEMAFAGNRGIDV---------ELSQGTGVMELLFSEELGLVLEVSESHVKTVRQRYSDAGVECHHIGRTCG-FGPEAMVSVRVDGQEVLRE-KLPNLRALWEDTSFQLERLQANELCVQQEKEGLAKRTQPYFNLTFDPSETPSIDQLSSGQPRVAVVREEGSNGDREMSVSLYMAGFEVWDVTMQDLCSGSLTLEQFKAVVFVGGFSYADVLGSAKGWAATVTYNPKAKAEFDRFWQRDDTLSLGVCNGCQLLALLGWVGEGEDAAGSE----VVLTHNESGRFESRFVSVGI-EKSPSVWLRGMEGSALGVWVAHGEGLMQFRSSQAKNRIISGGLAPLRYLDDQGQPTEV--YPLNPNGSPQGIAGLCSRDGRHLAMMPHPERCTLGWQWPWAPRDFRASLKPSPWLRMFKNAAAWCSK 1315          
BLAST of Phosphoribosylformylglycinamidine synthase vs. TrEMBL
Match: A0A087Y6E0 (Phosphoribosylformylglycinamidine synthase OS=Poecilia formosa OX=48698 PE=3 SV=2)

HSP 1 Score: 1264.98 bits (3272), Expect = 0.000e+0
Identity = 684/1340 (51.04%), Postives = 888/1340 (66.27%), Query Frame = 2
Query:   98 MEVLHFYQIVSFSNKLKRNLVDNNLLDGTIIATSEICYNIEIKGXXXXXXXXXXXXXXITRSDNINDISSKPINFQLKKYNMS----IEIGPRLNFCTPLSTNAVCILKSLGFNMISRFEISHIYHFS-SENDNLLSKRNDIIKNIHDKMTEMAYPHQINSFNLNVAPSPVFTIDIMNEGIKALEEINKSMGLAMDEWDLLYYHDIFVNIMHRNPSNVECFDLAQSNSEHSRHWFFKGQMIIDGVEMEQSLFDILTETQKYSNQNNVIAFSDNSSAIKGFTTPILYINDPAYPSVYEIKDSFQNVCFTAETHNXXXXXXXXXXXXXXXXXRIRDIQAVGMGGYVVAGTAGYCFGNLRLPYYTLPWETD-PCFKYPSNFAQASKIVIEASNGASDYGNEFGEPVINGFCRSFGMITHSGEWKEWIKPIMFSGGIGQLSSLHVNKSSPNVNQLVIKXXXXXXXXXXXXXAASSVEIQGDSSRDKELDLGAVQRGDAQMENKMNRVIRGCIDLRDLNPIKSIHDQGAGGNGNVLKELVDPLGAIIDASNFTLGDPTINLLELWGAEYQESNGLLIDERHLDQFKKICDRERCPINVVGKVTGDGNIRLINSVALEEELDPSMPYIVDLDLSVVLGKMPKKKFYLKHVEKILSPLKLPLNLQVEDALSRVLRLPSVGSKRFLTNKVDRSVSGLVAQQQCVGPLHTPLADVAIVALSYFDIVGAATAIGEQPIKMLINVKEGAKLCVIEALTNLCMIPVTSFEDIKVSGNWMWPAKLPGEGAALWDACNAFCSLLKDLKIAIDGGKDSLSMAATVNDNTVVKSPGSLVVSAYVCCPDIRLAVTPDL-----KGDGSLIWIRMN-SQYRLGGSALAQVYCQLGDKCPEFDNVGLFKKSWNCLQKIFMEKLASAAHDISDGGLIGCLLEMAFAGNVGIDVIINASIADCDASNSSAEISILFNEETGWIIEVPNNYLSTVINDLESNELLFSLIGHSCKRYEVTPTVTLTVNELNIFSNFKLGEFRTMWEDTSYHLEKLQCNTECVNKEYQFYGNPNITSNPFVISDSWLKPYNKINSKVFRVAILREEGSNGDREMAAAFIKSGFETWDITMQDLLSDLITLEEFNGLIFVGGFSFGDVLGSAKGWAAAIKYNEKIKKKFQNFKIREDTFSLGVCNGCQLMTWLGWLNDSHSLDNCEMKRDIILSHNDSNRFESRFSVVSIPQNTKSIMLSRLLGARLGVWVAHGEGKFEFTNQEFCSQALSDGLIALNYVNLDATNDDVVNYPFNPNGSISNVAGLCSKDGRHLAIMPHPERSFMWWQWAYTG-DLDVSTEVSPWMCIFNSAYEW 4078
            M VL FY   S    + R L     L   +  T+E+CYN+E+ G E  +     +L  + R      + ++P++ Q +    S    +EIGPRLNF T  STNAV I +S G + ++R E S  +    ++ D   +   ++I+ +HD MTE  Y H I SF +  AP PVF +D++ +G  ALE  N  +GLA D WDL YY  +F  I +RNP++VECFDLAQSNSEHSRHWFF+G+M+IDG E   +LF ++ +TQ++SNQNNVI F DNSS I+G     +Y  DP+  S YE + S ++V FTAETHNFPTGVAPF GA TGTGGRIRD+Q+ G GG+V+AGTAGYCFGNL +P Y+LPWE +   ++YPS+FA   ++ IEAS+GASDYGN+FGEPV++GF RSFGM   +GE +EWIKPIMFSGG+G +   +V K        V+KIGGPVYRIGVGGGAASSV++QGD+  ++  DLGAVQRGDA+ME KMNR +R C++  + NPI SIHDQGAGGNGNVLKEL +P GA+I  S F  GDPT+++LELWGAEYQESN LL+        +++C RE+CP++ VG++TGDG I L++    + +    + + VDL L  VLGKMP+K+F ++ +   L PL LP+ L V DAL RVLRLP+V SKR+LTNKVDRSV+GLVAQQQCVGPLHTPLADVA+VALS F + GAATAIGEQP+K L+    GA++ V EALTNL    VT+ +D+K SGNWMW AKLPGEGA LWDAC A C ++  L +AIDGGKDSLSMAA V   T VK+PG+LV+SAY  CPDI   VTPDL     K  G L+W+ ++  ++RLGGSALAQ Y QLGD CP+ D        +   QK+  ++L SA HDISDGGL+ CLLEMAFAGN G DV ++        S+ S  + +LF+EE G ++EV    L  V        L    IG +C  +    TV + V+   + S   L + R +WE TS+ LE+LQ +  CV +E +                S      ++ + + RVA++REEGSNGDREM+ +   +GFE WD+TMQDL S  +TL+ F  ++FVGGFS+ DVLGSA+GWAA + YN K K +F+ F+ REDT SLGVCNGCQL+T LGW+ +       E+  +++L+HN S RFESRF  V I Q++ SI L  + G+ LGVWVAHGEG   F +        S GL  + Y  LD        YP NPNGS   +AGLCS+DGRHLA+MPHPER  + WQW +   DL  +   SPW+ +F +A  W
Sbjct:    1 MAVLRFY---SGEALIGRALQRAAKLFPHLSITTELCYNVELTGCERLDAAQTEVLLWLFRPP----LQAEPLSDQPRLTEGSGDKLVEIGPRLNFSTAWSTNAVSICQSAGLSNVTRVERSRRFLIKVADGDTGSADVKELIECLHDSMTECVYQHPITSFAVETAPQPVFEVDVLGKGCAALETANSELGLAFDSWDLDYYTSMFQRI-NRNPTSVECFDLAQSNSEHSRHWFFRGRMVIDGQEQPATLFSLIMDTQRHSNQNNVIKFCDNSSGIRGGELRCIYPADPSEASPYETRRSVRHVIFTAETHNFPTGVAPFSGATTGTGGRIRDVQSAGRGGHVIAGTAGYCFGNLHIPGYSLPWEQEGEGWEYPSSFAPPLQVAIEASDGASDYGNKFGEPVLSGFARSFGMRLANGERREWIKPIMFSGGLGSIEDNYVKKEEAEAGMEVVKIGGPVYRIGVGGGAASSVQVQGDNCSER--DLGAVQRGDAEMEQKMNRALRACLERSNGNPICSIHDQGAGGNGNVLKELSEPAGAVIYCSKFKKGDPTLSVLELWGAEYQESNALLLRPSDKSYLERVCQREKCPVDFVGRITGDGKIVLVDDEGSDGDRADGVRHPVDLQLDWVLGKMPQKEFRMERLAPTLLPLSLPVELTVRDALQRVLRLPAVASKRYLTNKVDRSVTGLVAQQQCVGPLHTPLADVAVVALSPFGLQGAATAIGEQPVKGLVCPAAGARMAVGEALTNLLFARVTALKDVKCSGNWMWAAKLPGEGACLWDACKAMCEVMGQLGVAIDGGKDSLSMAARVGTET-VKAPGALVISAYAVCPDITATVTPDLEDPDGKALGVLLWVPVSPGRHRLGGSALAQCYSQLGDVCPDLDRPEFLSACFTTTQKLLEDRLLSAGHDISDGGLVSCLLEMAFAGNRGFDVELS--------SDGSGVMELLFSEELGLVLEVSQTDLEAVCQRYRDGGLRCHRIGRTCG-FGPEATVRVRVDGQEVLSE-SLPDLRAVWEATSFQLERLQADELCVKQEEEGLSRRMQPYFKLTFDPSETPSIRQLAAGLPRVAVVREEGSNGDREMSVSLFMAGFEVWDVTMQDLCSGSVTLQPFKAVVFVGGFSYADVLGSARGWAATVAYNPKAKAEFERFQRREDTLSLGVCNGCQLLTLLGWVGEGEEGAG-ELDSEVVLTHNRSGRFESRFVSVGI-QSSPSIWLRGMEGSALGVWVAHGEGLMRFRSPWAQDLITSSGLAPVRY--LDDQGSPTEEYPLNPNGSPQGIAGLCSRDGRHLAMMPHPERCTLGWQWPWAPRDLRPALSPSPWLRMFRNAAAW 1315          
BLAST of Phosphoribosylformylglycinamidine synthase vs. TrEMBL
Match: B5DEE8 (Glutamine amidotransferase type-1 domain-containing protein OS=Xenopus tropicalis OX=8364 PE=2 SV=1)

HSP 1 Score: 1264.6 bits (3271), Expect = 0.000e+0
Identity = 692/1350 (51.26%), Postives = 894/1350 (66.22%), Query Frame = 2
Query:   98 MEVLHFYQIVSFSNKLKRNLVDNNLLDGTIIATSEICYNIEIKGXXXXXXXXXXXXXXITR----SDNINDISSKPINFQLKKYNMSIEIGPRLNFCTPLSTNAVCILKSLGFNMISRFEISHIYHFSSENDNLLSKRNDIIKNIHDKMTEMAYPHQINSFNLNVAPSPVFTIDIMNEGIKALEEINKSMGLAMDEWDLLYYHDIFVNIMHRNPSNVECFDLAQSNSEHSRHWFFKGQMIIDGVEMEQSLFDILTETQKYSNQNNVIAFSDNSSAIKGFTTPILYINDPAYPSVYEIKDSFQNVCFTAETHNXXXXXXXXXXXXXXXXXRIRDIQAVGMGGYVVAGTAGYCFGNLRLPYYTLPWETDPCFKYPSNFAQASKIVIEASNGASDYGNEFGEPVINGFCRSFGMITHSGEWKEWIKPIMFSGGIGQLSSLHVNKSSPNVNQLVIKXXXXXXXXXXXXXAASSVEIQGDSSRDKELDLGAVQRGDAQMENKMNRVIRGCIDLRDLNPIKSIHDQGAGGNGNVLKELVDPLGAIIDASNFTLGDPTINLLELWGAEYQESNGLLIDERHLDQFKKICDRERCPINVVGKVTGDGNIRLINSVALEEELDPS----MPYIVDLDLSVVLGKMPKKKFYLKHVEKILSPLKLPLNLQVEDALSRVLRLPSVGSKRFLTNKVDRSVSGLVAQQQCVGPLHTPLADVAIVALSYFDIVGAATAIGEQPIKMLINVKEGAKLCVIEALTNLCMIPVTSFEDIKVSGNWMWPAKLPGEGAALWDACNAFCSLLKDLKIAIDGGKDSLSMAATVNDNTVVKSPGSLVVSAYVCCPDIRLAVTPDLKGDGS---LIWIRM-NSQYRLGGSALAQVYCQLGDKCPEFDNVGLFKKSWNCLQKIFMEKLASAAHDISDGGLIGCLLEMAFAGNVGIDVIINASIADCDASNSSAEISILFNEETGWIIEVPNNYLSTVINDLESNELLFSLIGHSCKRYEVTPTVTLTVNELNIFSNFKLGEFRTMWEDTSYHLEKLQCNTECVNKE---YQFYGNP--NITSNPFVISDSWLKPYNKINSKVFRVAILREEGSNGDREMAAAFIKSGFETWDITMQDLLSDLITLEEFNGLIFVGGFSFGDVLGSAKGWAAAIKYNEKIKKKFQNFKIREDTFSLGVCNGCQLMTWLGWLNDSHSLDNCE--MKRDIILSHNDSNRFESRFSVVSIPQNTKSIMLSRLLGARLGVWVAHGEGKFEFTNQEFCSQALSDGLIALNYVNLDATNDDVVNYPFNPNGSISNVAGLCSKDGRHLAIMPHPERSFMWWQWAYTGD-LDVSTEVSPWMCIFNSAYEWVEK 4087
            M VLHFY+ +  S++  R     N+         E+CYN+   G      Q    L  +        +I+D SS       +  ++ +EIGPRLNF T  STNAV I +S+G   + R E S  Y    +     S+  +++ +++D+MTE  YP  + SF ++V P  V+ +DI+ +G  ALE+ N  +GLA D WDL YY  +F  +  RNPS+VECFDLAQSNSEHSRHWFFKG++ +DG E E SLFD++ +TQ  SN NNVI F DNSSAI+G     L   DP+    Y +  S +++ FTAETHNFPTGVAPF GA TGTGGRIRD+Q+ G G +V+AGTAGYCFGNL +P Y+LPWE DP ++YP  FA+  ++ IEASNGASDYGN+FGEPV+ GF RSFG+   SGE +EW+KPIMFSGGIG +  +H  K +P     V+K+GGPVYRIGVGGGAASS+++QGD++   ELD GAVQRGDA+ME KMNR +R C++    NPI SIHDQGAGGNGNVLKEL +P GA+I   +F LGDPT+++LE+WGAEYQESN LL+     +  + +C RER P++ VGK+TGDG I LIN    +   D +    +P  VDL L  VLGKMP+K+F L  V   L PL LP  L V  AL RVLRLPSV SKR+LTNKVDRSV+GLVAQQQCVGPLHTPLADVA+V+LSY DIVG ATAIGEQPIK L+N   GA+L V EALTNL    VT  +D+K SGNWMW AKLPGEGA L+DAC A C ++  L +AIDGGKDSLSMAA V   T VK+PGSLV+S Y  CPDI   VTPDLK  G    L+++ +   Q+RLGGSALAQ Y QLG+  P+ D+       +N  Q++  +++ SA HD+SDGGL+ C+LEMAFAGN G+D+ I++S  +         + +LF EE G ++EV    +  V+    +  +    IG + +R   +  V +  N   +  N KLG  R +WE+TS+ LE+LQ N  CV++E    +    P  ++T NP  I    L P + +     RVA++REEGSNGDREMAA+ + +GF+ WD+TM+DLL+   TL+ F GL+FVGGFS+ DVLGSAKGWAA++K+N  ++++F+NF+ R DTFSLGVCNGCQLM  LGW+   +  D       + ++LSHN S RFESRF  + I Q + SI+L  + G+ LGVWVAHGEG   F + +      S+ L  L YV  D        YP NPNGS   +AGLCS DGRHLA+MPHPER  M WQW +  +    S +VSPWM +F + Y W ++
Sbjct:    1 MVVLHFYRSLQNSSETLRLPGAENIQS----LQRELCYNVNWTGPAAPSSQETDALRWLFSCPFDPQSISDTSS----LHSEPSDLLVEIGPRLNFSTATSTNAVSICRSVGLTNVDRIECSKRYLIKFQTRPQGSEEQELLASLYDRMTECVYPEPVRSFEVSVRPEKVYEVDILGQGRAALEKANTELGLAFDSWDLDYYSSLFQRV-GRNPSSVECFDLAQSNSEHSRHWFFKGKLKVDGQEKEMSLFDMIMKTQDTSNPNNVIKFCDNSSAIQGREVASLIPTDPSCAGPYHLCRSTRHLIFTAETHNFPTGVAPFSGATTGTGGRIRDVQSTGRGAHVIAGTAGYCFGNLHIPGYSLPWE-DPAYQYPVQFARPLEVAIEASNGASDYGNKFGEPVLAGFARSFGVRLPSGERREWVKPIMFSGGIGSMEDVHRTKEAPEPGMHVVKVGGPVYRIGVGGGAASSIQVQGDNA--SELDFGAVQRGDAEMEQKMNRAVRACVERGGKNPICSIHDQGAGGNGNVLKELSEPQGAVIYTKSFQLGDPTLSVLEIWGAEYQESNALLLRPDDAEFLRSVCRRERSPVDFVGKITGDGRIVLINGSDTDPAPDSTDRNAVP--VDLQLEWVLGKMPRKEFVLNRVAPNLQPLVLPSGLTVGQALDRVLRLPSVASKRYLTNKVDRSVTGLVAQQQCVGPLHTPLADVAVVSLSYSDIVGGATAIGEQPIKSLLNPAAGARLAVAEALTNLLFAQVTDLKDVKCSGNWMWAAKLPGEGALLYDACAAMCDVMAQLGVAIDGGKDSLSMAARVGTET-VKAPGSLVISVYAVCPDITTTVTPDLKNPGQKGVLLYLPLCPGQHRLGGSALAQCYSQLGETPPDLDDPQTLISCFNVTQQLLRDRVLSAGHDVSDGGLVTCILEMAFAGNCGLDIEISSSCTNV--------LELLFAEEPGLVLEVAEQSVELVMERYRAAGVECVRIGCTKERGPAS-MVRIRANGQEVV-NEKLGSLRAVWEETSFQLERLQANPSCVSQEEAGLRVREGPSYHLTFNPSEIP---LVPPS-VGGNQPRVAVVREEGSNGDREMAASLLMAGFQVWDVTMEDLLAGGTTLDSFRGLVFVGGFSYADVLGSAKGWAASVKFNASVREQFENFRRRADTFSLGVCNGCQLMALLGWVGPDNPTDTVGDLPTQGVLLSHNLSGRFESRFVTLKI-QQSPSILLRGMAGSTLGVWVAHGEGYMRFRSPKVQDYVTSNHLAPLCYV--DDGGKPTEEYPMNPNGSPLGIAGLCSADGRHLAMMPHPERCVMKWQWPWMPESWRQSLDVSPWMRLFQNGYRWCQE 1318          
BLAST of Phosphoribosylformylglycinamidine synthase vs. Ensembl Cavefish
Match: pfas (phosphoribosylformylglycinamidine synthase [Source:NCBI gene;Acc:103033258])

HSP 1 Score: 1214.13 bits (3140), Expect = 0.000e+0
Identity = 673/1342 (50.15%), Postives = 884/1342 (65.87%), Query Frame = 2
Query:   98 MEVLHFYQIVSFSNKLKRNLVDNNLLDGTIIATSEICYNIEIKGXXXXXXXXXXXXXXITRSDNINDISSKPINFQLKKYNMSIEIGPRLNFCTPLSTNAVCILKSLGFNMISRFEISHIYHFSSENDNLLSKRN-----DIIKNIHDKMTEMAYPHQINSFNLNVAPSPVFTIDIMNEGIKALEEINKSMGLAMDEWDLLYYHDIFVNIMHRNPSNVECFDLAQSNSEHSRHWFFKGQMIIDGVEMEQSLFDILTETQKYSNQNNVIAFSDNSSAIKGFTTPILYINDPAYPSVYEIKDSFQNVCFTAETHNXXXXXXXXXXXXXXXXXRIRDIQAVGMGGYVVAGTAGYCFGNLRLPYYTLPWETDPCFKYPSNFAQASKIVIEASNGASDYGNEFGEPVINGFCRSFGMITHSGEWKEWIKPIMFSGGIGQLSSLHVNKSSPNVNQLVIKXXXXXXXXXXXXXAASSVEIQGDSSRDKELDLGAVQRGDAQMENKMNRVIRGCIDLRDLNPIKSIHDQGAGGNGNVLKELVDPLGAIIDASNFTLGDPTINLLELWGAEYQESNGLLIDERHLDQFKKICDRERCPINVVGKVTGDGNIRLINSVALEEELDPSMPYIVDLDLSVVLGKMPKKKFYLKHVEKILSPLKLPLNLQVEDALSRVLRLPSVGSKRFLTNKVDRSVSGLVAQQQCVGPLHTPLADVAIVALSYFDIVGAATAIGEQPIKMLINVKEGAKLCVIEALTNLCMIPVTSFEDIKVSGNWMWPAKLPGEGAALWDACNAFCSLLKDLKIAIDGGKDSLSMAATVNDNTVVKSPGSLVVSAYVCCPDIRLAVTPDL---KGDGSLIWIRMNS-QYRLGGSALAQVYCQLGDKCPEFDNVGLFKKSWNCLQKIFMEKLASAAHDISDGGLIGCLLEMAFAGNVGIDVIINASIADCDASNSSAEISILFNEETGWIIEVPNNYLSTVINDLESNELLFSLIGHSCKRYEVTPTVTLTVNELNIFSNFKLGEFRTMWEDTSYHLEKLQCNTECVNKEYQFYGNPNITSNPFV---ISDSWLKPYNKINSKVFRVAILREEGSNGDREMAAAFIKSGFETWDITMQDLLSDLITLEEFNGLIFVGGFSFGDVLGSAKGWAAAIKYNEKIKKKFQNFKIREDTFSLGVCNGCQLMTWLGWLNDSHSLDNCEMKRDIILSHNDSNRFESRFSVVSIPQNTKSIMLSRLLGARLGVWVAHGEGKFEFTNQEFCSQALSDGLIALNYVNLDATNDDVVNYPFNPNGSISNVAGLCSKDGRHLAIMPHPERSFMWWQWAYTGD-LDVSTEVSPWMCIFNSAYEWVE 4084
            M VL FY+     ++  R L     L      T+E+CYN+E+K  E    + + +L  +    +   +  +P           +EIGPRLNF T  STNAV I +S G ++++R E+S   H   +  N    RN      ++  ++D MTE  Y   I SF+++V P  VF +DI+ +G  ALE+ N  +GLA D WDL YY  +F  +  RNP++VECFDLAQSNSEHSRHWFF+G+M++DG E + +LF ++  TQ++SNQNNVI F DNSS IKG     ++  DP+  S YE + + ++V FTAETHNFPTGVAPF GA TGTGGRIRD+Q+ G GG+V+AGTAGYCFGNL +P ++LPWE D  ++YPS FA   ++ IEAS+GASDYGN+FGEPV+ GF RSFGM   +GE +EWIKPIMFSGG+G +   HV K        V+KIGGPVYRIGVGGGAASSV++QGD+S D+  DLGAVQRGDA+ME KMNR +R C++    NPI SIHDQGAGGNGNVLKEL +P GA+I  S F  GDPT+++LELWGAEYQESN LL+        +K+C RE+CP++ VGK+TGDG I L++ +  + +   +    VDL+L  VLGKMP+K+F +  V   L PL LP  L V  AL RVLRLP+V SKR+LTNKVDRSV+GL+AQQQCVGPLHTPLADVA+VALS F + GAATAIGEQPIK L++   GA++ V EALTNL    VT+ +D+K SGNWMW AKLPGEGA LW+AC A C ++ +L +A+DGGKDSLSMAA V   T VK+PG+LV+S Y  CPDI   VTPDL   +G G L+++ +++ +YRLGGSALAQ Y QLGD CP+ D+  L    +N  Q +  + L SA HD+SDGGLI CLLEMAFAGN G++V +               +  LF+EE G ++EV  N   +V     +  L+   IG +C  +     V +++    +  N  L   RT+WE TS+ LE+LQ N  CV +E +        + PF       +      +++    RVA++REEGSNGDREMA +   +GFE WD+TMQDL S   TL+ F  ++FVGGFS+ DVLGSAKGWAA + +N + +++F+ F+ REDT SLGVCNGCQL+  LGW+  +      +   D+IL+HN S RFESRF  V I   + ++ML  + G+ LGVWVAHGEG  +F   E   + +S  L  + Y+  D +      YP NPNGS   +AG+CS DGRHLA+MPHPER+ + WQW +    L  S + SPW+ +F +A  W +
Sbjct:    1 MTVLQFYR--REESEGGRTLRRVKQLYPYATITTELCYNVELKDAESLSKEQKDVLRWLFSPPHSVALLDEPTLKVTSPGETLVEIGPRLNFSTAWSTNAVSICQSAGLDLVTRVEVSR-RHLIKDGQN--GPRNGGEMEKLVALLYDSMTECVYTKPIASFSVDVQPQKVFEVDILGKGRAALEKANDELGLAFDSWDLDYYTALFQRV-KRNPTSVECFDLAQSNSEHSRHWFFRGRMVVDGQEQKDTLFSLIMGTQQHSNQNNVIKFCDNSSGIKGMELECMFPTDPSQASCYETRSTTRHVIFTAETHNFPTGVAPFSGATTGTGGRIRDVQSAGQGGHVIAGTAGYCFGNLHIPGFSLPWEED-GWEYPSTFAPPLQVAIEASDGASDYGNKFGEPVLAGFARSFGMRLANGERREWIKPIMFSGGLGSIEDKHVKKEEAEPGMEVVKIGGPVYRIGVGGGAASSVQVQGDNSSDR--DLGAVQRGDAEMEQKMNRALRACLERATGNPICSIHDQGAGGNGNVLKELSEPAGAVIYTSMFKRGDPTLSVLELWGAEYQESNALLLRPSDRGFVEKVCQREKCPVDFVGKITGDGKIVLVDDLNNQCDGVNNGRCPVDLELDWVLGKMPQKEFVMDCVVPSLKPLSLPAGLSVLPALERVLRLPAVASKRYLTNKVDRSVTGLIAQQQCVGPLHTPLADVAVVALSPFSLQGAATAIGEQPIKGLVSPAAGARMAVGEALTNLVFAQVTALKDVKCSGNWMWAAKLPGEGAYLWEACQAMCKVMGELGVAVDGGKDSLSMAARVGGET-VKAPGALVISVYAVCPDITATVTPDLDDQEGKGVLLYVPVSAGKYRLGGSALAQCYGQLGDCCPDLDHPDLLSACFNTTQLLIQDHLLSAGHDVSDGGLISCLLEMAFAGNRGLEVNL--------PFEGVGVMEALFSEELGLVLEVCENNADSVCQRYTNAGLVCHRIGTTCG-FGPDSMVRVSLCGQEVL-NESLPTLRTLWESTSFQLERLQANPLCVLQEEEGL---TTRTEPFFKLSFDPTEFPLLKELDGGKPRVAVVREEGSNGDREMAVSLFMAGFEVWDVTMQDLCSGSKTLDPFRAVVFVGGFSYADVLGSAKGWAATVTFNTRAREEFERFRRREDTLSLGVCNGCQLLALLGWVGGAD-----DGGSDVILTHNKSGRFESRFVSVGI-LPSPAVMLKGMEGSALGVWVAHGEGLMQFRCPEAQDRLISASLAPVRYI--DDSGAPTETYPMNPNGSAQGIAGICSPDGRHLAMMPHPERAVLGWQWPWVPQPLRASLKPSPWLRMFQNAAAWCQ 1311          
BLAST of Phosphoribosylformylglycinamidine synthase vs. Ensembl Cavefish
Match: pfas (phosphoribosylformylglycinamidine synthase [Source:NCBI gene;Acc:103033258])

HSP 1 Score: 1202.58 bits (3110), Expect = 0.000e+0
Identity = 678/1337 (50.71%), Postives = 881/1337 (65.89%), Query Frame = 2
Query:   98 MEVLHFYQIVSFSNKLKRNLVDNNLLDGTIIATSEICYNIEIKGXXXXXXXXXXXXXXITRSDNINDISSKPINFQLKKYNMSIEIGPRLNFCTPLSTNAVCILKSLGFNMISRFEIS--HIYHFSSENDNLLSKRNDIIKNIHDKMTEMAYPHQINSFNLNVAPSPVFTIDIMNEGIKALEEINKSMGLAMDEWDLLYYHDIFVNIMHRNPSNVECFDLAQSNSEHSRHWFFKGQMIIDGVEMEQSLFDILTETQKYSNQNNVIAFSDNSSAIKGFTTPILYINDPAYPSVYEIKDSFQNVCFTAETHNXXXXXXXXXXXXXXXXXRIRDIQAVGMGGYVVAGTAGYCFGNLRLPYYTLPWETDPCFKYPSNFAQASKIVIEASNGASDYGNEFGEPVINGFCRSFGMITHSGEWKEWIKPIMFSGGIGQLSSLHVNKSSPNVNQLVIKXXXXXXXXXXXXXAASSVEIQGDSSRDKELDLGAVQRGDAQMENKMNRVIRGCIDLRDLNPIKSIHDQGAGGNGNVLKELVDPLGAIIDASNFTLGDPTINLLELWGAEYQESNGLLIDERHLDQFKKICDRERCPINVVGKVTGDGNIRLINSVALEEELDPSMPYIVDLDLSVVLGKMPKKKFYLKHVEKILSPLKLPLNLQVEDALSRVLRLPSVGSKRFLTNKVDRSVSGLVAQQQCVGPLHTPLADVAIVALSYFDIVGAATAIGEQPIKMLINVKEGAKLCVIEALTNLCMIPVTSFEDIKVSGNWMWPAKLPGEGAALWDACNAFCSLLKDLKIAIDGGKDSLSMAATVNDNTVVKSPGSLVVSAYVCCPDIRLAVTPDL---KGDGSLIWIRMNS-QYRLGGSALAQVYCQLGDKCPEFDNVGLFKKSWNCLQKIFMEKLASAAHDISDGGLIGCLLEMAFAGNVGIDVIINASIADCDASNSSAEISILFNEETGWIIEVPNNYLSTVINDLESNELLFSLIGHSCKRYEVTPTVTLTVNELNIFSNFKLGEFRTMWEDTSYHLEKLQCNTECVNKEYQFYGNPNITSNPFVIS-DSWLKPYNKINSKVFRVAILREEGSNGDREMAAAFIKSGFETWDITMQDLLSDLITLEEFNGLIFVGGFSFGDVLGSAKGWAAAIKYNEKIKKKFQNFKIREDTFSLGVCNGCQLMTWLGWLNDSHSLDNCEMKRDIILSHNDSNRFESRFSVVSIPQNTKSIMLSRLLGARLGVWVAHGEGKFEFTNQEFCSQALSDGLIALNYVNLDATNDDVVNYPFNPNGSISNVAGLCSKDGRHLAIMPHPERSFMWWQWAYTGD-LDVSTEVSPWMCIFNSAYEWVE 4084
            M VL FY+     ++  R L     L      T+E+CYN+E+K                     I ++ S  I F+   +  S     RLNF T  STNAV I +S G ++++R E+S  H+      N   + K   ++  ++D MTE  Y   I SF+++V P  VF +DI+ +G  ALE+ N  +GLA D WDL YY  +F  +  RNP++VECFDLAQSNSEHSRHWFF+G+M++DG E + +LF ++  TQ++SNQNNVI F DNSS IKG     ++  DP+  S YE + + ++V FTAETHNFPTGVAPF GA TGTGGRIRD+Q+ G GG+V+AGTAGYCFGNL +P ++LPWE D  ++YPS FA   ++ IEAS+GASDYGN+FGEPV+ GF RSFGM   +GE +EWIKPIMFSGG+G +   HV K        V+KIGGPVYRIGVGGGAASSV++QGD+S D+  DLGAVQRGDA+ME KMNR +R C++    NPI SIHDQGAGGNGNVLKEL +P GA+I  S F  GDPT+++LELWGAEYQESN LL+        +K+C RE+CP++ VGK+TGDG I L++ +  + +   +    VDL+L  VLGKMP+K+F +  V   L PL LP  L V  AL RVLRLP+V SKR+LTNKVDRSV+GL+AQQQCVGPLHTPLADVA+VALS F + GAATAIGEQPIK L++   GA++ V EALTNL    VT+ +D+K SGNWMW AKLPGEGA LW+AC A C ++ +L +A+DGGKDSLSMAA V   T VK+PG+LV+S Y  CPDI   VTPDL   +G G L+++ +++ +YRLGGSALAQ Y QLGD CP+ D+  L    +N  Q +  + L SA HD+SDGGLI CLLEMAFAGN G++V +    A             LF+EE G ++EV  N   +V     +  L+   IG +C  +     V +++    +  N  L   RT+WE TS+ LE+LQ N  CV +E +  G    T   F +S D    P  K   K  RVA++REEGSNGDREMA +   +GFE WD+TMQDL S   TL+ F  ++FVGGFS+ DVLGSAKGWAA + +N + +++F+ F+ REDT SLGVCNGCQL+  LGW+  +   D+     D+IL+HN S RFESRF  V I   + ++ML  + G+ LGVWVAHGEG  +F   E   + +S  L  + Y+  D +      YP NPNGS   +AG+CS DGRHLA+MPHPER+ + WQW +    L  S + SPW+ +F +A  W +
Sbjct:   11 MTVLQFYR--REESEGGRTLRRVKQLYPYATITTELCYNVELKEKFFFFY--------------ILNLLSVQIQFKKLLFVFSF----RLNFSTAWSTNAVSICQSAGLDLVTRVEVSRRHLIKNGPRNGGEMEK---LVALLYDSMTECVYTKPIASFSVDVQPQKVFEVDILGKGRAALEKANDELGLAFDSWDLDYYTALFQRV-KRNPTSVECFDLAQSNSEHSRHWFFRGRMVVDGQEQKDTLFSLIMGTQQHSNQNNVIKFCDNSSGIKGMELECMFPTDPSQASCYETRSTTRHVIFTAETHNFPTGVAPFSGATTGTGGRIRDVQSAGQGGHVIAGTAGYCFGNLHIPGFSLPWEEDG-WEYPSTFAPPLQVAIEASDGASDYGNKFGEPVLAGFARSFGMRLANGERREWIKPIMFSGGLGSIEDKHVKKEEAEPGMEVVKIGGPVYRIGVGGGAASSVQVQGDNSSDR--DLGAVQRGDAEMEQKMNRALRACLERATGNPICSIHDQGAGGNGNVLKELSEPAGAVIYTSMFKRGDPTLSVLELWGAEYQESNALLLRPSDRGFVEKVCQREKCPVDFVGKITGDGKIVLVDDLNNQCDGVNNGRCPVDLELDWVLGKMPQKEFVMDCVVPSLKPLSLPAGLSVLPALERVLRLPAVASKRYLTNKVDRSVTGLIAQQQCVGPLHTPLADVAVVALSPFSLQGAATAIGEQPIKGLVSPAAGARMAVGEALTNLVFAQVTALKDVKCSGNWMWAAKLPGEGAYLWEACQAMCKVMGELGVAVDGGKDSLSMAARVGGET-VKAPGALVISVYAVCPDITATVTPDLDDQEGKGVLLYVPVSAGKYRLGGSALAQCYGQLGDCCPDLDHPDLLSACFNTTQLLIQDHLLSAGHDVSDGGLISCLLEMAFAGNRGLEVNLPFEGA-------------LFSEELGLVLEVCENNADSVCQRYTNAGLVCHRIGTTCG-FGPDSMVRVSLCGQEVL-NESLPTLRTLWESTSFQLERLQANPLCVLQEEE--GLTTRTEPFFKLSFDPTEFPLLKELGKP-RVAVVREEGSNGDREMAVSLFMAGFEVWDVTMQDLCSGSKTLDPFRAVVFVGGFSYADVLGSAKGWAATVTFNTRAREEFERFRRREDTLSLGVCNGCQLLALLGWVGGA---DDGGEGSDVILTHNKSGRFESRFVSVGI-LPSPAVMLKGMEGSALGVWVAHGEGLMQFRCPEAQDRLISASLAPVRYI--DDSGAPTETYPMNPNGSAQGIAGICSPDGRHLAMMPHPERAVLGWQWPWVPQPLRASLKPSPWLRMFQNAAAWCQ 1295          
BLAST of Phosphoribosylformylglycinamidine synthase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002087.1 (pep scaffold:Pmarinus_7.0:GL485690:1046:10953:1 gene:ENSPMAG00000001895.1 transcript:ENSPMAT00000002087.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 231.491 bits (589), Expect = 2.975e-68
Identity = 119/275 (43.27%), Postives = 165/275 (60.00%), Query Frame = 2
Query:  197 SEICYNIEIKGXXXXXXXXXXXXXXITRSDNINDISSKPINFQLKKYNMSIEIGPRLNFCTPLSTNAVCILKSLGFNMISRFEISHIYHFSSENDNLLSKRNDIIKNIHDKMTEMAYPHQINSFNLNVAPSPVFTIDIMNEGIKALEEINKSMGLAMDEWDLLYYHDIFVNIMHRNPSNVECFDLAQSNSEHSRHWFFKGQMIIDGVEMEQSLFDILTETQKYSNQNNVIAFSDNSSAIKGFTTPILYINDPAYPSVYEIKDSFQNVCFTAETHN 1021
            +E CYN+E  G E    + +R L  +         +S       +  +  IE+GPRLNF T  STNAV I  S+G + + R E S  + F          R  +   +HD+ TE  Y H + SF L+V   PV+ +D++ EG  ALE  N+ +GLA+DEWDL YY  +F   + RNP++VECFD+AQSNSEHSRHW F+G++ +DG  +E+SLFD++  TQ++SN NNVI FSDNSSAI+G     L   +P  PS  +   + ++V FTAETHN
Sbjct:   39 TEFCYNVEWDGPEAPSAEERRKLLWLFHPMLGGPGASSQSCLNPEGNDCLIEVGPRLNFSTAWSTNAVSICHSIGLHHVKRIECSQRHLFKFPTHPATQARRVLASGLHDRTTECVYDHPLGSFALSVRTEPVYHVDVLGEGRAALERANRELGLALDEWDLDYYTRLFRERVGRNPTSVECFDIAQSNSEHSRHWLFRGRLTVDGQALEESLFDMIIGTQQHSNPNNVIKFSDNSSAIRGGEVRCLVPAEPGAPSPLQETLTTRHVIFTAETHN 313          
BLAST of Phosphoribosylformylglycinamidine synthase vs. Ensembl Yeast
Match: ADE6 (Formylglycinamidine-ribonucleotide (FGAM)-synthetase; catalyzes a step in the 'de novo' purine nucleotide biosynthetic pathway [Source:SGD;Acc:S000003293])

HSP 1 Score: 615.535 bits (1586), Expect = 0.000e+0
Identity = 458/1304 (35.12%), Postives = 683/1304 (52.38%), Query Frame = 2
Query:  347 IEIGPRLNFCTPLSTNAVCILKSLGF-NMISRFE------ISHIYHFSSENDNLLSKRNDI-IKNIHDKMTEMAY---PHQINSFNLNVAPSPVFTIDIMNEGIKA-----LEEINKSMGLAMDEWDLLYYHDIFVNIMHRNPSNVECFDLAQSNSEHSRHWFFKGQMIIDGVEMEQSLFDILTETQKYSNQNNVIAFSDNSSAIKGFTTPILYINDPAYPSVYEIKDSFQNVCFTAETHNXXXXXXXXXXXXXXXXXRIRDIQAVGMGGYVVAGTAGYCFGNLRLPYYTLPWETDPCFKYPSNFAQASKIVIEASNGASDYGNEFGEPVINGFCRSF--GMITHSG--EWKEWIKPIMFSGGIGQLSSLHVNKSSP-NVNQLVIKXXXXXXXXXXXXXAASSVEIQGDSSRDKELDLGAVQRGDAQMENKMNRVIRGCIDLRDLNPIKSIHDQGAGGNGNVLKELV--DPLGAIIDASNFTLGDPTINLLELWGAEYQESNGLLIDERHLDQFKKICDRERCPINVVGKVTGDGNIRLINSVALEEELDPSMPYIVDLDLSVVLGKMPKKKFYLKHVEKILSPLKLP-LNLQ----VEDALSRVLRLPSVGSKRFLTNKVDRSVSGLVAQQQCVGPLHTPLADVAIVALSYFDIV---GAATAIGEQPIKMLINVKEGAKLCVIEALTNLCMIPVTSFEDIKVSGNWMWPAKLPGEGAALWDACNAF-CSLLKDLKIAIDGGKDSLSMAATVNDNTVVKSPGSLVVSAYVCCPDIRLAVTPDL---KGDGSLIWIRMNSQYR---LGGSALAQVYCQLGDKCPEFDNVGLFKKSWNCLQKIFMEK--LASAAHDISDGGLIGCLLEMAFAGNVGIDVIINASIADCDASNSSAEISILFNEETGWIIEVPNNYLST---VINDLESNELLFSLIGHSCKRYEVTPTVTLTVNELNIFSNFKLGEFRTMWEDTSYHLEKLQCNTECVNKEYQFYGNPN-------ITSNPFVISDSWLKPYNKINSKVFRVAILREEGSNGDREMAAAFIKSGFETWDITMQDLLSDLITLEEFNGLIFVGGFSFGDVLGSAKGWAAAIKYNEKIKKKFQN-FKIREDTFSLGVCNGCQLMTWLGWLNDSHSLDNCEMKRDIILSHNDSNRFESRFSVVSIPQ-----NTKSIMLSRLLGARLGVWVAHGEGKFEFT-NQEFCSQALSDGLIALNYVNLDATNDDVVNYPFNPNGSISNVAGLCSKDGRHLAIMPHPER--SFMWWQWAYTGDLDVSTEVSPWMCIFNSAYEWV 4081
            I + PR    +P S+ A  I    G  + + R E      I  +  F      LL   NDI +K ++D+MT+  Y   P    S   +  P P+  + +  +  K      L + N  +GLA+D  ++ Y    FV  M R+P++VE F  AQ NSEH RH  F     IDG++ + +LF ++  T K + +  + A+SDN++ +        +  +         K+    +    ETHN PT V+PFPGAATG+GG IRD  A G G     G +G+   +L +P    PWE +     P + A A  I+IEA  G++ + NEFG P ING+ R+    ++ H G  E + + KPIM +GG G +      K++P      +I +GG    IG+GGGAASSV   G+ S D  LD  +VQRG+ +ME +  +VI  C+ L + NPI+SIHD GAGG  N L ELV  + LGA  D       +P ++ +E+W  E QE   L +  + L  F++IC RER P  VVG  T +        + +E+ L  + P  +DL++ ++ GK PK        E I   L LP  NL     ++DA+ RVL LPSVGSK FL    DRSV+GL+ + Q VGP   P+ADV +   S  + +   G A A+GE+P+  LI+    AKL V E+L N+    V S   IK+S NWM PA   GEG+ L++A  A    L   L +AI  GKDS+SM    +D  V  +P SL ++A+    +     TP L     D  L+ + ++++     LG SAL QVY Q+G+K P   +  + K     L ++  +K  +  A HD SDGGL+  LLEMAFA   G+++ I       D  +  ++++ LFNEE G + ++    LS    ++N+    +   S++G    + +    +  T N++ I++N +  E    W  TSY ++KL+ N +   +E+    +         +T NP   +D  +K   +++S+  +VAILRE+G NG  EMA  F ++GF + D+TM DLL     L++F GL   GGFS+GDVLG+  GWA ++ Y+E ++ +F   F  R+DTF+ G CNGCQ ++ L  +     +  CE         N S ++E+R  +V I Q     + +S+ L+ + G++L + VAHGEGK  F+ + E   +   DGL  + YV  D   +    +PFNPNGS + +AG+ S +GR LA+MPHPER        W   G  +      PW+ +F SA  WV
Sbjct:  101 IRVVPRSGTISPWSSKATNIAHVCGLQDKVQRIERGLALLIKTVPGFP-----LLENLNDISLKCVYDRMTQQLYLTEPPNTMSIFTHEEPKPLVHVPLTPKDTKQSPKDILSKANTELGLALDSGEMEYLIHAFVETMKRDPTDVELFMFAQVNSEHCRHKIFNADWTIDGIKQQFTLFQMIRNTHKLNPEYTISAYSDNAAVLDSENDAFFFAPNSTTKEWTSTKERIP-LLIKVETHNHPTAVSPFPGAATGSGGEIRDEGATGRGSKTKCGLSGFSVSDLLIPGNEQPWELN--IGKPYHIASALDIMIEAPLGSAAFNNEFGRPCINGYFRTLTTKVLNHQGKEEIRGFHKPIMIAGGFGTVRPQFALKNTPITPGSCLIVLGGQSMLIGLGGGAASSV-ASGEGSAD--LDFASVQRGNPEMERRCQQVIDACVALGNNNPIQSIHDVGAGGLSNALPELVHDNDLGAKFDIRKVLSLEPGMSPMEIWCNESQERYVLGVSPQDLSIFEEICKRERAPFAVVGHATAE------QKLIVEDPLLKTTP--IDLEMPILFGKPPKMS-----RETITEALNLPEANLSEIPSLQDAIQRVLNLPSVGSKSFLITIGDRSVTGLIDRDQFVGPWQVPVADVGVTGTSLGETIISTGEAMAMGEKPVNALISASASAKLSVAESLLNIFAADVKSLNHIKLSANWMSPASHQGEGSKLYEAVQALGLDLCPALGVAIPVGKDSMSMKMKWDDKEVT-APLSLNITAFAPVFNTSKTWTPLLNRNTDDSVLVLVDLSAKQETKSLGASALLQVYNQVGNKSPTVYDNAILKGFLESLIQLHQQKEDIVLAYHDRSDGGLLITLLEMAFASRCGLEINI-------DGGDLESQLTNLFNEELGAVFQISAKNLSKFEKILNENGVAKEYISIVGKPSFQSQEIKIINSTTNDV-IYANSR-SELEQTWSKTSYEMQKLRDNPKTAEEEFASITDDRDPGLQYALTYNP---ADD-MKIGLELSSQRPKVAILREQGVNGQMEMAWCFQQAGFNSVDVTMTDLLEGRFHLDDFIGLAACGGFSYGDVLGAGAGWAKSVLYHEGVRSQFSKFFNERQDTFAFGACNGCQFLSRLKDI-----IPGCENWPS--FERNVSEQYEARVCMVQISQEKDNSSEESVFLNGMAGSKLPIAVAHGEGKATFSKSAEQLEKFEKDGLCCIRYV--DNYGNVTERFPFNPNGSTNGIAGIKSPNGRVLAMMPHPERVCRLEANSWYPEGKYEEWGGYGPWIRLFRSARRWV 1357          
BLAST of Phosphoribosylformylglycinamidine synthase vs. Ensembl Nematostella
Match: EDO49597 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFF5])

HSP 1 Score: 1233.78 bits (3191), Expect = 0.000e+0
Identity = 684/1369 (49.96%), Postives = 916/1369 (66.91%), Query Frame = 2
Query:  101 EVLHFYQIVSFSNKLKRNLVDNNL------LDGTIIATSEICYNIEIK-GXXXXXXXXXXXXXXITRSDNINDISSKPINFQLKKYNMS--------IEIGPRLNFCTPLSTNAVCILKSLGFNMISRFEISHIYHFSSENDN------LLSKRND-IIKNIHDKMTEMAYPHQINSFNLNVAPSPVFTIDIMNEGIKALEEINKSMGLAMDEWDLLYYHDIFVNIMHRNPSNVECFDLAQSNSEHSRHWFFKGQMIIDGVEMEQSLFDILTETQKYSNQNNVIAFSDNSSAIKGFTTPILYINDPAYPSVYEI-KDSFQNVCFTAETHNXXXXXXXXXXXXXXXXXRIRDIQAVGMGGYVVAGTAGYCFGNLRLPYYTLPWETDPCFKYPSNFAQASKIVIEASNGASDYGNEFGEPVINGFCRSFGMITHSGEWKEWIKPIMFSGGIGQLSSLHVNKSSPNVNQLVIKXXXXXXXXXXXXXAASSVEIQGDSSRDKELDLGAVQRGDAQMENKMNRVIRGCIDLRDLNPIKSIHDQGAGGNGNVLKELVDPLGAIIDASNFTLGDPTINLLELWGAEYQESNGLLIDERHLDQFKKICDRERCPINVVGKVTGDGNIRLINSVALEEE--LDPSMP-------YIVDLDLSVVLGKMPKKKFYLKHVEKILSPLKLPLNLQVEDALSRVLRLPSVGSKRFLTNKVDRSVSGLVAQQQCVGPLHTPLADVAIVALSYFDIVGAATAIGEQPIKMLINVKEGAKLCVIEALTNLCMIPVTSFEDIKVSGNWMWPAKLPGEGAALWDACNAFCSLLKDLKIAIDGGKDSLSMAATVNDNTVVKSPGSLVVSAYVCCPDIRLAVTPDLK---GDGSLIWIRMNSQ-YRLGGSALAQVYCQLGDKCPEFDNVGLFKKSWNCLQKIFMEKLASAAHDISDGGLIGCLLEMAFAGNVGIDVIINASIADCDASNSSAEISILFNEETGWIIEVPNNYLSTVINDLESNELLFSLIGHSCKRYEVTPTVTLTVNELNIFSNFKLGEFRTMWEDTSYHLEKLQCNTECVNKEYQFYGNPNITSNPFVISDSWLKPYNKINSKVFRVAILREEGSNGDREMAAAFIKSGFETWDITMQDLLSDLITLEEFNGLIFVGGFSFGDVLGSAKGWAAAIKYNEKIKKKFQNFKIREDTFSLGVCNGCQLMTWLGWLNDSHSLDNCEM---KRDIILSHNDSNRFESRFSVVSIPQNTKSIMLSRLLGARLGVWVAHGEGKFEFTNQEFCSQALSDGLIALNYVNLDATNDDVVNYPFNPNGSISNVAGLCSKDGRHLAIMPHPERSFMWWQWAYTG-DLDVSTEVSPWMCIFNSAYEWVEK 4087
            +++ FYQ+   S   K  +V + L      ++ T +AT EIC+N+ I+ G EL+ D+++ L WL ++S    +++ +  +F ++K            IEIGPRLNF T  STNAV I  SLG   + R E S  Y   ++  N      L  K    ++  +HD+MT+  Y   I +F ++  P P + +D+M  G  ALE++NK +GLA DEWDL YY  +F   + RNP++VECFDLAQSNSEHSRHWFF G++++DG E+++SL  ++ +TQ  SN NNVI FSDNSS+IKG+  P+L  ++PA  S + + +D+ +++ F+AETHNFPTGVAPFPGA TGTGGRIRD+QA G G +V+AGTAGYCFGNL++P Y LPWE DP   YP+N A A ++ IEASNGASDYGN+FGEPV+ GF RSFGM   +GE +EW+KPIMFSGG+G + +  V K +P     V+KIGGP YRIGVGGGAASS+++QGD+    ELD GAVQRGDA+ME K+NR IR C+++   NPI SIHDQGAGGNGNVLKE+ +P GA+I   +F LGDPT++++ELWGAEYQESN LL+      + + I  RE+ P++ VG +TGDG I L +  + EE   LD S+        Y VDL+L VVLGKMPKK F L HV  +L PL LP  L V +AL RVLRLPSV SKR+LTNKVDRSV+GL+AQQQCVGPLHTP+A VA+ ALS+F  VG+ATA+GEQPIK L++   GA++ V EALTNL    +T  +D+K SGNWMW AKLPGEGAAL+D C A C ++ +L IA+DGGKDSLSMAA V  +T VK+PG+LVVS Y  CPD+ L VTPDLK   G+G+L+++RM ++ +RLGGSALAQVY Q+GD  P+ DN  LF  ++N  Q++  +KL ++ HD+SDGGL+  LLEMAFAGN G+D   N  +      +S A I +LF EE G ++EV    +  V N  + N +   +IG +    E +  + + V+   +  + K+   R +WE+TS+ LE LQ N  CV  E     +            + + P    ++   +VA++REEGSNGDREM A+F  +GF+ WD+TM D+    +TL+ F G++FVGGFS+ DVLGSAKGWAA  + N   K +F+ F  R+DTFSLG+CNGCQLM  LGW+    + +  +     + +  +HN S RFESRF  V+I +++ ++ML  L G+ LGVWVAHGEG+ +F   E     +S  L  + YV+ D   +    YP NPNGS   +AGLCS DGRHLA+MPHPER  + WQWA+   +   S   SPW+ +F +AYEW  K
Sbjct:    4 KIIRFYQVPGLSTG-KHEVVLSKLRAAIPRVEITKLAT-EICFNVSIQDGCELEADKVEHLEWLFSKSFERENLT-RDTSFSVEKIEAEQPASRCVVIEIGPRLNFSTANSTNAVSICHSLGLKKVDRIEQSVRYLIQTKPRNEDDEKPLTDKEEQTLVSKLHDRMTQCRYTKPITTFEIDFHPEPCYDVDVMEGGRGALEKVNKDLGLAFDEWDLNYYTKLFKEKVGRNPTSVECFDLAQSNSEHSRHWFFCGRLVVDGQEIDKSLMRMVKDTQITSNDNNVIKFSDNSSSIKGYQVPLLIPDEPATASKFHLSEDTTRHIIFSAETHNFPTGVAPFPGATTGTGGRIRDVQAAGRGAHVIAGTAGYCFGNLQIPGYKLPWE-DPDLVYPNNMAPALEVAIEASNGASDYGNKFGEPVLAGFARSFGMRMPNGERREWVKPIMFSGGLGTIDAHSVTKLAPEKGMEVVKIGGPAYRIGVGGGAASSIQVQGDNI--SELDFGAVQRGDAEMEQKLNRAIRACLEMGKRNPICSIHDQGAGGNGNVLKEICEPAGAVIRVKDFILGDPTLSVMELWGAEYQESNALLVRAEDAAKLRTISSREKVPVSFVGTITGDGRIVLEDDNSSEENGMLDTSLAKRQKTTKYPVDLELDVVLGKMPKKVFTLDHVSPMLQPLSLPQGLTVAEALRRVLRLPSVASKRYLTNKVDRSVTGLIAQQQCVGPLHTPVAGVAVTALSHFHTVGSATAVGEQPIKCLVDPGCGARMTVGEALTNLVFAKITDLKDVKCSGNWMWAAKLPGEGAALYDTCKAMCGVMAELGIAVDGGKDSLSMAARVGSDT-VKAPGALVVSVYAACPDVCLTVTPDLKLPGGNGTLLYVRMGAEGWRLGGSALAQVYQQIGDVSPDMDNPQLFISAFNTTQELLSQKLITSGHDVSDGGLVTTLLEMAFAGNCGLDT--NIPVTSWTPQHSKA-IDVLFAEELGLVLEVKPENVEAVQNAYQRNGVCCLVIGKTAGLGEGS-GILIKVDGETVLED-KMVALRDLWEETSFQLELLQSNPSCVEIEKAGLKHRKAPEYNLTFEPTAVTPIEDRDN-CPKVAVIREEGSNGDREMVASFYMAGFQVWDVTMNDICRGDVTLDGFRGVVFVGGFSYADVLGSAKGWAAVCQINPTAKAQFEAFLARDDTFSLGICNGCQLMALLGWVGSEDTGETPKFASPSQGVCFTHNISERFESRFVTVTI-ESSPALMLQGLEGSSLGVWVAHGEGRAQFVRPEVLDNVVSKNLAPVRYVDDDG--NITTQYPLNPNGSPLGIAGLCSPDGRHLAMMPHPERCTLPWQWAWMPEEWRGSMSTSPWLRMFQNAYEWCVK 1356          
BLAST of Phosphoribosylformylglycinamidine synthase vs. Ensembl Medaka
Match: pfas (phosphoribosylformylglycinamidine synthase [Source:NCBI gene;Acc:101156076])

HSP 1 Score: 1228 bits (3176), Expect = 0.000e+0
Identity = 687/1337 (51.38%), Postives = 869/1337 (65.00%), Query Frame = 2
Query:   98 MEVLHFYQIVSFSNKLKRNLVDNNLLDGTIIATSEICYNIEIKGXXXXXXXXXXXXXXITRSDNINDISSKPINFQLKKYNMSIEIGPRLNFCTPLSTNAVCILKSLGFNMISRFEISHIYHFSSENDN----LLSKRNDIIKNIHDKMTEMAYPHQINSFNLNVAPSPVFTIDIMNEGIKALEEINKSMGLAMDEWDLLYYHDIFVNIMHRNPSNVECFDLAQSNSEHSRHWFFKGQMIIDGVEMEQSLFDILTETQKYSNQNNVIAFSDNSSAIKGFTTPILYINDPAYPSVYEIKDSFQNVCFTAETHNXXXXXXXXXXXXXXXXXRIRDIQAVGMGGYVVAGTAGYCFGNLRLPYYTLPWET-DPCFKYPSNFAQASKIVIEASNGASDYGNEFGEPVINGFCRSFGMITHSGEWKEWIKPIMFSGGIGQLSSLHVNKSSPNVNQLVIKXXXXXXXXXXXXXAASSVEIQGDSSRDKELDLGAVQRGDAQMENKMNRVIRGCIDLRDLNPIKSIHDQGAGGNGNVLKELVDPLGAIIDASNFTLGDPTINLLELWGAEYQESNGLLIDERHLDQFKKICDRERCPINVVGKVTGDGNIRLINSVALEEELDPSMPYIVDLDLSVVLGKMPKKKFYLKHVEKILSPLKLPLNLQVEDALSRVLRLPSVGSKRFLTNKVDRSVSGLVAQQQCVGPLHTPLADVAIVALSYFDIVGAATAIGEQPIKMLINVKEGAKLCVIEALTNLCMIPVTSFEDIKVSGNWMWPAKLPGEGAALWDACNAFCSLLKDLKIAIDGGKDSLSMAATVNDNTVVKSPGSLVVSAYVCCPDIRLAVTPDLK---GDGSLIWIRMN-SQYRLGGSALAQVYCQLGDKCPEFDNVGLFKKSWNCLQKIFMEKLASAAHDISDGGLIGCLLEMAFAGNVGIDVIINASIADCDASNSSAEISILFNEETGWIIEVPNNYLSTVINDLESNELLFSLIGHSCKRYEVTPTVTLTVNELNIFSNFKLGEFRTMWEDTSYHLEKLQCNTECVNKEYQFYGNPNITSNPFVISDSWLKPYNKINSKVFRVAILREEGSNGDREMAAAFIKSGFETWDITMQDLLSDLITLEEFNGLIFVGGFSFGDVLGSAKGWAAAIKYNEKIKKKFQNFKIREDTFSLGVCNGCQLMTWLGWLNDSHSLDNCEMKRDIILSHNDSNRFESRFSVVSIPQNTKSIMLSRLLGARLGVWVAHGEGKFEFTNQEFCSQALSDGLIALNYVNLDATNDDVVNYPFNPNGSISNVAGLCSKDGRHLAIMPHPERSFMWWQWAYTG-DLDVSTEVSPWMCIFNSAYEW 4078
            M V+ FY   S      R L     L   +  T+E+CYN+E+ G E    + + +L  + R     +  S+  N         +EIGPRLNF T  STNAV I +S G   ++R E+S  +    +N      L      +I  +HD MTE  Y   I SF +     PVF +DI+ +G  ALE+ N  +GLA D WDL YY  +F  I  RNP++VECFDLAQSNSEHSRHWFF+G+M+IDG E +++LF ++ +TQ++SN NNVI F DNSS IKG     +Y  DP+  S YE + S ++V FTAETHNFPTGVAPF GA TGTGGRIRD+Q+ G GG+V+AGTAGYCFGNL +P Y LPWE+    ++YPS+FA   ++ IEAS+GASDYGN+FGEPV++GF RSFGM   +GE +EWIKPIMFSGG+G +   HV K   +    V+KIGGPVYRIGVGGGAASSV+IQGD+  ++  DLGAVQRGDA+ME KMNR +R C++  D NPI SIHDQGAGGNGNVLKEL +P GA+I +S F  GDPT+++LELWGAEYQESN LL+        + +C RE+CP++ VG +TGDG I L++      +   S+ + VDL L  VLGKMP+K+F L+ V     PL+LP  L V DAL RVLRLPSV SKR+LTNKVDRSV+GLVAQQQCVGPLHTPLADVA+VALS F + GAATAIGEQPIK L+    GA++ V EALTNL    VT+ +D+K SGNWMW AKLPGEGA LW+AC A C ++ +L +AIDGGKDSLSMAA V   T VK+PG+LV+SAY  CPDI   VTPDL+   G G L+W+ ++   +RLGGSALAQ Y QL D  P+ D+  L    ++  Q +  +++ SA HDISDGGLI CLLEMAFAGN GID+ ++        S  S  + +LF+EE G ++EV    +  V        +    IG +C  +     V + V+   +     L E R  WEDTS+ LE LQ N  CV +E +                S      ++     RVA++REEGSNGDREM+A+   + FE WD+TMQDL    +TLE F  ++FVGGFS+ DVLGSAKGWAAA  YN K K +F  F+ REDT SLGVCNGCQL+  LGW+ ++      E    ++L+HN S RFESRF  V I Q + SI L  + G+ LGVWVAHGEG  +F +       +S GL  L Y  LD        YP NPNGS   VAGLCS+DGRHLA+MPHPER  + WQW +   +L  S   SPW+ +F +A  W
Sbjct:    1 MAVVRFY---SSEAPDGRALQRAAKLFPHLTLTTELCYNVELTGRESLSAEEKEVLLWLFRPPLQAEPLSENPNLIESSEEKLVEIGPRLNFSTAWSTNAVSICRSAGLTNVTRVEVSRRFLVKPKNGKGTGELSGDMKKLIDCLHDSMTECVYHRPITSFAVETKRQPVFEVDILAKGRAALEKANDDLGLAFDSWDLDYYTSMFQRI-QRNPTSVECFDLAQSNSEHSRHWFFRGRMLIDGQEQKETLFSLIMDTQRHSNPNNVIKFCDNSSGIKGVEIECVYPKDPSRASPYETRLSLRHVIFTAETHNFPTGVAPFSGATTGTGGRIRDVQSAGRGGHVIAGTAGYCFGNLHIPGYELPWESAGEEWEYPSSFAPPLQVAIEASDGASDYGNKFGEPVLSGFARSFGMRLPNGERREWIKPIMFSGGLGSIEDSHVKKEEASPGMEVVKIGGPVYRIGVGGGAASSVQIQGDNCSER--DLGAVQRGDAEMEQKMNRALRACLERSDGNPICSIHDQGAGGNGNVLKELSEPAGAVIYSSRFKKGDPTLSVLELWGAEYQESNALLLHPSDRSFLESVCQREKCPVDFVGNITGDGKIVLVDDEGGSNDQVDSVRHPVDLQLEWVLGKMPQKEFRLERVALACQPLRLPAGLSVRDALQRVLRLPSVASKRYLTNKVDRSVTGLVAQQQCVGPLHTPLADVAVVALSPFSLEGAATAIGEQPIKGLVCPAAGARMAVGEALTNLMFARVTALKDVKCSGNWMWAAKLPGEGAYLWEACKAMCKVMSELGVAIDGGKDSLSMAARVGKET-VKAPGALVISAYAVCPDISATVTPDLEDPDGKGVLLWVPLSPGNHRLGGSALAQCYGQLADCSPDLDHAELLTACFSTTQTLLQDRIVSAGHDISDGGLISCLLEMAFAGNRGIDIELS--------SQGSEVMELLFSEELGVVLEVSECDVEAVCQRYSDAGVQCHRIGRTCG-FGPKAEVRVCVDGQEVLKE-SLPELRAAWEDTSFQLECLQANELCVKQEEEGLAKRTQPYFQLNFDPSESPSVRRLAGGPPRVAVIREEGSNGDREMSASLYMADFEVWDVTMQDLCCGSLTLELFKAVVFVGGFSYADVLGSAKGWAAAATYNAKAKAEFDRFQQREDTLSLGVCNGCQLLALLGWVGETADGAGSE----VVLTHNRSGRFESRFVSVGI-QESPSIWLRGMEGSALGVWVAHGEGLMQFRSSMAQDLIISGGLAPLRY--LDEQGFPTEEYPLNPNGSPQGVAGLCSRDGRHLAMMPHPERCTLSWQWPWAPRELRPSLVPSPWLRMFKNAAAW 1313          
BLAST of Phosphoribosylformylglycinamidine synthase vs. Planmine SMEST
Match: SMESG000028663.1 (SMESG000028663.1)

HSP 1 Score: 2624.35 bits (6801), Expect = 0.000e+0
Identity = 1323/1331 (99.40%), Postives = 1328/1331 (99.77%), Query Frame = 2
Query:   98 MEVLHFYQIVSFSNKLKRNLVDNNLLDGTIIATSEICYNIEIKGXXXXXXXXXXXXXXITRSDNINDISSKPINFQLKKYNMSIEIGPRLNFCTPLSTNAVCILKSLGFNMISRFEISHIYHFSSENDNLLSKRNDIIKNIHDKMTEMAYPHQINSFNLNVAPSPVFTIDIMNEGIKALEEINKSMGLAMDEWDLLYYHDIFVNIMHRNPSNVECFDLAQSNSEHSRHWFFKGQMIIDGVEMEQSLFDILTETQKYSNQNNVIAFSDNSSAIKGFTTPILYINDPAYPSVYEIKDSFQNVCFTAETHNXXXXXXXXXXXXXXXXXRIRDIQAVGMGGYVVAGTAGYCFGNLRLPYYTLPWETDPCFKYPSNFAQASKIVIEASNGASDYGNEFGEPVINGFCRSFGMITHSGEWKEWIKPIMFSGGIGQLSSLHVNKSSPNVNQLVIKXXXXXXXXXXXXXAASSVEIQGDSSRDKELDLGAVQRGDAQMENKMNRVIRGCIDLRDLNPIKSIHDQGAGGNGNVLKELVDPLGAIIDASNFTLGDPTINLLELWGAEYQESNGLLIDERHLDQFKKICDRERCPINVVGKVTGDGNIRLINSVALEEELDPSMPYIVDLDLSVVLGKMPKKKFYLKHVEKILSPLKLPLNLQVEDALSRVLRLPSVGSKRFLTNKVDRSVSGLVAQQQCVGPLHTPLADVAIVALSYFDIVGAATAIGEQPIKMLINVKEGAKLCVIEALTNLCMIPVTSFEDIKVSGNWMWPAKLPGEGAALWDACNAFCSLLKDLKIAIDGGKDSLSMAATVNDNTVVKSPGSLVVSAYVCCPDIRLAVTPDLKGDGSLIWIRMNSQYRLGGSALAQVYCQLGDKCPEFDNVGLFKKSWNCLQKIFMEKLASAAHDISDGGLIGCLLEMAFAGNVGIDVIINASIADCDASNSSAEISILFNEETGWIIEVPNNYLSTVINDLESNELLFSLIGHSCKRYEVTPTVTLTVNELNIFSNFKLGEFRTMWEDTSYHLEKLQCNTECVNKEYQFYGNPNITSNPFVISDSWLKPYNKINSKVFRVAILREEGSNGDREMAAAFIKSGFETWDITMQDLLSDLITLEEFNGLIFVGGFSFGDVLGSAKGWAAAIKYNEKIKKKFQNFKIREDTFSLGVCNGCQLMTWLGWLNDSHSLDNCEMKRDIILSHNDSNRFESRFSVVSIPQNTKSIMLSRLLGARLGVWVAHGEGKFEFTNQEFCSQALSDGLIALNYVNLDATNDDVVNYPFNPNGSISNVAGLCSKDGRHLAIMPHPERSFMWWQWAYTGDLDVSTEVSPWMCIFNSAYEWVEKL 4090
            MEVLHFYQIVSFSNKLKRNLVDNNLLDGTIIATSEICYNIEIKGDELDEDQLQRLLWLITRSDNINDISSKPINFQLKKYNMSIEIGPRLNFCTPLSTNAVCILKSLGFNMI+RFEISHIYHFSSENDNLLSKRNDIIKNIHDKMTEMAYPHQINSFNLNVAPSPVFTIDIMNEGIKALEEINKSMGLAMDEWDLLYYHDIFVNIM RNPSNVECFDLAQSNSEHSRHWFFKGQMIIDGVEMEQSLFD+LTETQKYSNQNNVIAFSDNSSAIKGFTTPILYI DPAYPSVYEIKDSFQNVCFTAETHNFPTGVAPFPGAATGTGGRIRDIQAVGMGGYVVAGTAGYCFGNLRLPYYTLPWETDPCFKYPSNFAQASKIVIEASNGASDYGNEFGEPVINGFCRSFGMITHSGEWKEWIKPIMFSGGIGQLSSLHVNKSSPNVNQLVIKIGGPVYRIGVGGGAASSVEIQGDSSRDKELDLGAVQRGDAQMENKMNRVIRGCIDLRDLNPIKSIHDQGAGGNGNVLKELVDPLGAIIDASNFTLGDPTINLLELWGAEYQESNGLLIDERHLDQFKKICDRERCPINVVGKVTGDGNIRLINSVALEEELDPSMPYIVDLDL+VVLGKMPKKKFYLKHVEKILSPLKLPLNLQVEDALSRVLRLPSVGSKRFLTNKVDRSVSGL+AQQQCVGPLHTPLADVAIVALSYFDIVGAATAIGEQPIKMLINVKEGAKLCVIEALTNLCMIPVTSFEDIKVSGNWMWPAKLPGEGAALWDACNAFCSLLKDLKIAIDGGKDSLSMAATVNDNTVVKSPGSLVVSAYVCCPDIRLAVTPDLKGDGSLIWIRMNSQYRLGGSALAQVYCQLGDKCPEFDNVGLFKKSWNCLQKIFMEKLASAAHDISDGGLIGCLLEMAFAGNVGIDV INASIADCDASNSSAEISILFNEETGWIIEVPNNYLSTVINDLESNELLFSLIGHSCKRYEVTPTVTLTVNELNIFSNFKLGEFRTMWEDTSYHLEKLQCNTECVNKEYQFYGNPNITSNPFVISDSWLKPYNKINSKVFRVAILREEGSNGDREMAAAFIKSGFETWDITMQDLLSDLITLEEFNGLIFVGGFSFGDVLGSAKGWAAAIKYNEKIKKKFQNFKIREDTFSLGVCNGCQLMTWLGWLNDSHSLD+CEMKRDIILSHNDSNRFESRFSVVSIPQNTKSIMLSRLLGARLGVWVAHGEGKFEFTNQEFCSQALSDGLIALNYVNLDATNDDVVNYPFNPNGSISNVAGLCSKDGRHLAIMPHPERSFMWWQWAYTGDLDVSTEVSPWMCIFNSAYEWVEKL
Sbjct:    1 MEVLHFYQIVSFSNKLKRNLVDNNLLDGTIIATSEICYNIEIKGDELDEDQLQRLLWLITRSDNINDISSKPINFQLKKYNMSIEIGPRLNFCTPLSTNAVCILKSLGFNMINRFEISHIYHFSSENDNLLSKRNDIIKNIHDKMTEMAYPHQINSFNLNVAPSPVFTIDIMNEGIKALEEINKSMGLAMDEWDLLYYHDIFVNIMQRNPSNVECFDLAQSNSEHSRHWFFKGQMIIDGVEMEQSLFDMLTETQKYSNQNNVIAFSDNSSAIKGFTTPILYITDPAYPSVYEIKDSFQNVCFTAETHNFPTGVAPFPGAATGTGGRIRDIQAVGMGGYVVAGTAGYCFGNLRLPYYTLPWETDPCFKYPSNFAQASKIVIEASNGASDYGNEFGEPVINGFCRSFGMITHSGEWKEWIKPIMFSGGIGQLSSLHVNKSSPNVNQLVIKIGGPVYRIGVGGGAASSVEIQGDSSRDKELDLGAVQRGDAQMENKMNRVIRGCIDLRDLNPIKSIHDQGAGGNGNVLKELVDPLGAIIDASNFTLGDPTINLLELWGAEYQESNGLLIDERHLDQFKKICDRERCPINVVGKVTGDGNIRLINSVALEEELDPSMPYIVDLDLNVVLGKMPKKKFYLKHVEKILSPLKLPLNLQVEDALSRVLRLPSVGSKRFLTNKVDRSVSGLIAQQQCVGPLHTPLADVAIVALSYFDIVGAATAIGEQPIKMLINVKEGAKLCVIEALTNLCMIPVTSFEDIKVSGNWMWPAKLPGEGAALWDACNAFCSLLKDLKIAIDGGKDSLSMAATVNDNTVVKSPGSLVVSAYVCCPDIRLAVTPDLKGDGSLIWIRMNSQYRLGGSALAQVYCQLGDKCPEFDNVGLFKKSWNCLQKIFMEKLASAAHDISDGGLIGCLLEMAFAGNVGIDVKINASIADCDASNSSAEISILFNEETGWIIEVPNNYLSTVINDLESNELLFSLIGHSCKRYEVTPTVTLTVNELNIFSNFKLGEFRTMWEDTSYHLEKLQCNTECVNKEYQFYGNPNITSNPFVISDSWLKPYNKINSKVFRVAILREEGSNGDREMAAAFIKSGFETWDITMQDLLSDLITLEEFNGLIFVGGFSFGDVLGSAKGWAAAIKYNEKIKKKFQNFKIREDTFSLGVCNGCQLMTWLGWLNDSHSLDDCEMKRDIILSHNDSNRFESRFSVVSIPQNTKSIMLSRLLGARLGVWVAHGEGKFEFTNQEFCSQALSDGLIALNYVNLDATNDDVVNYPFNPNGSISNVAGLCSKDGRHLAIMPHPERSFMWWQWAYTGDLDVSTEVSPWMCIFNSAYEWVEKL 1331          
The following BLAST results are available for this feature:
BLAST of Phosphoribosylformylglycinamidine synthase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
PFAS0.000e+050.75phosphoribosylformylglycinamidine synthase [Source... [more]
PFAS7.697e-7741.46phosphoribosylformylglycinamidine synthase [Source... [more]
PFAS4.485e-2767.07phosphoribosylformylglycinamidine synthase [Source... [more]
PFAS6.264e-841.51phosphoribosylformylglycinamidine synthase [Source... [more]
back to top
BLAST of Phosphoribosylformylglycinamidine synthase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
pfas-10.000e+046.59Probable phosphoribosylformylglycinamidine synthas... [more]
back to top
BLAST of Phosphoribosylformylglycinamidine synthase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Pfas0.000e+046.38gene:FBgn0000052 transcript:FBtr0079221[more]
Pfas0.000e+046.38gene:FBgn0000052 transcript:FBtr0079220[more]
Pfas0.000e+046.38gene:FBgn0000052 transcript:FBtr0079219[more]
back to top
BLAST of Phosphoribosylformylglycinamidine synthase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
pfas0.000e+049.93phosphoribosylformylglycinamidine synthase [Source... [more]
back to top
BLAST of Phosphoribosylformylglycinamidine synthase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pfas0.000e+051.19phosphoribosylformylglycinamidine synthase [Source... [more]
pfas0.000e+052.65phosphoribosylformylglycinamidine synthase [Source... [more]
pfas0.000e+052.69phosphoribosylformylglycinamidine synthase [Source... [more]
pfas0.000e+050.74phosphoribosylformylglycinamidine synthase [Source... [more]
pfas0.000e+052.05phosphoribosylformylglycinamidine synthase [Source... [more]
back to top
BLAST of Phosphoribosylformylglycinamidine synthase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Pfas0.000e+049.41phosphoribosylformylglycinamidine synthase (FGAR a... [more]
Pfas1.452e-10340.37phosphoribosylformylglycinamidine synthase (FGAR a... [more]
Pfas4.372e-2767.07phosphoribosylformylglycinamidine synthase (FGAR a... [more]
back to top
BLAST of Phosphoribosylformylglycinamidine synthase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5SUR0|PUR4_MOUSE0.000e+049.41Phosphoribosylformylglycinamidine synthase OS=Mus ... [more]
sp|O15067|PUR4_HUMAN0.000e+050.75Phosphoribosylformylglycinamidine synthase OS=Homo... [more]
sp|P35421|PUR4_DROME0.000e+046.38Phosphoribosylformylglycinamidine synthase OS=Dros... [more]
sp|Q9M8D3|PUR4_ARATH0.000e+047.20Probable phosphoribosylformylglycinamidine synthas... [more]
sp|Q54JC8|PUR4_DICDI0.000e+048.18Phosphoribosylformylglycinamidine synthase OS=Dict... [more]
back to top
BLAST of Phosphoribosylformylglycinamidine synthase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3B3WI830.000e+051.23Phosphoribosylformylglycinamidine synthase OS=Poec... [more]
A0A3B5R4I60.000e+051.45Phosphoribosylformylglycinamidine synthase OS=Xiph... [more]
A0A3Q1J1K80.000e+051.16Phosphoribosylformylglycinamidine synthase OS=Anab... [more]
A0A087Y6E00.000e+051.04Phosphoribosylformylglycinamidine synthase OS=Poec... [more]
B5DEE80.000e+051.26Glutamine amidotransferase type-1 domain-containin... [more]
back to top
BLAST of Phosphoribosylformylglycinamidine synthase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
pfas0.000e+050.15phosphoribosylformylglycinamidine synthase [Source... [more]
pfas0.000e+050.71phosphoribosylformylglycinamidine synthase [Source... [more]
back to top
BLAST of Phosphoribosylformylglycinamidine synthase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000002087.12.975e-6843.27pep scaffold:Pmarinus_7.0:GL485690:1046:10953:1 ge... [more]
back to top
BLAST of Phosphoribosylformylglycinamidine synthase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
ADE60.000e+035.12Formylglycinamidine-ribonucleotide (FGAM)-syntheta... [more]
back to top
BLAST of Phosphoribosylformylglycinamidine synthase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO495970.000e+049.96Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Phosphoribosylformylglycinamidine synthase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
pfas0.000e+051.38phosphoribosylformylglycinamidine synthase [Source... [more]
back to top
BLAST of Phosphoribosylformylglycinamidine synthase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000028663.10.000e+099.40SMESG000028663.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028144 ID=SMED30028144|Name=Phosphoribosylformylglycinamidine synthase|organism=Schmidtea mediterranea sexual|type=transcript|length=4205bp
TGTTAATGTGATTTTTTTCAACATTAGATTTAGCGTTATCGCTTTAGTCA
GATTTTGTAAAATTAACTTCTGAAATTATTTCATTTAATATTTCACCATG
GAAGTTCTTCATTTTTACCAAATCGTTTCGTTTTCTAACAAACTTAAAAG
AAATTTAGTTGATAATAATCTTTTGGATGGCACTATTATTGCCACTTCAG
AAATATGTTATAATATTGAAATAAAAGGAGATGAACTAGATGAAGATCAA
CTTCAAAGATTATTGTGGTTAATTACAAGATCAGATAATATTAACGATAT
TTCTTCAAAACCAATTAATTTTCAGTTAAAGAAATACAATATGAGCATTG
AGATTGGACCTAGATTAAATTTCTGTACTCCTTTAAGTACTAACGCAGTA
TGTATTTTGAAAAGTCTGGGATTTAATATGATTAGTCGTTTTGAAATATC
TCATATTTATCATTTTTCTTCCGAAAACGATAATTTATTATCGAAAAGAA
ACGATATTATAAAAAATATTCATGATAAAATGACTGAAATGGCTTATCCA
CATCAAATAAATTCATTCAATTTAAATGTAGCCCCAAGTCCAGTTTTTAC
TATTGATATAATGAATGAAGGAATCAAAGCACTAGAAGAAATCAATAAGT
CAATGGGTTTGGCAATGGATGAATGGGATTTGCTGTATTATCATGATATT
TTCGTCAATATTATGCACCGTAATCCTTCAAATGTCGAATGTTTTGACCT
TGCCCAATCAAATAGCGAGCATTCCAGGCATTGGTTTTTTAAAGGCCAAA
TGATAATCGATGGCGTTGAAATGGAACAAAGTTTATTTGACATTCTCACC
GAAACACAAAAATACTCCAATCAAAATAATGTTATTGCATTCTCAGATAA
TAGTAGTGCTATTAAAGGATTTACGACTCCAATTCTATATATAAATGATC
CAGCCTATCCTTCAGTGTATGAAATAAAAGATTCCTTTCAAAATGTTTGT
TTCACTGCTGAAACACATAATTTTCCTACAGGAGTGGCCCCCTTTCCGGG
AGCAGCTACGGGAACTGGAGGAAGAATTCGAGATATTCAAGCCGTAGGAA
TGGGAGGGTACGTTGTTGCTGGTACAGCTGGATACTGTTTTGGTAATTTG
AGATTACCTTATTATACACTTCCATGGGAAACAGATCCATGCTTTAAATA
CCCCTCTAATTTTGCGCAAGCATCAAAAATAGTCATCGAAGCTAGCAATG
GAGCTAGTGACTATGGTAATGAATTTGGCGAACCAGTTATTAATGGGTTT
TGTCGATCTTTTGGCATGATTACCCATTCCGGAGAATGGAAAGAATGGAT
TAAGCCTATCATGTTTAGTGGTGGAATTGGACAACTATCGTCTTTGCATG
TTAACAAATCCAGTCCAAATGTTAATCAGTTAGTTATAAAAATTGGCGGT
CCCGTTTATCGAATCGGTGTTGGTGGGGGAGCTGCCAGTTCTGTTGAAAT
TCAAGGAGACAGTAGTAGAGATAAAGAATTGGATCTTGGTGCAGTCCAAA
GAGGTGATGCACAAATGGAAAATAAAATGAATCGAGTTATTAGAGGATGC
ATCGATCTGAGAGACCTAAATCCTATTAAATCTATACACGATCAAGGTGC
TGGTGGAAACGGAAATGTTTTAAAAGAATTGGTTGATCCTCTTGGCGCTA
TTATTGATGCTTCTAATTTTACGTTAGGAGATCCAACAATTAATCTACTT
GAATTATGGGGTGCCGAGTATCAAGAATCAAATGGCCTTTTAATTGATGA
AAGGCATTTAGATCAATTTAAAAAAATTTGTGATCGAGAAAGATGCCCAA
TAAATGTGGTTGGTAAAGTGACAGGTGATGGAAATATTCGGCTTATAAAT
TCTGTCGCACTTGAGGAAGAACTTGATCCATCTATGCCTTACATAGTTGA
TCTGGATTTAAGCGTAGTCCTTGGCAAAATGCCAAAGAAAAAGTTTTATT
TAAAACACGTGGAGAAGATTTTATCTCCTCTTAAATTACCTTTAAATCTT
CAAGTTGAAGATGCTCTTTCACGAGTTTTAAGATTACCATCAGTTGGAAG
TAAAAGGTTTTTGACAAATAAGGTAGATCGTTCTGTTAGTGGATTGGTTG
CCCAGCAGCAGTGTGTGGGTCCACTCCACACCCCTCTTGCTGACGTTGCG
ATTGTTGCTTTGTCATATTTTGATATTGTTGGCGCTGCCACTGCTATAGG
AGAGCAACCTATCAAAATGTTAATAAATGTGAAAGAAGGCGCGAAATTGT
GTGTTATCGAAGCATTAACAAATTTATGCATGATTCCTGTTACATCATTT
GAAGACATAAAGGTTAGTGGTAACTGGATGTGGCCAGCTAAATTACCAGG
AGAAGGTGCTGCTCTATGGGATGCTTGTAATGCATTTTGCAGCTTGCTTA
AGGATCTAAAAATAGCAATTGATGGCGGCAAAGACTCTTTAAGTATGGCA
GCTACAGTGAACGATAATACCGTAGTGAAGTCTCCAGGGTCCCTAGTAGT
ATCTGCATATGTTTGTTGTCCAGATATCCGACTTGCTGTAACTCCTGATT
TAAAAGGAGATGGATCATTGATATGGATTCGGATGAATAGCCAATATCGA
CTTGGAGGAAGCGCATTGGCTCAAGTTTATTGTCAATTGGGAGACAAATG
TCCTGAATTTGATAACGTTGGATTATTTAAAAAGTCATGGAACTGTTTAC
AGAAAATATTTATGGAAAAGCTGGCATCAGCAGCTCATGATATAAGTGAT
GGTGGATTAATCGGATGTCTGCTAGAAATGGCGTTTGCAGGCAACGTGGG
AATTGATGTGATAATTAATGCATCTATAGCTGACTGTGATGCCAGCAATT
CCTCTGCAGAAATTTCTATTTTGTTTAATGAAGAAACCGGGTGGATTATT
GAAGTTCCTAATAATTATTTATCCACGGTAATCAACGATTTGGAATCCAA
TGAATTATTATTTTCTCTTATCGGACATTCATGCAAACGATATGAAGTAA
CGCCGACAGTTACTTTAACAGTGAACGAATTAAATATATTTTCCAACTTT
AAATTAGGTGAATTTCGTACTATGTGGGAAGATACAAGTTACCATTTAGA
AAAATTACAATGTAATACAGAGTGTGTAAATAAAGAATATCAGTTTTATG
GAAATCCTAACATTACATCAAACCCATTTGTAATTAGCGATTCTTGGTTA
AAACCATATAACAAAATCAATTCAAAAGTTTTTCGTGTAGCTATTTTACG
GGAAGAAGGAAGTAATGGTGATCGTGAAATGGCTGCGGCTTTTATAAAAT
CTGGATTTGAAACTTGGGATATTACGATGCAAGATTTATTATCTGATTTA
ATTACTCTTGAAGAATTCAATGGACTAATATTTGTTGGTGGTTTCAGTTT
TGGTGATGTTCTCGGTTCTGCCAAAGGCTGGGCAGCTGCAATTAAATATA
ATGAAAAGATTAAAAAAAAATTTCAAAATTTCAAAATACGAGAAGACACA
TTTTCATTGGGTGTTTGCAATGGTTGCCAATTAATGACTTGGCTTGGTTG
GCTTAATGATTCGCATAGTTTGGATAATTGTGAAATGAAGCGAGATATTA
TTTTGTCGCACAATGATTCAAACCGATTTGAATCTCGATTTAGTGTTGTT
TCGATTCCACAAAATACTAAGTCGATAATGCTTTCAAGATTACTCGGTGC
CCGTTTAGGAGTTTGGGTCGCTCACGGTGAAGGCAAATTTGAATTTACCA
ATCAGGAATTTTGCTCGCAAGCCCTCAGCGATGGTTTAATAGCGCTAAAT
TACGTGAACTTGGATGCGACAAATGATGATGTAGTTAACTATCCATTCAA
TCCAAACGGTTCAATTTCCAATGTAGCCGGATTATGTTCCAAAGATGGTC
GTCACTTAGCAATAATGCCTCATCCAGAACGCAGTTTCATGTGGTGGCAA
TGGGCTTATACGGGGGATTTGGATGTCTCTACTGAAGTTTCACCTTGGAT
GTGCATTTTTAATAGTGCTTATGAGTGGGTTGAAAAGCTTTAATGTGGGA
TTTTTTTATAATTAGTGCAGTATTTTAGTCAAATTTTCTATGTATTTTTC
CCATTTATTACATTGTTTTTATTAATGTTTTGATTTTTAATAAAGTATTC
TTGAG
back to top

protein sequence of SMED30028144-orf-1

>SMED30028144-orf-1 ID=SMED30028144-orf-1|Name=SMED30028144-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1332bp
MEVLHFYQIVSFSNKLKRNLVDNNLLDGTIIATSEICYNIEIKGDELDED
QLQRLLWLITRSDNINDISSKPINFQLKKYNMSIEIGPRLNFCTPLSTNA
VCILKSLGFNMISRFEISHIYHFSSENDNLLSKRNDIIKNIHDKMTEMAY
PHQINSFNLNVAPSPVFTIDIMNEGIKALEEINKSMGLAMDEWDLLYYHD
IFVNIMHRNPSNVECFDLAQSNSEHSRHWFFKGQMIIDGVEMEQSLFDIL
TETQKYSNQNNVIAFSDNSSAIKGFTTPILYINDPAYPSVYEIKDSFQNV
CFTAETHNFPTGVAPFPGAATGTGGRIRDIQAVGMGGYVVAGTAGYCFGN
LRLPYYTLPWETDPCFKYPSNFAQASKIVIEASNGASDYGNEFGEPVING
FCRSFGMITHSGEWKEWIKPIMFSGGIGQLSSLHVNKSSPNVNQLVIKIG
GPVYRIGVGGGAASSVEIQGDSSRDKELDLGAVQRGDAQMENKMNRVIRG
CIDLRDLNPIKSIHDQGAGGNGNVLKELVDPLGAIIDASNFTLGDPTINL
LELWGAEYQESNGLLIDERHLDQFKKICDRERCPINVVGKVTGDGNIRLI
NSVALEEELDPSMPYIVDLDLSVVLGKMPKKKFYLKHVEKILSPLKLPLN
LQVEDALSRVLRLPSVGSKRFLTNKVDRSVSGLVAQQQCVGPLHTPLADV
AIVALSYFDIVGAATAIGEQPIKMLINVKEGAKLCVIEALTNLCMIPVTS
FEDIKVSGNWMWPAKLPGEGAALWDACNAFCSLLKDLKIAIDGGKDSLSM
AATVNDNTVVKSPGSLVVSAYVCCPDIRLAVTPDLKGDGSLIWIRMNSQY
RLGGSALAQVYCQLGDKCPEFDNVGLFKKSWNCLQKIFMEKLASAAHDIS
DGGLIGCLLEMAFAGNVGIDVIINASIADCDASNSSAEISILFNEETGWI
IEVPNNYLSTVINDLESNELLFSLIGHSCKRYEVTPTVTLTVNELNIFSN
FKLGEFRTMWEDTSYHLEKLQCNTECVNKEYQFYGNPNITSNPFVISDSW
LKPYNKINSKVFRVAILREEGSNGDREMAAAFIKSGFETWDITMQDLLSD
LITLEEFNGLIFVGGFSFGDVLGSAKGWAAAIKYNEKIKKKFQNFKIRED
TFSLGVCNGCQLMTWLGWLNDSHSLDNCEMKRDIILSHNDSNRFESRFSV
VSIPQNTKSIMLSRLLGARLGVWVAHGEGKFEFTNQEFCSQALSDGLIAL
NYVNLDATNDDVVNYPFNPNGSISNVAGLCSKDGRHLAIMPHPERSFMWW
QWAYTGDLDVSTEVSPWMCIFNSAYEWVEKL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0006541glutamine metabolic process
GO:0006189'de novo' IMP biosynthetic process
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR040707FGAR-AT_N
IPR010073PurL_large
IPR041609PurL_linker
IPR036921PurM-like_N_sf
IPR036676PurM-like_C_sf
IPR036604PurS-like_sf
IPR016188PurM-like_N
IPR029062Class_I_gatase-like
IPR010918PurM-like_C_dom
IPR017926GATASE
Vocabulary: molecular function
TermDefinition
GO:0004642phosphoribosylformylglycinamidine synthase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableSMARTSM01211GATase_5_2coord: 1061..1328
e-value: 1.6E-103
score: 359.9
NoneNo IPR availableGENE3DG3DSA:1.10.8.750coord: 161..222
e-value: 7.9E-20
score: 72.4
NoneNo IPR availablePFAMPF13507GATase_5coord: 1063..1328
e-value: 4.8E-92
score: 307.7
NoneNo IPR availablePANTHERPTHR10099:SF1PHOSPHORIBOSYLFORMYLGLYCINAMIDINE SYNTHASEcoord: 2..1328
NoneNo IPR availablePANTHERPTHR10099PHOSPHORIBOSYLFORMYLGLYCINAMIDINE SYNTHASEcoord: 2..1328
NoneNo IPR availableCDDcd02204PurL_repeat2coord: 699..977
e-value: 2.74217E-66
score: 223.181
NoneNo IPR availableCDDcd01740GATase1_FGAR_ATcoord: 1064..1325
e-value: 3.27065E-88
score: 284.122
NoneNo IPR availableCDDcd02203PurL_repeat1coord: 214..599
e-value: 5.20748E-118
score: 368.723
NoneNo IPR availableSUPERFAMILYSSF109736FGAM synthase PurL, linker domaincoord: 163..229
IPR040707Phosphoribosylformylglycinamidine synthase, N-terminalPFAMPF18076FGAR-AT_Ncoord: 37..152
e-value: 1.8E-10
score: 40.8
IPR010073Phosphoribosylformylglycinamidine synthase PurLTIGRFAMTIGR01735TIGR01735coord: 23..1328
e-value: 0.0
score: 1483.7
IPR010918PurM-like, C-terminal domainPFAMPF02769AIRS_Ccoord: 852..984
e-value: 8.0E-13
score: 48.8
coord: 444..599
e-value: 2.3E-20
score: 73.3
IPR029062Class I glutamine amidotransferase-likeGENE3DG3DSA:3.40.50.880coord: 1004..1329
e-value: 1.7E-108
score: 364.3
IPR029062Class I glutamine amidotransferase-likeSUPERFAMILYSSF52317Class I glutamine amidotransferase-likecoord: 1062..1328
IPR041609Phosphoribosylformylglycinamidine synthase, linker domainPFAMPF18072FGAR-AT_linkercoord: 179..228
e-value: 3.9E-9
score: 36.9
IPR036921PurM-like, N-terminal domain superfamilyGENE3DG3DSA:3.30.1330.10coord: 636..822
e-value: 3.6E-19
score: 71.0
IPR036921PurM-like, N-terminal domain superfamilyGENE3DG3DSA:3.30.1330.10coord: 223..427
e-value: 1.1E-36
score: 127.8
IPR036921PurM-like, N-terminal domain superfamilySUPERFAMILYSSF55326PurM N-terminal domain-likecoord: 230..437
IPR036921PurM-like, N-terminal domain superfamilySUPERFAMILYSSF55326PurM N-terminal domain-likecoord: 650..832
IPR036676PurM-like, C-terminal domain superfamilyGENE3DG3DSA:3.90.650.10coord: 824..996
e-value: 6.4E-22
score: 79.8
coord: 428..609
e-value: 1.6E-45
score: 156.9
IPR036676PurM-like, C-terminal domain superfamilySUPERFAMILYSSF56042PurM C-terminal domain-likecoord: 441..674
IPR036676PurM-like, C-terminal domain superfamilySUPERFAMILYSSF56042PurM C-terminal domain-likecoord: 833..1038
IPR017926Glutamine amidotransferasePROSITEPS51273GATASE_TYPE_1coord: 1063..1307
score: 13.258
IPR036604Phosphoribosylformylglycinamidine synthase subunit PurS-like superfamilySUPERFAMILYSSF82697PurS-likecoord: 28..159