beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3

Overview
Namebeta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3
Smed IDSMED30028115
Length (bp)1373
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 (SMED30028115) t-SNE clustered cells

Violin plots show distribution of expression levels for beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 (SMED30028115) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 (SMED30028115) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 (SMED30028115) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028115

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30028115SMESG000026549.1 dd_Smed_v4_10879_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30028115SMESG000026549.1 dd_Smed_v4_10879_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30028115SMESG000026549.1 dd_Smed_v4_10879_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30028115SMESG000026549.1 dd_Smed_v4_10879_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30028115SMESG000026549.1 dd_Smed_v4_10879_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30028115SMESG000026549.1 dd_Smed_v6_10879_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30028115SMESG000026549.1 SMESG000032462.1 OX_Smed_1.0.02944ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Human
Match: GCNT3 (glucosaminyl (N-acetyl) transferase 3, mucin type [Source:HGNC Symbol;Acc:HGNC:4205])

HSP 1 Score: 167.548 bits (423), Expect = 2.466e-46
Identity = 101/317 (31.86%), Postives = 157/317 (49.53%), Query Frame = 1
Query:  229 EEINFPIAFGISIYRDAEQFEHLLKAIYRPFNLYCIHVDLSSDARVHEAAIRLSKQFQNVLLTKRFIDVIHSEFSVLESEMLCMEALYQYKKIKWKYFINLTGQEWPLKVNLELVRILKALNGSNLIEK-----------------IKLNSERVPSKIGPPPDGIKLWKGAVHIVVVRDFVKLALYNKRALNLYEFLKKTYVPDETYFSTLNHDHSFKAPGGYSGDLVRDPINYPFINRYKLWEGE----------SVCHGKFLRGICIFSMADVPEMINMNNKKLFANKFVIGINDEVLKYMEKWFYNRSRIVYSN 1098
            EE+ FPIA+ + I+   E FE LL+A+Y P N+YC+HVD  S     EA   +   F NV +  + + V+++ +S +++++ CME L Q   + WKYF+N  G ++P+K N E+V+ LK LNG N +E                  ++        K  PPP  + ++ G  +IV  RDFV+  L N ++  L E++K TY PDE  ++TL        PG        D  +   I R   W+G           + C G   R IC++   D+  M  + N  L ANKF   ++D  L+ +E+  Y R + +Y  
Sbjct:  127 EEVEFPIAYSMVIHEKIENFERLLRAVYAPQNIYCVHVDEKSPETFKEAVKAIISCFPNVFIASKLVRVVYASWSRVQADLNCMEDLLQ-SSVPWKYFLNTCGTDFPIKSNAEMVQALKMLNGRNSMESEVPPKHKETRWKYHFEVVRDTLHLTNKKKDPPPYNLTMFTGNAYIVASRDFVQHVLKNPKSQQLIEWVKDTYSPDEHLWATLQRARWM--PGSVPNHPKYDISDMTSIARLVKWQGHEGDIDKGAPYAPCSGIHQRAICVYGAGDLNWM--LQNHHLLANKFDPKVDDNALQCLEE--YLRYKAIYGT 436          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Human
Match: GCNT3 (glucosaminyl (N-acetyl) transferase 3, mucin type [Source:HGNC Symbol;Acc:HGNC:4205])

HSP 1 Score: 167.548 bits (423), Expect = 2.466e-46
Identity = 101/317 (31.86%), Postives = 157/317 (49.53%), Query Frame = 1
Query:  229 EEINFPIAFGISIYRDAEQFEHLLKAIYRPFNLYCIHVDLSSDARVHEAAIRLSKQFQNVLLTKRFIDVIHSEFSVLESEMLCMEALYQYKKIKWKYFINLTGQEWPLKVNLELVRILKALNGSNLIEK-----------------IKLNSERVPSKIGPPPDGIKLWKGAVHIVVVRDFVKLALYNKRALNLYEFLKKTYVPDETYFSTLNHDHSFKAPGGYSGDLVRDPINYPFINRYKLWEGE----------SVCHGKFLRGICIFSMADVPEMINMNNKKLFANKFVIGINDEVLKYMEKWFYNRSRIVYSN 1098
            EE+ FPIA+ + I+   E FE LL+A+Y P N+YC+HVD  S     EA   +   F NV +  + + V+++ +S +++++ CME L Q   + WKYF+N  G ++P+K N E+V+ LK LNG N +E                  ++        K  PPP  + ++ G  +IV  RDFV+  L N ++  L E++K TY PDE  ++TL        PG        D  +   I R   W+G           + C G   R IC++   D+  M  + N  L ANKF   ++D  L+ +E+  Y R + +Y  
Sbjct:  127 EEVEFPIAYSMVIHEKIENFERLLRAVYAPQNIYCVHVDEKSPETFKEAVKAIISCFPNVFIASKLVRVVYASWSRVQADLNCMEDLLQ-SSVPWKYFLNTCGTDFPIKSNAEMVQALKMLNGRNSMESEVPPKHKETRWKYHFEVVRDTLHLTNKKKDPPPYNLTMFTGNAYIVASRDFVQHVLKNPKSQQLIEWVKDTYSPDEHLWATLQRARWM--PGSVPNHPKYDISDMTSIARLVKWQGHEGDIDKGAPYAPCSGIHQRAICVYGAGDLNWM--LQNHHLLANKFDPKVDDNALQCLEE--YLRYKAIYGT 436          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Human
Match: GCNT2 (glucosaminyl (N-acetyl) transferase 2 (I blood group) [Source:HGNC Symbol;Acc:HGNC:4204])

HSP 1 Score: 154.066 bits (388), Expect = 1.110e-41
Identity = 97/310 (31.29%), Postives = 160/310 (51.61%), Query Frame = 1
Query:  169 SQNHYQVLDSRIPDWNYYLMEEINFPIAFGISIYRDAEQFEHLLKAIYRPFNLYCIHVDLSSDARVHEAAIRLSKQFQNVLLTKRFIDVIHSEFSVLESEMLCMEALYQYKKIKWKYFINLTGQEWPLKVNLELVRILKALNGSNL----------IEKIKLNSERVPSKIG-----------PPPDGIKLWKGAVHIVVVRDFVKLALYNKRALNLYEFLKKTYVPDETYFSTLNHDHSFKAPG-----GYSGDLVRDPINYPFINRYKLWEGESVCHGKFLRGICIFSMADVPEMINMNNKKLFANKF 1020
            +QNHY  + S + +      EE  FP+A+ + I++D + FE L +AIY P N+YC+HVD  + A   E+  +L   FQN  +  +   V+++  S L++++ C++ L    ++ WKY IN  GQ++PLK N E+V+ LK   G N+          I++ K   +    K G            PP  + ++ G  ++ + RDFV   L ++RA++L ++ K TY PDE ++ TLN       PG      ++G+L         I    + +    CHG ++ GICI+   D+  ++  N+  LFANKF
Sbjct:   79 TQNHY--ITSPLSE------EEAAFPLAYVMVIHKDFDTFERLFRAIYMPQNVYCVHVDEKAPAEYKESVRQLLSCFQNAFIASKTESVVYAGISRLQADLNCLKDLVA-SEVPWKYVINTCGQDFPLKTNREIVQHLKGFKGKNITPGVLPPDHAIKRTKYVHQEHTDKGGFFVKNTNILKTSPPHQLTIYFGTAYVALTRDFVDFVLRDQRAIDLLQWSKDTYSPDEHFWVTLNRVSG--VPGSMPNASWTGNLRA-------IKWSDMEDRHGGCHGHYVHGICIYGNGDLKWLV--NSPSLFANKF 368          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Human
Match: GCNT2 (glucosaminyl (N-acetyl) transferase 2 (I blood group) [Source:HGNC Symbol;Acc:HGNC:4204])

HSP 1 Score: 152.525 bits (384), Expect = 4.562e-41
Identity = 97/323 (30.03%), Postives = 165/323 (51.08%), Query Frame = 1
Query:  169 SQNHYQVLDSRIPDWNYYLMEEINFPIAFGISIYRDAEQFEHLLKAIYRPFNLYCIHVDLSSDARVHEAAIRLSKQFQNVLLTKRFIDVIHSEFSVLESEMLCMEALYQYKKIKWKYFINLTGQEWPLKVNLELVRILKALNGSNL----------IEKIKLNSERVPSKIG-----------PPPDGIKLWKGAVHIVVVRDFVKLALYNKRALNLYEFLKKTYVPDETYFSTLNHDHSFKAPG-----GYSGDLVRDPINYPFINRYKLWEGESVCHGKFLRGICIFSMADVPEMINMNNKKLFANKFVIGINDEVLKYME 1059
            +QNHY  + S + +      EE  FP+A+ + I++D + FE L +AIY P N+YC+HVD  + A   E+  +L   FQN  +  +   V+++  S L++++ C++ L    ++ WKY IN  GQ++PLK N E+V+ LK   G N+          I++ K   +    K G            PP  + ++ G  ++ + R+FV   L ++RA++L ++ K TY PDE ++ TLN       PG      ++G+L         I    + +    CHG ++ GICI+   D+  ++  N+  LFANKF +      ++ +E
Sbjct:   79 TQNHY--ITSPLSE------EEAAFPLAYVMVIHKDFDTFERLFRAIYMPQNVYCVHVDEKAPAEYKESVRQLLSCFQNAFIASKTESVVYAGISRLQADLNCLKDLVA-SEVPWKYVINTCGQDFPLKTNREIVQHLKGFKGKNITPGVLPPDHAIKRTKYVHQEHTDKGGFFVKNTNILKTSPPHQLTIYFGTAYVALTREFVDFVLRDQRAIDLLQWSKDTYSPDEHFWVTLNRVSG--VPGSMPNASWTGNLRA-------IKWSDMEDRHGGCHGHYVHGICIYGNGDLKWLV--NSPSLFANKFELNTYPLTVECLE 381          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Human
Match: GCNT1 (glucosaminyl (N-acetyl) transferase 1 [Source:HGNC Symbol;Acc:HGNC:4203])

HSP 1 Score: 149.828 bits (377), Expect = 6.770e-40
Identity = 97/301 (32.23%), Postives = 149/301 (49.50%), Query Frame = 1
Query:  229 EEINFPIAFGISIYRDAEQFEHLLKAIYRPFNLYCIHVDLSSDARVHEAAIRLSKQFQNVLLTKRFIDVIHSEFSVLESEMLCMEALYQYKKIKWKYFINLTGQEWPLKVNLELVRILKALNGSNLIEKIKLNSERVPS------------------KIGP----PPDGIKLWKGAVHIVVVRDFVKLALYNKRALNLYEFLKKTYVPDETYFSTLNHDHSFKAPGGYSGDLVRDPINYPFINRYKLW---EGE-------SVCHGKFLRGICIFSMADVPEMINMNNKKLFANKFVIGIN 1035
            EE  FPIA+ I ++   E  + LL+AIY P N YCIHVD  S+     A + ++  F NV +  R   V+++ +S +++++ CM+ LY      WKY INL G ++P+K NLE+VR LK L G N      L +ER+PS                    G     PP    L+ G+ + VV R++V   L N++   L E+ + TY PDE  ++T+      + PG        D  +   + R+  W   EG+         C G  +R +CIF   D+  M+  ++  LFANKF + ++
Sbjct:  117 EEAEFPIAYSIVVHHKIEMLDRLLRAIYMPQNFYCIHVDTKSEDSYLAAVMGIASCFSNVFVASRLESVVYASWSRVQADLNCMKDLYAMSA-NWKYLINLCGMDFPIKTNLEIVRKLKLLMGEN-----NLETERMPSHKEERWKKRYEVVNGKLTNTGTVKMLPPLETPLFSGSAYFVVSREYVGYVLQNEKIQKLMEWAQDTYSPDEYLWATIQRIP--EVPGSLPASHKYDLSDMQAVARFVKWQYFEGDVSKGAPYPPCDGVHVRSVCIFGAGDLNWMLRKHH--LFANKFDVDVD 407          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Celegans
Match: gly-17 (GLYcosylation related [Source:UniProtKB/TrEMBL;Acc:O02315])

HSP 1 Score: 122.865 bits (307), Expect = 8.334e-31
Identity = 89/270 (32.96%), Postives = 136/270 (50.37%), Query Frame = 1
Query:  229 EEINFPIAFGISIYRDAEQFEHLLKAIYRPFNLYCIHVDLSSDARVHEAAIRLSKQFQNVLLTKRFIDVIHSEFSVLESEMLCMEALYQYKKIKWKYFINLTGQEWPLKVNLELVRILKALNGSNLIEKIKLNSERVPSKIGPPPDGIKLWKGAVHIVVVRDFVKLALYNKRALNLYEFLKKTYVPDETYFSTL-NHDHSFKAPGGYSGDLVRDPINYP---FINRYKLWEGESVCHGKFLRGICIFSMADVPEMINMNNKKLFANKFVI 1026
            EE  FP++FG+ +Y++  Q   LL +IY+P N YCI V  +S          L+  F NV   KR   +    F ++ S   C+E L   K   WKYF  L+G + PLK NLE+VRILK LNG+  I  I    +R+ +        + L+K ++  ++ R        +     L EFL+ T+V DE ++ TL  +   F  PG ++     DP+      +++R++LW  ES CH       C+F + DVP +  M ++ L A+K  I
Sbjct:  103 EEARFPLSFGLLVYKELSQVLFLLSSIYQPQNEYCIAVGENSAPAFLILLKELANCFPNVYFMKR-PPIKWGSFEIINSVYGCLEFLSHLKS-DWKYFQYLSGVDIPLKTNLEMVRILKRLNGTVNI-GISTYEDRLLNGKNKTESPLPLFKSSLSSLIPRKAANYLSSSSVPQQLLEFLRTTWVADEGFWGTLFGNKDLFNVPGSFN---FNDPLTNGWGNYVSRHQLWV-ESECHNYMKDRSCVFGIGDVPNL--MKSRALVAHKLYI 363          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Celegans
Match: gly-16 (GLY-16; GLYcosylation related [Source:UniProtKB/TrEMBL;Acc:G5EDP7])

HSP 1 Score: 117.087 bits (292), Expect = 1.396e-28
Identity = 88/286 (30.77%), Postives = 138/286 (48.25%), Query Frame = 1
Query:  229 EEINFPIAFGISIYRDAEQFEHLLKAIYRPFNLYCIHVDLSSDARVHEAAIRLSKQFQNVLLTKRFIDVIHSEFSVLESEMLCMEALYQYKKIKWKYFINLTGQEWPLKVNLELVRILKALNGSNLIEKIKLNSERVPSKIGPPPDGIKLWKGAVHIVVVRDFVKLALYNKRALNLYEFLKKTYVPDETYFSTL-NHDHSFKAPGG-------YSGDLVRDPINYP------FINRYKLWEGESVCHGKFLRGICIFSMADVPEMINMNNKKLFANKFVIGINDEV 1044
            EE  FP+++G+ +Y++  Q   +L +IY+P N YCI V  +S +        LS  F NV   KR   +    + ++ S   C++ L   K   WKYF  L+G + PLK NLE+VRILK+LNG+  +E IK+   R           + L+K ++  ++ R        +     L EFL+ T+V DE ++ TL  +   F  PG        Y  +  R  +  P      +I+R+++W  ES CH     G C+F + DV  ++    K L A+K  +    E 
Sbjct:   93 EEARFPLSYGLLVYKELSQVLFMLSSIYQPQNEYCIAVGENSASTFLILLEELSDCFPNVHFMKR-PPITWGSYEIINSVYDCLKFLSHLKS-NWKYFQYLSGVDIPLKTNLEMVRILKSLNGTANVE-IKVYENRRLLGQNETESPLPLFKSSLSSLIPRKAANYLASSSIPQQLLEFLRNTWVADEGFWGTLFGNKGLFDVPGSLNFEEWIYFKENARANLTKPTDGWFYYISRHQIW-FESGCHNHMKDGSCVFGIGDVSNLLQA--KALVAHKLYLTSEPEA 372          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Celegans
Match: gly-1 (GLY-1; GLYcosylation related [Source:UniProtKB/TrEMBL;Acc:G5ECK8])

HSP 1 Score: 113.62 bits (283), Expect = 4.007e-27
Identity = 90/319 (28.21%), Postives = 145/319 (45.45%), Query Frame = 1
Query:  196 SRIPDWNYYLMEEINFPIAFGISIYRDAEQFEHLLKAIYRPFNLYCIHVDLSSDARVHEAAIRLSKQFQNVLLTKRFIDVIH--SEFSVLESEMLCMEALYQYKKIKWKYFINLTGQEWPLKVNLELVRILKALNGSNLIEKIKLNSERVPSKIG--PPPDGIKLWKGAVHIVVVRDFVKLALYNKRALNLYEFLKKTYVPDETYFST-LNHDHSFKAPGGYSGDLVRD-------------------PINYPFINRYKLWEGESVCHGKFLRGICIFSMADVPEMINMNNKKLFANKFVIGINDEVLKYMEKWFYNRS 1080
            +RIP       EE  +P+A+G+ +Y+   Q    +   Y+P +++CI VD  S          L   F N+ +   FI        F +L++   C   L + K+ KWKY+  L+G + P++ NLE+VRI KALNGS   +      +R  +  G  PP   + ++K ++ +VV R+     + + R   L ++L KT++PDE+++ST L        PG      VRD                    I   +I RY++W  +  C GK     C+F + D+ E+  M   +L A+K  +         M K    RS
Sbjct:  116 TRIPS----SREEAEYPLAYGLVVYKTIVQVLTQMSLFYQPQHMFCITVDDQSPNEYKSVIQALPSCFPNMHV---FIGEPSQWGSFGILKNVYTCFNWLSKSKQ-KWKYYQYLSGTDLPIRTNLEMVRIFKALNGSMNTDVSTFEVDRYKNMEGVLPP---MPVYKSSMSVVVPREGADYLISSPRVQKLLKYLSKTWIPDESFWSTVLGSPALLPVPGSIR---VRDILWLRKNFKLRPPYENTVNSIGTSYIGRYQVWGWQKECFGKVKDFSCVFGVEDIEEI--MTRPELVAHKLYLEFQPAAFMCMLKEVRRRS 418          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Celegans
Match: gly-18 (GLYcosylation related [Source:UniProtKB/TrEMBL;Acc:Q19730])

HSP 1 Score: 113.235 bits (282), Expect = 4.048e-27
Identity = 84/286 (29.37%), Postives = 138/286 (48.25%), Query Frame = 1
Query:  229 EEINFPIAFGISIYRDAEQFEHLLKAIYRPFNLYCIHVDLSSDARVHEAAIRLSKQFQNVLLTKRFIDVIHSEFSVLESEMLCMEALYQYKKIKWKYFINLTGQEWPLKVNLELVRILKALNGSNLIEKIKLNSERVPSKIGPPPDGIKLWKGAVHIVVVRDFVKLALYNKRALNLYEFLKKTYVPDETYFSTL-NHDHSFKAPGGYS-------GDLVRDPINYP------FINRYKLWEGESVCHGKFLRGICIFSMADVPEMINMNNKKLFANKFVIGINDEV 1044
            EE +FP+++G+ +Y++  Q   +L +IY P N YCI V  +S          LS  F N+   KR   +      ++ S   C+E L   K   W+YF  L+G + PLK NLE+V+ILK LNG+  +E      +R+  K       + L+K ++  ++ R+       +     L EFL+ T + DE ++ TL  + + F  PG  +        + V   + YP      +I+R ++W   + CH     G C+F + DVP +  + +K L A+KF +    E 
Sbjct:  113 EEESFPLSYGLLVYKELSQVLFMLSSIYHPQNEYCIAVGENSAPIFQNLLKELSNCFSNIHFMKR-PPIDWGSHEIINSAYDCLEFLSHLKS-DWRYFQYLSGVDIPLKTNLEMVQILKHLNGTANVEIKPYQYQRLRGK-NETQSPLPLFKSSLSSLIPREAANHLSSSSIPQQLLEFLRNTGIADEGFWGTLFGNKNLFDIPGSLNFKEWISYKNNVETNLTYPTDGWRYYISRDQIWSKPN-CHNYMKAGSCVFGIGDVPRL--LKSKALVAHKFYLKSEPEA 392          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Celegans
Match: gly-19 (GLY-19; GLYcosylation related [Source:UniProtKB/TrEMBL;Acc:G5EBK7])

HSP 1 Score: 108.997 bits (271), Expect = 1.067e-25
Identity = 89/286 (31.12%), Postives = 137/286 (47.90%), Query Frame = 1
Query:  229 EEINFPIAFGISIYRDAEQFEHLLKAIYRPFNLYCIHVDLSSDARVHEAAIRLSKQFQNVLLTKRFIDVIHSEFSVLESEMLCMEALYQYKKIKWKYFINLTGQEWPLKVNLELVRILKALNGSNLIEKIKLNSERVPSKIGPPPDGIKLWKGAVHIVVVRDFVKLALYNKRALNLYEFLKKTYVPDETYFSTL--NHDHSFKAPGGY-SGDLV--RDPINYPF---------INRYKLWEGESVCHGKFLRGICIFSMADVPEMINMNNKKLFANKFVIGINDEV 1044
            EE +FP+++G+ +Y+D  Q   LL +IY P N YCI V  +S          +S  F NV   KR   +      +++S   C+E L  + +  W+YF  L+G + PLK NLE+V+ILK LNG++ +E       R+  K       + L+K ++  ++ R        +  A  L EFL  T + DE ++ TL  N D  F   G   S D +  RD  N  F         I+R ++W+ E +C        C+F + DVP +    +K L A+KF +    E 
Sbjct:  110 EEKHFPLSYGMLVYKDLPQVLFLLSSIYHPQNEYCIAVGENSAPIFQNLLREVSTCFSNVHFMKR-PPISWGSHEIIDSVYDCLEFL-SHLETDWRYFQYLSGVDIPLKTNLEMVQILKHLNGTSNVEITNYQQARLTGK-NENESPLPLFKSSLSAIIPRKAANQLASSNTARKLLEFLWNTEIADEGFWGTLFGNKDQ-FNISGSINSKDWMEYRDNQNNIFNPTDGWSYYISRDQIWDPE-LCKNYMKDDSCVFGIGDVPRL--RTSKALVAHKFYLKSEPEA 388          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Fly
Match: oxt (gene:FBgn0015360 transcript:FBtr0072904)

HSP 1 Score: 75.8702 bits (185), Expect = 3.443e-14
Identity = 84/317 (26.50%), Postives = 132/317 (41.64%), Query Frame = 1
Query:  247 IAFGISI-YRDAEQFEHLLKAIYRPFNLYCIHVDLSSDARVHEAAIRLSKQFQNVLLTKRFIDVIHSEFSVLESEMLCMEALYQYKKIKWKYFINLTGQEWPLKVNLELVRILKALNGSNLIEKIKLNSERVPSKIG------------------PPPDGIKLWKGAVHIVVVRDFVKLALYNKRALNLYEFLKK----TYVPDETYFSTL--NHDHSFKAPGGYSGDLVRDPINYPFINRYKLWEGESVCHGKFLRGIC-----IFSMADVPEMINMNNKKL-FANKFVIGINDEVLKYMEKWFYNRSRIVYSNVN 1104
            IAF +++  R   Q   LLKA+Y P ++Y IHVD   D  ++   + L  +F N+ L ++    I    S+L   + CME L Q     W + INL+  ++P+K   +LV  L A  G N ++     +++   K G                    P GI++  G+  + + R FV    + +    L + L K    T +P E++F T+  N  H                 N   +  +K  +G   C  K +   C      F   D P +     K L FA KF   IN  VL  +E+W Y      Y+N++
Sbjct:  250 IAFLLTLNGRALRQVHRLLKALYAPEHVYYIHVDERQD-YLYRKLLELESKFPNIRLARKRFSTIWGGASLLTMLLQCMEDLLQ-SNWHWDFVINLSESDFPVKTLDKLVDFLSANPGRNFVKGHGRETQKFIQKQGLDKTFVECDTHMWRIGDRKLPAGIQVDGGSDWVALSRPFVGYVTHPREDDELLQALLKLFRHTLLPAESFFHTVLRNTKHCTSYVD-----------NNLHVTNWKRKQG-CKCQYKHVVDWCGCSPNDFKPEDWPRLQATEQKSLFFARKFEPVINQAVLLQLEEWLYGPYTSEYANLH 552          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Zebrafish
Match: gcnt7 (glucosaminyl (N-acetyl) transferase family member 7 [Source:ZFIN;Acc:ZDB-GENE-120919-3])

HSP 1 Score: 159.844 bits (403), Expect = 1.094e-43
Identity = 101/313 (32.27%), Postives = 157/313 (50.16%), Query Frame = 1
Query:  229 EEINFPIAFGISIYRDAEQFEHLLKAIYRPFNLYCIHVDLSSDARVHEAAIRLSKQFQNVLLTKRFIDVIHSEFSVLESEMLCMEALYQYKKIKWKYFINLTGQEWPLKVNLELVRILKA--LNGSNLIEKIK------------------LNSERVPSKIGPPPDGIKLWKGAVHIVVVRDFVKLALYNKRALNLYEFLKKTYVPDETYFSTLNHDHSFKAPGGYSGDLVRDPINYPFINRYKLWEG--------------ESVCHGKFLRGICIFSMADVPEMINMNNKKLFANKFVIGINDEVLKYMEKW 1065
            EE ++P+AF I+I+++   F  LL+AIY P N+YCIH+D  +  +   +   LS+ F NV L+   + V ++ FS L++++ CM+ L +   I+WK  INL GQ++P++ NLELVR ++       N+   IK                   +  +   K GPPP  +K++ G  +  + R FV+  L N  A +L  + K +Y PDE Y+ TLNH    +APG                N    WEG                 C G+++RGIC++ + D+P +I    + +FANKF +    E L  ME W
Sbjct:  106 EEEDYPLAFIITIHKELATFVRLLRAIYAPQNVYCIHIDQKASEKYKSSVRNLSRCFPNVFLSSVNVKVTYAGFSRLQADINCMKDLVE-SPIQWKKVINLCGQDYPIQTNLELVRYMQTPEWKDRNMTPGIKQPPSMRYRTAFQYVEVKNTHVAQTGRKKGPPPHNLKIYFGTAYYSLTRPFVEYVLDNPVAKDLLSWSKDSYSPDEHYWVTLNHIK--EAPGS---------------NVEGEWEGNVRAVKWSDQQGTAHQGCKGQYIRGICVYGIGDLPWLI--EKESMFANKFEMASFPEALDCMELW 398          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Zebrafish
Match: gcnt3 (glucosaminyl (N-acetyl) transferase 3, mucin type [Source:ZFIN;Acc:ZDB-GENE-110411-253])

HSP 1 Score: 154.836 bits (390), Expect = 5.411e-42
Identity = 100/316 (31.65%), Postives = 158/316 (50.00%), Query Frame = 1
Query:  229 EEINFPIAFGISIYRDAEQFEHLLKAIYRPFNLYCIHVDLSSDARVHEAAIRLSKQFQNVLLTKRFIDVIHSEFSVLESEMLCMEALYQYKKIKWKYFINLTGQEWPLKVNLELVRILKALNGSNLIEKIKLNSERVPSK--------------------IGPPPDGIKLWKGAVHIVVVRDFVKLALYNKRALNLYEFLKKTYVPDETYFSTLNHDHSFKAPGGYSGDLVRDPINYPFINRYKLW---EGE-------SVCHGKFLRGICIFSMADVPEMINMNNKKLFANKFVIGINDEVLKYMEKWFYNRSRI 1086
            EE +FPIA+ + I+   E FE LL+AIY P N+YC+HVD+ S     EA   +   F NV +  +   VI++ +S +++++ CM+ L +   ++W+Y +N  G ++P+K N E VR LK LNG N +E     SE VP K                      PPP    ++ G  + VV R+FV+  + +K   NL E+ K TY PDE  ++TL    S   PG  S +   +  +   I R   W   EG+         C G   R +C++   D+  ++  ++  L ANKF   ++D  +K ME +   ++ +
Sbjct:  101 EEEDFPIAYSMVIHDKIEMFERLLRAIYAPQNVYCVHVDMKSPQIFREAVNAIVSCFPNVFVASKLESVIYASWSRVQADVNCMQDLLK-SPVQWRYLLNTCGTDFPIKTNAETVRSLKHLNGKNSME-----SETVPGKNWRWQFHHNITNTVIRTDIRKSPPPINTSMFSGNAYFVVSREFVEYIMNSKEIQNLMEWEKDTYSPDEHMWATLQRMPS--VPGSNSPNNKYEQSDMNAIARLVKWSYHEGDLNSGAPYPPCTGMHRRSVCVYGAGDLKWIVRQHH--LLANKFDPEVDDVAIKCMEAFLRYKATV 406          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Zebrafish
Match: gcnt3 (glucosaminyl (N-acetyl) transferase 3, mucin type [Source:ZFIN;Acc:ZDB-GENE-110411-253])

HSP 1 Score: 155.221 bits (391), Expect = 5.813e-42
Identity = 103/318 (32.39%), Postives = 159/318 (50.00%), Query Frame = 1
Query:  229 EEINFPIAFGISIYRDAEQFEHLLKAIYRPFNLYCIHVDLSSDARVHEAAIRLSKQFQNVLLTKRFIDVIHSEFSVLESEMLCMEALYQYKKIKWKYFINLTGQEWPLKVNLELVRILKALNGSNLIEKIKLNSERVPSK--------------------IGPPPDGIKLWKGAVHIVVVRDFVKLALYNKRALNLYEFLKKTYVPDETYFSTLNHDHSFKAPGGYSGDLVRDPINYPFINRYKLW---EGE-------SVCHGKFLRGICIFSMADVPEMINMNNKKLFANKFVIGINDEVLKYMEKWFYNRSRIVY 1092
            EE +FPIA+ + I+   E FE LL+AIY P N+YC+HVD+ S     EA   +   F NV +  +   VI++ +S +++++ CM+ L +   ++W+Y +N  G ++P+K N E VR LK LNG N +E     SE VP K                      PPP    ++ G  + VV R+FV+  + +K   NL E+ K TY PDE  ++TL    S   PG  S +   +  +   I R   W   EG+         C G   R +C++   D+  ++  ++  L ANKF   ++D  +K ME +   R + VY
Sbjct:  113 EEEDFPIAYSMVIHDKIEMFERLLRAIYAPQNVYCVHVDMKSPQIFREAVNAIVSCFPNVFVASKLESVIYASWSRVQADVNCMQDLLK-SPVQWRYLLNTCGTDFPIKTNAETVRSLKHLNGKNSME-----SETVPGKNWRWQFHHNITNTVIRTDIRKSPPPINTSMFSGNAYFVVSREFVEYIMNSKEIQNLMEWEKDTYSPDEHMWATLQRMPS--VPGSNSPNNKYEQSDMNAIARLVKWSYHEGDLNSGAPYPPCTGMHRRSVCVYGAGDLKWIVRQHH--LLANKFDPEVDDVAIKCMEAFL--RYKAVY 418          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Zebrafish
Match: gcnt3 (glucosaminyl (N-acetyl) transferase 3, mucin type [Source:ZFIN;Acc:ZDB-GENE-110411-253])

HSP 1 Score: 154.836 bits (390), Expect = 7.145e-42
Identity = 100/310 (32.26%), Postives = 155/310 (50.00%), Query Frame = 1
Query:  229 EEINFPIAFGISIYRDAEQFEHLLKAIYRPFNLYCIHVDLSSDARVHEAAIRLSKQFQNVLLTKRFIDVIHSEFSVLESEMLCMEALYQYKKIKWKYFINLTGQEWPLKVNLELVRILKALNGSNLIEKIKLNSERVPSK--------------------IGPPPDGIKLWKGAVHIVVVRDFVKLALYNKRALNLYEFLKKTYVPDETYFSTLNHDHSFKAPGGYSGDLVRDPINYPFINRYKLW---EGE-------SVCHGKFLRGICIFSMADVPEMINMNNKKLFANKFVIGINDEVLKYMEKWF 1068
            EE +FPIA+ + I+   E FE LL+AIY P N+YC+HVD+ S     EA   +   F NV +  +   VI++ +S +++++ CM+ L +   ++W+Y +N  G ++P+K N E VR LK LNG N +E     SE VP K                      PPP    ++ G  + VV R+FV+  + +K   NL E+ K TY PDE  ++TL    S   PG  S +   +  +   I R   W   EG+         C G   R +C++   D+  ++  ++  L ANKF   ++D  +K ME + 
Sbjct:  113 EEEDFPIAYSMVIHDKIEMFERLLRAIYAPQNVYCVHVDMKSPQIFREAVNAIVSCFPNVFVASKLESVIYASWSRVQADVNCMQDLLK-SPVQWRYLLNTCGTDFPIKTNAETVRSLKHLNGKNSME-----SETVPGKNWRWQFHHNITNTVIRTDIRKSPPPINTSMFSGNAYFVVSREFVEYIMNSKEIQNLMEWEKDTYSPDEHMWATLQRMPS--VPGSNSPNNKYEQSDMNAIARLVKWSYHEGDLNSGAPYPPCTGMHRRSVCVYGAGDLKWIVRQHH--LLANKFDPEVDDVAIKCMEAFL 412          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Zebrafish
Match: gcnt4a (glucosaminyl (N-acetyl) transferase 4a [Source:NCBI gene;Acc:324510])

HSP 1 Score: 142.51 bits (358), Expect = 2.006e-37
Identity = 93/309 (30.10%), Postives = 161/309 (52.10%), Query Frame = 1
Query:  229 EEINFPIAFGISIYRDAEQFEHLLKAIYRPFNLYCIHVDLSSDARVHEAAIRLSKQFQNVLLTKRFIDVIHSEFSVLESEMLCMEALYQYKKIKWKYFINLTGQEWPLKVNLELVRILKALNGSNLIE-----KIKLNS--------------ERVPSKIG----PPPDGIKLWKGAVHIVVVRDFVKLALYNKRALNLYEFLKKTYVPDETYFSTLNHDHSFKAPGGYSGDLVR-DPINYPFINRYKLWEGESV-------CHGKFLRGICIFSMADVPEMINMNNKKLFANKFVIGINDEVLKYMEK 1062
            EE NFPIA+ + +++++   E +L+AIY P N+YCIH D  S      A   L   F NV +  +   V ++  + L++++ C+  L    ++KWKY INL GQ++PLK N ELV  L+ LNG+N++E     K+K                 +++P K      PPP  I+++ G+ + V+ RDFV   + N+ A +  ++   TY PDE +++++      + P G  G+L R +P      +R +L +   +       C G   R +CI+  A++  +  + +   FANKF   ++  ++K +E+
Sbjct:  114 EECNFPIAYSLVVHKNSAMVERILRAIYAPQNIYCIHYDQKSTKDFIAAMKNLESCFPNVFIASKIESVQYAHITRLKADLNCLSDLLS-SEVKWKYVINLCGQDFPLKSNYELVTELRKLNGANMLETSRPSKVKKQRFQFRYQLKDVSYEYQKMPVKTSIAKDPPPHNIEMFVGSAYFVLSRDFVTYVMNNQLAKDFLQWSVDTYSPDEHFWASMA-----RVP-GVPGELARSEPDVSDLKSRTRLVKWNYLEERLYPKCTGTHRRSVCIYGAAELRWL--LEDGHWFANKFDPKVDPVIIKCLEE 413          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Xenopus
Match: cnksr2 (connector enhancer of kinase suppressor of Ras 2 [Source:Xenbase;Acc:XB-GENE-490704])

HSP 1 Score: 168.318 bits (425), Expect = 1.033e-46
Identity = 105/315 (33.33%), Postives = 165/315 (52.38%), Query Frame = 1
Query:  229 EEINFPIAFGISIYRDAEQFEHLLKAIYRPFNLYCIHVDLSSDARVHEAAIRLSKQFQNVLLTKRFIDVIHSEFSVLESEMLCMEALYQYKKIKWKYFINLTGQEWPLKVNLELVRILKALNGSNLIEKIKLNSER---------VPSKI-------GPPPDGIKLWKGAVHIVVVRDFVKLALYNKRALNLYEFLKKTYVPDETYFSTLNHDHSFKAPGGYSGDLVRDPINYPFINRYKLW---EGESV-------CHGKFLRGICIFSMADVPEMINMNNKKLFANKFVIGINDEVLKYMEKWFYNRSRIVYS 1095
            EE NFPIA+ + I+   + FE LL+AIY P N+YC+HVD  S A   EA   ++  F NV +  + + V+++ +  +++++ CME L Q  K+ WKY +N  G ++PLK N E+VR LK+LNG N +E  K +S +         V   I        PPP    ++ G  +IVV R+FV+    N +AL L E++K TY PDE  ++TLN          YS    +  +N   + R   W   EG+         C G   R IC++   D+  ++  ++  + ANKF   +++  L+ +E++   R + VY 
Sbjct:  121 EEENFPIAYSMVIHEKIDMFERLLRAIYAPQNIYCVHVDEKSPAVFKEAVNAITSCFDNVFIASKLVKVVYAAWPRVQADLNCMEDLLQ-SKVLWKYLLNTCGTDFPLKTNAEIVRTLKSLNGKNSMESEKPSSSKKTRWEFHFEVGDSISKTAIEKSPPPIDSPMFTGNAYIVVCRNFVEHIFNNPQALTLIEWVKDTYSPDEHLWATLNRMPGVPGSSPYSDKYEKSDMNA--VARMVKWGYMEGDIAKGAPYPPCTGTHRRSICVYGTGDLYWLLEQHH--VLANKFDPKVDNIALECLEEYL--RHKTVYG 428          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Xenopus
Match: gcnt2.2 (glucosaminyl (N-acetyl) transferase 2 (I blood group), gene 2 [Source:NCBI gene;Acc:100038221])

HSP 1 Score: 162.54 bits (410), Expect = 1.175e-44
Identity = 97/296 (32.77%), Postives = 161/296 (54.39%), Query Frame = 1
Query:  214 NYYLM-----EEINFPIAFGISIYRDAEQFEHLLKAIYRPFNLYCIHVDLSSDARVHEAAIRLSKQFQNVLLTKRFIDVIHSEFSVLESEMLCMEALYQYKKIKWKYFINLTGQEWPLKVNLELVRILKALNGSNL----------IEKIK-------LNSERVPSKI--GPPPDGIKLWKGAVHIVVVRDFVKLALYNKRALNLYEFLKKTYVPDETYFSTLNH--DHSFKAP-GGYSGDLVRDPINYPFINRYKLWEGESVCHGKFLRGICIFSMADVPEMINMNNKKLFANKF 1020
            N+++M     EE  FP+A+ ++++++ E FE L +AIY P N+YC+HVD  + A   +A   L + F N  L  +   V++   S L++++ CM+ L     ++WKY INL GQ++PLK N E++  +K+  G N+          I + K       +NS  V +++   PPP  I ++ G+ ++ + R+F +  L ++RA NL  + K TY PDE Y+ TLN   D    AP   + G L           ++K  + +  CHG ++R ICI+   D+  +  MN++ +FANKF
Sbjct:  100 NHFIMSPLSQEEAAFPLAYILTVHKEFETFERLFRAIYMPQNIYCVHVDEKASADFMQAVDSLVQCFPNTFLASKMEPVVYGGISRLQADLNCMKDLLA-SDVQWKYVINLCGQDFPLKTNKEIIHHIKSFKGKNITPGVLPPAHAIPRTKYVHREDIVNSRVVRTRVLKPPPPHNITIYFGSAYVALTREFTRFILEDQRATNLLLWSKDTYSPDEHYWVTLNRIADVPGSAPDASWEGQLR--------AVKWKDMKDQEKCHGHYVRDICIYGTGDLQWL--MNSRSIFANKF 384          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Xenopus
Match: adsl (adenylosuccinate lyase [Source:Xenbase;Acc:XB-GENE-1001539])

HSP 1 Score: 158.303 bits (399), Expect = 3.001e-43
Identity = 96/322 (29.81%), Postives = 166/322 (51.55%), Query Frame = 1
Query:  229 EEINFPIAFGISIYRDAEQFEHLLKAIYRPFNLYCIHVDLSSDARVHEAAIRLSKQFQNVLLTKRFIDVIHSEFSVLESEMLCMEALYQYKKIKWKYFINLTGQEWPLKVNLELVRILKALNGSNL----------IEKIK-------LNSERVPSKI--GPPPDGIKLWKGAVHIVVVRDFVKLALYNKRALNLYEFLKKTYVPDETYFSTLNHDHSFKAPGG-----YSGDLVRDPINYPFINRYKLWEGESV---CHGKFLRGICIFSMADVPEMINMNNKKLFANKFVIGINDEVLKYMEKWFYNRSRIVYSNVNVNP 1113
            EE  FP+A+ ++++++ E FE L +AIY P N+YC+HVD  + A   +A   L + F N  L  +   V++   S L++++ CM+ L     ++WKY INL GQ++PLK N E++  +K+  G N+          I + K       +NS  V +++   PPP  I ++ G+ ++ + R+F +  L ++RA NL  + K TY PDE Y+ TLN    F  PG      + GDL           R   W  +     CHG ++R +C++   D+  +  + +  +F NKF +      ++ +E     R+ + Y+ +++ P
Sbjct:   88 EEAAFPLAYILTVHKEFETFERLFRAIYMPQNIYCVHVDEKASADFMQAVDSLVQCFPNTFLASKMEPVVYGGISRLQADLNCMKDLLA-SDVQWKYVINLCGQDFPLKTNREIIHHIKSFKGKNITPGVLPPAHAIPRTKYVHREDIVNSRVVRTRVLKPPPPHNITIYFGSAYVALTREFTRFILEDQRATNLLLWSKDTYSPDEHYWVTLNRIADF--PGSVPDAKWEGDL-----------RAIKWSDDKTHDGCHGHYVRDVCVYGTGDLQWL--LKSPSMFGNKFELASYPPTVECLELRLRKRA-LDYAEISLQP 392          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Xenopus
Match: slc24a4 (solute carrier family 24 member 4 [Source:Xenbase;Acc:XB-GENE-478288])

HSP 1 Score: 157.147 bits (396), Expect = 2.089e-42
Identity = 94/313 (30.03%), Postives = 161/313 (51.44%), Query Frame = 1
Query:  229 EEINFPIAFGISIYRDAEQFEHLLKAIYRPFNLYCIHVDLSSDARVHEAAIRLSKQFQNVLLTKRFIDVIHSEFSVLESEMLCMEALYQYKKIKWKYFINLTGQEWPLKVNLELVRILKALNGSNLIE----------------KIKLNSERV---PSKIGPPPDGIKLWKGAVHIVVVRDFVKLALYNKRALNLYEFLKKTYVPDETYFSTLNHDHSFKAPGGYSGDLVRDPINYPFINRYKLWEGES----------VCHGKFLRGICIFSMADVPEMINMNNKKLFANKFVIGINDEVLKYMEKWFYNRS 1080
            EE +FPIA+ + I+ + E FE LL+AIY P N+YC+H+D  S    H+A   ++  F NV +  + ++V+++ +  +++++ CME L Q  K+ WKY IN  G ++P+K N E+V+ LK+LNG N +E                ++K +S  +    ++  P P  + ++ G  +IVV R+FV     N    +   + K TY PDE  ++TLN     + PG        D  +   I R   WE              C G   R +C++   D+  ++  ++  LFANKF   +++ V++ +E++   +S
Sbjct:  128 EEQDFPIAYSMVIHDNIEMFERLLRAIYTPHNIYCVHMDKKSPESFHQAVRAITSCFGNVFVASKLVNVVYASWRRVQADLNCMEDLLQ-SKVPWKYLINTCGTDFPIKTNAEMVKALKSLNGHNSMESEIPPNHKKRRWEYHFELKEDSNNIVLTNTRKKPSPLPVPVFSGNAYIVVTRNFVNALFVNPTVRSFITWAKDTYSPDEYLWATLN--RFAEMPGYMPAHQKYDTSDINAIARLVKWESLEGDMSKGAPYIPCSGTHRRTVCVYGTGDLNWLLQQHH--LFANKFDPKVDNNVIQCLEEYLRYKS 435          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Xenopus
Match: ccdc77 (coiled-coil domain containing 77 [Source:Xenbase;Acc:XB-GENE-959311])

HSP 1 Score: 149.058 bits (375), Expect = 1.181e-39
Identity = 95/311 (30.55%), Postives = 154/311 (49.52%), Query Frame = 1
Query:  229 EEINFPIAFGISIYRDAEQFEHLLKAIYRPFNLYCIHVDLSSDARVHEAAIRLSKQFQNVLLTKRFIDVIHSEFSVLESEMLCMEALYQYKKIKWKYFINLTGQEWPLKVNLELVRILKALNGSNLIEKIKL----------NSERVPSKI-------GPPPDGIKLWKGAVHIVVVRDFVKLALYNKRALNLYEFLKKTYVPDETYFSTLNHDHSFKAPGGYSGDLVRDPINYPFINRYKLW---EGESV-------CHGKFLRGICIFSMADVPEMINMNNKKLFANKFVIGINDEVLKYMEKWFYNRS 1080
            EE  FPIA+ I +Y   +  E LL++IY P N YCIHVD  S      A   ++  F+NV +  +  +V+++ ++ +++++ CM  L+  K  KWKY INL G ++P+K N E+V +LK L   N +E  K+          + E V + I        PPP    ++ G+ + VV R FV   L N++     E+ K TY PDE  ++TL        PG    +   D  +     R+  W   EG+         C G  +R +C+F   D+  M+  ++  LF NKF I ++   +K +E+   +++
Sbjct:  114 EEREFPIAYSIVVYHRIDMLERLLRSIYTPQNYYCIHVDKKSSTSFLNAVKAITSCFENVFIASQLENVVYASWARVQADLNCMTDLHN-KNAKWKYLINLCGMDFPIKTNREMVEMLKGLKSQNSLETEKMPPHKEVRWRKHYEIVDNAIRKTEEDKTPPPLETPVFSGSAYFVVTRAFVSYILENEKIQRFLEWSKDTYSPDEFIWATLQRIPG--VPGSVPANSKYDVSDMNAYARFVKWAYLEGDVAKGAPYPPCAGNHVRSVCVFGAGDLEFMLQKHH--LFGNKFDIDVDPTAIKCLEEHLRHKA 419          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Mouse
Match: Gcnt3 (glucosaminyl (N-acetyl) transferase 3, mucin type [Source:MGI Symbol;Acc:MGI:1919327])

HSP 1 Score: 158.688 bits (400), Expect = 3.560e-43
Identity = 95/323 (29.41%), Postives = 161/323 (49.85%), Query Frame = 1
Query:  229 EEINFPIAFGISIYRDAEQFEHLLKAIYRPFNLYCIHVDLSSDARVHEAAIRLSKQFQNVLLTKRFIDVIHSEFSVLESEMLCMEALYQYKKIKWKYFINLTGQEWPLKVNLELVRILKALNGSNLIE----------------KIKLNSERVPSKIGPPPDGIKLWKGAVHIVVVRDFVKLALYNKRALNLYEFLKKTYVPDETYFSTLNHDHSFKAPGGYSGDLVRDPINYPF-------INRYKLW---EGE-------SVCHGKFLRGICIFSMADVPEMINMNNKKLFANKFVIGINDEVLKYMEKWFYNRSRIVYSN 1098
            EE +FPIA+ + ++   E FE LL+A+Y P N+YC+H+D  S     +A   +   F NV +  + + V+++ +S +++++ CME L Q   + WKY +N  G ++P+K N E+V+ LK L G N +E                ++         +  PPP+ + ++ G  ++V  RDF++    N +A  L E++K TY PDE  ++TL    +   PG        DP++  F       I R   W   EG+       + C G   R +C++   D+  +  + N  L ANKF   ++D VL+ +E+  Y R + +Y  
Sbjct:  127 EEASFPIAYSMVVHEKIENFERLLRAVYTPQNVYCVHMDQKSSEPFKQAVRAIVSCFPNVFIASKLVSVVYASWSRVQADLNCMEDLLQ-SPVPWKYLLNTCGTDFPIKTNAEMVKALKLLKGQNSMESEVPPPHKKSRWKYHYEVTDTLHMTSKRKTPPPNNLTMFTGNAYMVASRDFIEHVFSNSKARQLIEWVKDTYSPDEHLWATLQ--RASWMPGS-------DPLHRKFDLSDMRAIARLTKWYDHEGDIENGAPYTSCSGIHQRAVCVYGSGDLHWI--LQNHHLLANKFDPKVDDNVLQCLEE--YLRHKAIYGT 435          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Mouse
Match: Gcnt2 (glucosaminyl (N-acetyl) transferase 2, I-branching enzyme [Source:MGI Symbol;Acc:MGI:1100870])

HSP 1 Score: 155.221 bits (391), Expect = 3.030e-42
Identity = 91/289 (31.49%), Postives = 143/289 (49.48%), Query Frame = 1
Query:  229 EEINFPIAFGISIYRDAEQFEHLLKAIYRPFNLYCIHVDLSSDARVHEAAIRLSKQFQNVLLTKRFIDVIHSEFSVLESEMLCMEALYQYKKIKWKYFINLTGQEWPLKVNLELVRILKALNGSNLIEKIKLNSERVPSK---------------------IGPPPDGIKLWKGAVHIVVVRDFVKLALYNKRALNLYEFLKKTYVPDETYFSTLNH----DHSFKAPGGYSGDLVRDPINYPFINRYKLWEGESVCHGKFLRGICIFSMADVPEMINMNNKKLFANKF 1020
            EE  FP+AF ++I++D + FE L +AIY P N+YC+HVD  +     E   +L   F N  L  R   V++  FS L++++ CM+ L    KI WKY +N  GQ++PLK N E+V+ LK   G NL   +   +  V                          PPP  + ++ G  ++ + R+F    L ++R+++L  + K TY PDE ++ TLN       S      ++G+L         +    +      CHG ++ GICI+   D+  +I  N++ LFANKF
Sbjct:   89 EEARFPLAFTLTIHKDYDTFERLFRAIYMPQNVYCVHVDSKATDTFKEEVRQLLSCFPNAFLASRMEPVVYGGFSRLQADLNCMKDLVA-SKIPWKYVLNTCGQDFPLKTNKEIVQYLKRFIGKNLTPGVLPPAHAVGRTKYVHQELLDHKNPYVHNTARLKAPPPHNLTIYFGTAYVALTREFANFVLKDQRSVDLISWSKDTYSPDEHFWVTLNRIPGVPGSMPPNASWTGNLRA-------VKWMDMEAKHGGCHGHYVHGICIYGNGDLQWLI--NSQSLFANKF 367          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Mouse
Match: Gcnt2 (glucosaminyl (N-acetyl) transferase 2, I-branching enzyme [Source:MGI Symbol;Acc:MGI:1100870])

HSP 1 Score: 153.68 bits (387), Expect = 1.058e-41
Identity = 93/289 (32.18%), Postives = 146/289 (50.52%), Query Frame = 1
Query:  229 EEINFPIAFGISIYRDAEQFEHLLKAIYRPFNLYCIHVDLSSDARVHEAAIRLSKQFQNVLLTKRFIDVIHSEFSVLESEMLCMEALYQYKKIKWKYFINLTGQEWPLKVNLELVRILKALNGSN----------LIEKIKLNSERVPSKIG-----------PPPDGIKLWKGAVHIVVVRDFVKLALYNKRALNLYEFLKKTYVPDETYFSTLNH----DHSFKAPGGYSGDLVRDPINYPFINRYKLWEGESVCHGKFLRGICIFSMADVPEMINMNNKKLFANKF 1020
            EE  FP+A+ + I++D + FE L +AIY P N+YC+HVD  +     EA  +L   F N  L  +   V++  FS L++++ CM+ L    K+ WKY +N  GQ++PLK N E++  LK   G N          ++ + K   +    K G           PPP  + ++ G  ++ + RDFV   L ++RA+ L E+ K TY PDE ++ TLN       S      ++G+L         +    +      CHG ++ GICI+   D+  +I  N++ LFANKF
Sbjct:   89 EEAAFPLAYIMVIHKDFDTFERLFRAIYMPQNVYCVHVDSKATDTFKEAVRQLLSCFPNAFLASKVEQVVYGGFSRLQADLNCMKDLVA-SKVPWKYVLNTCGQDFPLKTNKEIINHLKRFKGKNITPGVLPPAYIVVRTKYVHQERKGKDGYFMHKTNILKTPPPHQLIIYFGTAYVALTRDFVNFILNDERAIALLEWSKDTYSPDEHFWVTLNRIPGVPGSMPPNASWTGNLRA-------VKWMDMEAKHGGCHGHYVHGICIYGNGDLQWLI--NSQSLFANKF 367          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Mouse
Match: Gcnt1 (glucosaminyl (N-acetyl) transferase 1, core 2 [Source:MGI Symbol;Acc:MGI:95676])

HSP 1 Score: 149.828 bits (377), Expect = 5.198e-40
Identity = 95/311 (30.55%), Postives = 158/311 (50.80%), Query Frame = 1
Query:  229 EEINFPIAFGISIYRDAEQFEHLLKAIYRPFNLYCIHVDLSSDARVHEAAIRLSKQFQNVLLTKRFIDVIHSEFSVLESEMLCMEALYQYKKIKWKYFINLTGQEWPLKVNLELVRILKALNGSNLIEKIKL---NSER-------VPSKI-------GPPPDGIKLWKGAVHIVVVRDFVKLALYNKRALNLYEFLKKTYVPDETYFSTLNHDHSFKAPGGYSGDLVRDPINYPFINRYKLW---EGE-------SVCHGKFLRGICIFSMADVPEMINMNNKKLFANKFVIGINDEVLKYMEKWFYNRS 1080
            EE+ FPIA+ I ++   E  + LL+AIY P N YCIHVD  ++     A   ++  F NV +  +   V+++ +S +++++ CM+ LY+     WKY INL G ++P+K NLE+VR LK   G N +E  K+     ER       V  K+        PPP    L+ G+ + VV R++V   L N+    L E+ + TY PDE  ++T+      + PG +      D  +   I R+  W   EG          C G  +R +C+F   D+  M+  ++  LFANKF + ++   ++ +++   +++
Sbjct:  117 EEVGFPIAYSIVVHHKIEMLDRLLRAIYMPQNFYCIHVDRKAEESFLAAVQGIASCFDNVFVASQLESVVYASWSRVKADLNCMKDLYRMNA-NWKYLINLCGMDFPIKTNLEIVRKLKCSTGENNLETEKMPPNKEERWKKRYTVVDGKLTNTGIVKAPPPLKTPLFSGSAYFVVTREYVGYVLENENIQKLMEWAQDTYSPDEFLWATIQRIP--EVPGSFPSSNKYDLSDMNAIARFVKWQYFEGHVSNGAPYPPCSGVHVRSVCVFGAGDLSWMLRQHH--LFANKFDMDVDPFAIQCLDEHLRHKA 422          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Mouse
Match: Gcnt1 (glucosaminyl (N-acetyl) transferase 1, core 2 [Source:MGI Symbol;Acc:MGI:95676])

HSP 1 Score: 149.828 bits (377), Expect = 5.198e-40
Identity = 95/311 (30.55%), Postives = 158/311 (50.80%), Query Frame = 1
Query:  229 EEINFPIAFGISIYRDAEQFEHLLKAIYRPFNLYCIHVDLSSDARVHEAAIRLSKQFQNVLLTKRFIDVIHSEFSVLESEMLCMEALYQYKKIKWKYFINLTGQEWPLKVNLELVRILKALNGSNLIEKIKL---NSER-------VPSKI-------GPPPDGIKLWKGAVHIVVVRDFVKLALYNKRALNLYEFLKKTYVPDETYFSTLNHDHSFKAPGGYSGDLVRDPINYPFINRYKLW---EGE-------SVCHGKFLRGICIFSMADVPEMINMNNKKLFANKFVIGINDEVLKYMEKWFYNRS 1080
            EE+ FPIA+ I ++   E  + LL+AIY P N YCIHVD  ++     A   ++  F NV +  +   V+++ +S +++++ CM+ LY+     WKY INL G ++P+K NLE+VR LK   G N +E  K+     ER       V  K+        PPP    L+ G+ + VV R++V   L N+    L E+ + TY PDE  ++T+      + PG +      D  +   I R+  W   EG          C G  +R +C+F   D+  M+  ++  LFANKF + ++   ++ +++   +++
Sbjct:  117 EEVGFPIAYSIVVHHKIEMLDRLLRAIYMPQNFYCIHVDRKAEESFLAAVQGIASCFDNVFVASQLESVVYASWSRVKADLNCMKDLYRMNA-NWKYLINLCGMDFPIKTNLEIVRKLKCSTGENNLETEKMPPNKEERWKKRYTVVDGKLTNTGIVKAPPPLKTPLFSGSAYFVVTREYVGYVLENENIQKLMEWAQDTYSPDEFLWATIQRIP--EVPGSFPSSNKYDLSDMNAIARFVKWQYFEGHVSNGAPYPPCSGVHVRSVCVFGAGDLSWMLRQHH--LFANKFDMDVDPFAIQCLDEHLRHKA 422          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. UniProt/SwissProt
Match: sp|Q8CH87|GCNT3_RAT (Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 OS=Rattus norvegicus OX=10116 GN=Gcnt3 PE=1 SV=1)

HSP 1 Score: 168.318 bits (425), Expect = 6.720e-46
Identity = 104/323 (32.20%), Postives = 166/323 (51.39%), Query Frame = 1
Query:  229 EEINFPIAFGISIYRDAEQFEHLLKAIYRPFNLYCIHVDLSSDARVHEAAIRLSKQFQNVLLTKRFIDVIHSEFSVLESEMLCMEALYQYKKIKWKYFINLTGQEWPLKVNLELVRILKALNGSNLIE----------KIKLNSE------RVPSKIGPPPDGIKLWKGAVHIVVVRDFVKLALYNKRALNLYEFLKKTYVPDETYFSTLNHDHSFKAPGGYSGDLVRDPINYPF-------INRYKLW---EGE-------SVCHGKFLRGICIFSMADVPEMINMNNKKLFANKFVIGINDEVLKYMEKWFYNRSRIVYSN 1098
            EE NFPIA+ + I+   E FE LL+A+Y P N+YC+HVD  S     +A   +   F NV +  + + V+++ +S +++++ CME L Q   + W+Y +N  G ++P+K N E+V+ LK LNG N +E          + K + E      R   +  PPP+ I ++ G  ++V  RDF++  L N +A  L E++K TY PDE  ++TL    +   PG        DP++  F       I R   W   EG+       + C G   R IC++   D+  +  + N  L ANKF   ++D VL+ +E+  Y R + +Y  
Sbjct:  127 EEANFPIAYSMVIHEKIENFERLLRAVYTPQNIYCVHVDQKSSETFQQAVRAIVSCFPNVFIANKLVSVVYASWSRVQADLNCMEDLLQ-SPVPWEYLLNTCGTDFPIKTNAEMVKALKLLNGQNSMESEVPPPHKTFRWKYHYEVADTLYRTSKEKTPPPNNITMFTGNAYMVASRDFIEHVLSNSKARQLIEWVKDTYSPDEHLWATLQ--RASWMPGS-------DPLHPKFDLSDMRSIARLTKWQDHEGDIENGAPYTSCSGIHQRAICVYGSGDLHWI--LQNHHLLANKFDPKVDDNVLQCLEE--YLRHKAIYGT 435          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. UniProt/SwissProt
Match: sp|O95395|GCNT3_HUMAN (Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 OS=Homo sapiens OX=9606 GN=GCNT3 PE=2 SV=1)

HSP 1 Score: 167.548 bits (423), Expect = 1.184e-45
Identity = 101/317 (31.86%), Postives = 157/317 (49.53%), Query Frame = 1
Query:  229 EEINFPIAFGISIYRDAEQFEHLLKAIYRPFNLYCIHVDLSSDARVHEAAIRLSKQFQNVLLTKRFIDVIHSEFSVLESEMLCMEALYQYKKIKWKYFINLTGQEWPLKVNLELVRILKALNGSNLIEK-----------------IKLNSERVPSKIGPPPDGIKLWKGAVHIVVVRDFVKLALYNKRALNLYEFLKKTYVPDETYFSTLNHDHSFKAPGGYSGDLVRDPINYPFINRYKLWEGE----------SVCHGKFLRGICIFSMADVPEMINMNNKKLFANKFVIGINDEVLKYMEKWFYNRSRIVYSN 1098
            EE+ FPIA+ + I+   E FE LL+A+Y P N+YC+HVD  S     EA   +   F NV +  + + V+++ +S +++++ CME L Q   + WKYF+N  G ++P+K N E+V+ LK LNG N +E                  ++        K  PPP  + ++ G  +IV  RDFV+  L N ++  L E++K TY PDE  ++TL        PG        D  +   I R   W+G           + C G   R IC++   D+  M  + N  L ANKF   ++D  L+ +E+  Y R + +Y  
Sbjct:  127 EEVEFPIAYSMVIHEKIENFERLLRAVYAPQNIYCVHVDEKSPETFKEAVKAIISCFPNVFIASKLVRVVYASWSRVQADLNCMEDLLQ-SSVPWKYFLNTCGTDFPIKSNAEMVQALKMLNGRNSMESEVPPKHKETRWKYHFEVVRDTLHLTNKKKDPPPYNLTMFTGNAYIVASRDFVQHVLKNPKSQQLIEWVKDTYSPDEHLWATLQRARWM--PGSVPNHPKYDISDMTSIARLVKWQGHEGDIDKGAPYAPCSGIHQRAICVYGAGDLNWM--LQNHHLLANKFDPKVDDNALQCLEE--YLRYKAIYGT 436          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. UniProt/SwissProt
Match: sp|Q866Z6|GCNT3_SHEEP (Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 OS=Ovis aries OX=9940 GN=GCNT3 PE=3 SV=1)

HSP 1 Score: 161.384 bits (407), Expect = 2.580e-43
Identity = 101/317 (31.86%), Postives = 163/317 (51.42%), Query Frame = 1
Query:  229 EEINFPIAFGISIYRDAEQFEHLLKAIYRPFNLYCIHVDLSSDARVHEAAIRLSKQFQNVLLTKRFIDVIHSEFSVLESEMLCMEALYQYKKIKWKYFINLTGQEWPLKVNLELVRILKALNGSNLIEKIKLNSE----------------RVPSKI-GPPPDGIKLWKGAVHIVVVRDFVKLALYNKRALNLYEFLKKTYVPDETYFSTLNHDHSFKAPGGYSGDLVRDPINYPFINRYKLWEGE----------SVCHGKFLRGICIFSMADVPEMINMNNKKLFANKFVIGINDEVLKYMEKWFYNRSRIVYSN 1098
            EE++FPIA+ + ++   E FE LL+A+Y P N+YC+HVD+ S     EA   +   F NV +  + + V+++ +S +++++ CME L Q   + WKY +N  G ++P+K N E+V  LK LNG N +E  ++ SE                 + SK+  PPPD + ++ G  + V  R FV+  L N ++  L E++K TY PDE  ++TL    +   PG           +   I R   W+G           + C G   R ICI+ + D+  +  + N  L ANKF   ++D VL+ +E+  Y R + +Y  
Sbjct:  130 EELDFPIAYSMVVHEKIENFERLLRAVYAPQNIYCVHVDVKSPETFKEAVKAIISCFPNVFMASKLVPVVYASWSRVQADLNCMEDLLQ-SSVPWKYLLNTCGTDFPIKTNAEMVLALKMLNGKNSMES-EIPSEYKKTRWKYRYEVTDRLSLTSKMKDPPPDNLPVFTGNAYFVASRAFVQHVLENPKSQRLIEWVKDTYSPDEHLWATLQ--RAPWMPGSVPYHPKYHISDMTAIARLVKWQGHEGDVSMGAPYAPCSGIHQRAICIYGVGDLHWI--LQNHHLLANKFDPRVDDNVLQCLEE--YLRHKAIYGT 438          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. UniProt/SwissProt
Match: sp|Q7YQE1|GCNT3_BOVIN (Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 OS=Bos taurus OX=9913 GN=GCNT3 PE=1 SV=1)

HSP 1 Score: 160.614 bits (405), Expect = 4.263e-43
Identity = 101/317 (31.86%), Postives = 162/317 (51.10%), Query Frame = 1
Query:  229 EEINFPIAFGISIYRDAEQFEHLLKAIYRPFNLYCIHVDLSSDARVHEAAIRLSKQFQNVLLTKRFIDVIHSEFSVLESEMLCMEALYQYKKIKWKYFINLTGQEWPLKVNLELVRILKALNGSNLIEKIKLNSE----------------RVPSKI-GPPPDGIKLWKGAVHIVVVRDFVKLALYNKRALNLYEFLKKTYVPDETYFSTLNHDHSFKAPGGYSGDLVRDPINYPFINRYKLWEGE----------SVCHGKFLRGICIFSMADVPEMINMNNKKLFANKFVIGINDEVLKYMEKWFYNRSRIVYSN 1098
            EE++FPIA+ + ++   E FE LL+A+Y P N+YC+HVD+ S     EA   +   F NV +  + + V+++ +S +++++ CME L Q   + WKY +N  G ++P+K N E+V  LK LNG N +E  ++ SE                 + SK+  PPPD + ++ G  + V  R FV+  L N ++  L E++K TY PDE  ++TL    +   PG           +   I R   W+G           + C G   R ICI+   D+  +  + N  L ANKF   ++D VL+ +E+  Y R + +Y  
Sbjct:  130 EELDFPIAYSMVVHEKIENFERLLRAVYAPQNIYCVHVDVKSPETFKEAVKAIISCFPNVFMASKLVPVVYASWSRVQADLNCMEDLLQ-SSVPWKYLLNTCGTDFPIKTNAEMVLALKMLNGKNSMES-EIPSEYKKNRWKYRYEVTDRLYLTSKMKDPPPDNLPMFTGNAYFVASRAFVQHVLENPKSQRLIEWVKDTYSPDEHLWATLQ--RAPWMPGSVPYHPKYHISDMTAIARLVKWQGHEGDVSMGAPYAPCSGIHQRAICIYGAGDLHWI--LQNHHLLANKFDPRVDDNVLQCLEE--YLRHKAIYGT 438          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. UniProt/SwissProt
Match: sp|Q866Z5|GCNT3_BOSMU (Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 OS=Bos mutus grunniens OX=30521 GN=GCNT3 PE=3 SV=1)

HSP 1 Score: 160.614 bits (405), Expect = 4.307e-43
Identity = 101/317 (31.86%), Postives = 162/317 (51.10%), Query Frame = 1
Query:  229 EEINFPIAFGISIYRDAEQFEHLLKAIYRPFNLYCIHVDLSSDARVHEAAIRLSKQFQNVLLTKRFIDVIHSEFSVLESEMLCMEALYQYKKIKWKYFINLTGQEWPLKVNLELVRILKALNGSNLIEKIKLNSE----------------RVPSKI-GPPPDGIKLWKGAVHIVVVRDFVKLALYNKRALNLYEFLKKTYVPDETYFSTLNHDHSFKAPGGYSGDLVRDPINYPFINRYKLWEGE----------SVCHGKFLRGICIFSMADVPEMINMNNKKLFANKFVIGINDEVLKYMEKWFYNRSRIVYSN 1098
            EE++FPIA+ + ++   E FE LL+A+Y P N+YC+HVD+ S     EA   +   F NV +  + + V+++ +S +++++ CME L Q   + WKY +N  G ++P+K N E+V  LK LNG N +E  ++ SE                 + SK+  PPPD + ++ G  + V  R FV+  L N ++  L E++K TY PDE  ++TL    +   PG           +   I R   W+G           + C G   R ICI+   D+  +  + N  L ANKF   ++D VL+ +E+  Y R + +Y  
Sbjct:  130 EELDFPIAYSMVVHEKIENFERLLRAVYAPQNIYCVHVDVKSPETFKEAVKAIISCFPNVFMASKLVPVVYASWSRVQADLNCMEDLLQ-SSVPWKYLLNTCGTDFPIKTNAEMVLALKMLNGKNSMES-EIPSEYKKNRWKYRYEVTDRLYLTSKMKDPPPDNLPMFTGNAYFVASRAFVQHVLENPKSQRLIEWVKDTYSPDEHLWATLQ--RAPWMPGSVPYHPKYHISDMTAIARLVKWQGHEGDVSMGAPYAPCSGIHQRAICIYGAGDLHWI--LQNHHLLANKFDPRVDDNVLQCLEE--YLRHKAIYGT 438          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. TrEMBL
Match: A0A0L8GYB5 (Uncharacterized protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22025916mg PE=4 SV=1)

HSP 1 Score: 259.225 bits (661), Expect = 2.764e-77
Identity = 146/317 (46.06%), Postives = 196/317 (61.83%), Query Frame = 1
Query:  229 EEINFPIAFGISIYRDAEQFEHLLKAIYRPFNLYCIHVDLSSDARVHEAAIRLSKQFQNVLLTKRFIDVIHSEFSVLESEMLCMEALYQYKKIKWKYFINLTGQEWPLKVNLELVRILKALNGSNLIEKI--KLNSERVPSKIGPPPDGIKLWKGAVHIVVVRDFVKLALYNKRALNLYEFLKKTYVPDETYFSTLNHDHSFKAPGGYSGDLVRDPINYPFINRYKLWEGE-----SVCHGKFLRGICIFSMADVPEMINMNNKKLFANKFVIGINDEVLKYMEKWFYNRSRIVYSNVNVNPFINLKYYSRLSVVKN 1158
            EE++FP+A+ I +Y+D EQ E LL+AIYRP N YCI+VD  S     +A   ++K F NV +    I V   E+SVLE E+LCM+ L  Y   KWKYFINLTGQE+PLK N ELVRILKA NG+N +E    + N  R  +K GPPP GIK  KG+VH+++ R FV  A+ +  A +L E+ K   +PDETYF+TLNH+   K PG Y+G     P + P+  RYK+WE       S+C GKFLR +C+F++ D+P++       LFANKF +  N  + K +E W +N++R  Y         N  +Y  LS VKN
Sbjct:  197 EELHFPLAYSILMYKDIEQVERLLRAIYRPQNFYCINVDGKSRNSTLKAMKAIAKCFPNVHILSPSIVVRWGEYSVLEPELLCMKHLLVY---KWKYFINLTGQEFPLKTNYELVRILKAYNGANDVEGTQKRANKHRW-AKSGPPPHGIKPIKGSVHVILQRGFVDYAVNSPVAKDLLEWTKTVLIPDETYFATLNHNPHLKVPGSYTGIPETGP-DKPYFARYKIWENSEIPFPSICKGKFLRSVCLFALGDLPKLT--TTPALFANKFHLQYNPLLQKCLEDWHFNKTRDYYL---YKKKFNTSFYENLSFVKN 503          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. TrEMBL
Match: A0A2T7P154 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_12288 PE=4 SV=1)

HSP 1 Score: 249.595 bits (636), Expect = 3.633e-75
Identity = 137/317 (43.22%), Postives = 186/317 (58.68%), Query Frame = 1
Query:  214 NYYLMEEINFPIAFGISIYRDAEQFEHLLKAIYRPFNLYCIHVDLSSDARVHEAAIRLSKQFQNVLLTKRFIDVIHSEFSVLESEMLCMEALYQYKKIKWKYFINLTGQEWPLKVNLELVRILKALNGSNLIEKI--KLNSERVPSKIGPPPDGIKLWKGAVHIVVVRDFVKLALYNKRALNLYEFLKKTYVPDETYFSTLNHDHSFKAPGGYSGDLVRDPINYPFINRYKLWEGESVCHGKFLRGICIFSMADVPEMINMNNKKLFANKFVIGINDEVLKYMEKWFYNRSRIVYSNVNVNPFINLKYYSRLSVVKN 1158
            N+   EE NFPIA+ I +++DA Q   LL+AIYRP N+YCIHVD  +D    +    ++  F NV LT R +DV    F+VLE E++CM+ L+ +K  KWKYFINLTGQE+PL+ N ELVRIL A NG+N +E I  + N ER  S  GP P GI   KG+VHIVV RDFV   L++  A +   + ++  VPDET+F++LNH+      G Y G    DP+  PF+ R+K W       G F R ICI S  D+P +      ++FANKF    +   L+ + +  YN +R  +  +      N  YY  +S VKN
Sbjct:   55 NFLTEEERNFPIAYSILVFKDAHQVTQLLQAIYRPQNVYCIHVDQKADQSYRDTMAAIADCFHNVFLTSRSVDVRWGTFTVLEPELICMKDLWHFK--KWKYFINLTGQEFPLRTNFELVRILTAYNGANDVESIVKRANKERWASA-GPTPHGIIPVKGSVHIVVNRDFVDYVLHSPVAQDFLNWTRRVDVPDETFFASLNHNPQLGIRGSYKGYPETDPVTKPFLTRFKNWGDYPCAEGNFNRDICILSTGDLPLLD--TRPEMFANKFYQDYSRVALECLHERLYNHTRDEFLGMME---FNTSYYQNVSFVKN 363          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. TrEMBL
Match: A0A2T7P144 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_12287 PE=4 SV=1)

HSP 1 Score: 246.514 bits (628), Expect = 5.866e-74
Identity = 134/317 (42.27%), Postives = 186/317 (58.68%), Query Frame = 1
Query:  214 NYYLMEEINFPIAFGISIYRDAEQFEHLLKAIYRPFNLYCIHVDLSSDARVHEAAIRLSKQFQNVLLTKRFIDVIHSEFSVLESEMLCMEALYQYKKIKWKYFINLTGQEWPLKVNLELVRILKALNGSNLIEKI--KLNSERVPSKIGPPPDGIKLWKGAVHIVVVRDFVKLALYNKRALNLYEFLKKTYVPDETYFSTLNHDHSFKAPGGYSGDLVRDPINYPFINRYKLWEGESVCHGKFLRGICIFSMADVPEMINMNNKKLFANKFVIGINDEVLKYMEKWFYNRSRIVYSNVNVNPFINLKYYSRLSVVKN 1158
            N+   EE NF IA+ I +++DA Q   LL+AIYRP N+YCIHVD  +D    +    ++  F NV LT R +DV    F+VLE E++CM+ L+ +KK  WKYFINLTGQE+PL+ N ELVRIL A NG+N +E I  + N ER  S  GP P GI L KGAVHI V RDFV   L++  A +   + ++ ++PDET+F++LNH+      G Y G    DP+  PF+ R+K W       G ++R ICI S  D+P +      ++FANKF    +   L+ + +  YN  R  +  +      +  YY  +S VKN
Sbjct:   60 NFLTEEERNFSIAYSILVFKDAHQVTQLLQAIYRPQNVYCIHVDQKADQSYRDTMAAIADCFHNVFLTSRSVDVRWGTFTVLEPELICMKDLWHFKK--WKYFINLTGQEFPLRTNFELVRILTAYNGANDVESIVKRANKERWASA-GPTPHGIILVKGAVHIAVNRDFVDYVLHSPVAQDFLNWTRRVHIPDETFFASLNHNPQLGIRGSYKGYPETDPVTKPFLTRFKNWGDYPCAEGNWIRDICILSTGDLPLLD--KRPEMFANKFYQDYSRVALECLHQRLYNHMRDEFLGMME---FDTSYYQNVSFVKN 368          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. TrEMBL
Match: A0A0B7A221 (Uncharacterized protein (Fragment) OS=Arion vulgaris OX=1028688 GN=ORF89186 PE=4 SV=1)

HSP 1 Score: 245.743 bits (626), Expect = 3.868e-73
Identity = 137/310 (44.19%), Postives = 183/310 (59.03%), Query Frame = 1
Query:  229 EEINFPIAFGISIYRDAEQFEHLLKAIYRPFNLYCIHVDLSSDARVHEAAIRLSKQFQNVLLTKRFIDVIHSEFSVLESEMLCMEALYQYKKIKWKYFINLTGQEWPLKVNLELVRILKALNGSNLIEKIKLNSERVPSKIGPPPDGIKLWKGAVHIVVVRDFVKLALYNKRALNLYEFLKKTYVPDETYFSTLNHDHSFKAPGGYSGDLVRDPINYPFINRYKLWEGESVCHGKFLRGICIFSMADVPEMINMNNKKLFANKFVIGINDEVLKYMEKWFYNRSRIVYSNVNVNPFINLKYYSRLSVVKN 1158
            EE NFP+A+ I +Y DAE  E LL+AIYRP N YCIHVD  S    + A   ++K F NV LT + IDV   +FSVLE E+ CM+ L +Y   KWKYF+NLTGQE+PLK N ELV+IL A +G+N IE    +++        PP GI+  KG+VHI V RDFV   L+N  + +   + K T VPDETYF++L  +      G Y G  V      P++ RYK WE E  C G+F+R +CI S  D+P +     K+LFANKF +  +  V+  +E+  +N +R  Y  +      N  YY+ L  VKN
Sbjct:  107 EEANFPLAYSIMVYTDAEMVEKLLRAIYRPQNYYCIHVDKKSTDVFYRAMSSIAKCFSNVFLTSKRIDVQWGKFSVLEPELQCMKELCKYP--KWKYFLNLTGQEYPLKTNFELVKILTAYDGANDIECKIQSADNSRWNNSVPPHGIQGVKGSVHIAVNRDFVDYVLHNNISKSFMLWSKNTIVPDETYFASLQCNPQLGIRGSYKGKSVDTK---PYLTRYKQWEDEGPCAGRFVRRVCILSTGDLPRLGKA--KELFANKFYLDEDRIVVGCLEEQLFNNTRDEYMGIKT---FNADYYTSLDFVKN 406          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. TrEMBL
Match: A0A2T7NME5 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_18141 PE=4 SV=1)

HSP 1 Score: 243.817 bits (621), Expect = 9.323e-73
Identity = 137/325 (42.15%), Postives = 199/325 (61.23%), Query Frame = 1
Query:  223 LMEEINFPIAFGISIYRDAEQFEHLLKAIYRPFNLYCIHVDLSSDARVHEAAIRLSKQFQNVLLTKRFIDVIHSEFSVLESEMLCMEALYQYKKIKWKYFINLTGQEWPLKVNLELVRILKALNGSNLIEKIK--LNSERVPSKIGPPPDGIKLWKGAVHIVVVRDFVKLALYNKRALNLYEFLKKTYVPDETYFSTLNHDHSFKAPGGYSGDLVRDPINYPFINRYKLW-----EGES------VCHGKFLRGICIFSMADVPEMINMNNKKLFANKFVIGINDEVLKYMEKWFYNRSRIVYSNVNVNPFINLKYYSRLSVVKN 1158
            L EE +FP+A+ + +Y+D E  E +L+AIYRP N YC+HVD  +D  + EA   ++   +NV +    +DVI  EFSVLE E++CM  L++YK  KW+YFINLTGQE+PLK NL+LVRIL ALNGSNL++      +++R  +    PP GIK +KG VH+VV R FV   L+N  A +   +L++T VPDE++FSTLN++   + PG Y G    D    P++ R+K W     +G         C+GK +R IC+F + D+P +   + K+LFANKF I      L+ +E W YN +   Y+       +++ +Y  L +VKN
Sbjct:   56 LPEEESFPLAYSMVLYKDIELVERILRAIYRPHNFYCLHVDQKADPSLLEAVRSIASCLENVFVASESVDVIWGEFSVLEPELVCMRDLWRYK--KWRYFINLTGQEFPLKTNLQLVRILTALNGSNLVDCTTNGRDNDRWYNNFL-PPHGIKPYKGNVHVVVNRGFVDYILHNPVAHDYLSWLRRTDVPDESFFSTLNYNPHLRVPGAYLGPPDTDAHLKPYLARFKNWGHNWRDGLDRMNFNWPCYGKRVRTICVFGVGDLPMLT--SRKELFANKFYINFEPLTLQCLEDWLYNMTVDEYAG---RVSMDVSFYKNLDIVKN 372          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Cavefish
Match: ENSAMXT00000050168.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001873.1:355693:357685:-1 gene:ENSAMXG00000033034.1 transcript:ENSAMXT00000050168.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 167.933 bits (424), Expect = 5.825e-47
Identity = 101/309 (32.69%), Postives = 158/309 (51.13%), Query Frame = 1
Query:  229 EEINFPIAFGISIYRDAEQFEHLLKAIYRPFNLYCIHVDLSSDARVHEAAIRLSKQFQNVLLTKRFIDVIHSEFSVLESEMLCMEALYQYKKIKWKYFINLTGQEWPLKVNLELVRILKALNGSNLIEKIKLNS-------ERVPSKIG----------PPPDGIKLWKGAVHIVVVRDFVKLALYNKRALNLYEFLKKTYVPDETYFSTLNHDHSFKAPGGYSGDLVRDPINYPFINRYKLWEGES--------VCHGKFLRGICIFSMADVPEMINMNNKKLFANKFVIGINDEVLKYMEKWFYNRS 1080
            EE  FP+A+ I ++   + FE LL++IY P N YCIHVD  +      A       F NV +  +  +V+++ +S +++++ CM+ LYQ    +WKYFINL GQ++P+K NLE+VR LK L+G N +E   + S       +R   K G          PPP  IK++ G  +IVV R F++  L + +A  L  + K TY PDE  ++T+        PG        D  +   I+R   W G           C G  +R IC++ + D+  M+  ++  LFANKF    +   ++ +EK   N++
Sbjct:  109 EEEAFPLAYSIVVHHKVQNFERLLRSIYAPQNFYCIHVDKKASESTRAAINATVSCFDNVFIASQLEEVVYASWSRVQADINCMKDLYQISD-RWKYFINLCGQDFPMKTNLEMVRALKGLHGGNSLETETMPSNKEYRWKKRHIVKNGAIQYTNEAKKPPPSRIKMFSGGAYIVVSRAFIRFVLEDPKAQELISWSKDTYSPDEFLWATMQRIPG--VPGYIRAHHKFDRSDMNTISRLIKWAGHEGEFDAVYPPCQGTHVRAICVYGVGDLQWMLQQDH--LFANKFDTDFDPIAIRCLEKHLRNKA 412          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Cavefish
Match: ENSAMXT00000026751.2 (glucosaminyl (N-acetyl) transferase 1 [Source:NCBI gene;Acc:103024919])

HSP 1 Score: 167.933 bits (424), Expect = 6.881e-47
Identity = 103/309 (33.33%), Postives = 160/309 (51.78%), Query Frame = 1
Query:  229 EEINFPIAFGISIYRDAEQFEHLLKAIYRPFNLYCIHVDLSSDARVHEAAIRLSKQFQNVLLTKRFIDVIHSEFSVLESEMLCMEALYQYKKIKWKYFINLTGQEWPLKVNLELVRILKALNGSNLIEKIKLNS-------ERVPSKIG----------PPPDGIKLWKGAVHIVVVRDFVKLALYNKRALNLYEFLKKTYVPDETYFSTLNHDHSFKAPGGYSGDLVRDPINYPFINRYKLW---EGE-----SVCHGKFLRGICIFSMADVPEMINMNNKKLFANKFVIGINDEVLKYMEKWFYNRS 1080
            EE  FP+A+ I ++   + FE LL++IY P N YCIHVD  +      A       F NV +  +  +V+++ +S +++++ CM+ LYQ    +WKYFINL GQ++P+K NLE+VR LK L+G N +E   + S       +R   K G          PPP GIK++ G  +IVV R F++  L + +A  L  + K TY PDE  ++T+        PG        D  +   I+R   W   EG+       C G  +R IC++   D+  M+  ++  LFANKF    +   ++ +EK   N++
Sbjct:  115 EEEAFPLAYSIVVHHKVQNFERLLRSIYAPQNFYCIHVDKKASESTRAAINATVSCFDNVFIASQLEEVVYASWSRVQADINCMKDLYQISD-RWKYFINLCGQDFPMKTNLEMVRALKGLHGGNSLETETMPSNKEYRWKKRHIVKNGDIHNTNEAKKPPPSGIKMFSGGAYIVVSRVFIRFVLEDPKAQELILWSKDTYSPDEFLWATMQRIPG--VPGYIRAHHKFDRTDMNTISRLIKWVYHEGDFDAVYPPCQGTHVRSICVYGAGDLQWMLQQDH--LFANKFDTDFDPIAIRCLEKHLRNKA 418          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Cavefish
Match: gcnt3 (glucosaminyl (N-acetyl) transferase 3, mucin type [Source:ZFIN;Acc:ZDB-GENE-110411-253])

HSP 1 Score: 151.369 bits (381), Expect = 1.294e-40
Identity = 94/311 (30.23%), Postives = 151/311 (48.55%), Query Frame = 1
Query:  226 MEEINFPIAFGISIYRDAEQFEHLLKAIYRPFNLYCIHVDLSSDARVHEAAIRLSKQFQNVLLTKRFIDVIHSEFSVLESEMLCMEALYQYKKIKWKYFINLTGQEWPLKVNLELVRILKALNGSNLIEKIKLNSE----------------RVPSKIGPPPDGIKLWKGAVHIVVVRDFVKLALYNKRALNLYEFLKKTYVPDETYFSTLNHDHSFKAPGGYSGDLVRDPINYPFINRYKLW---EGE-------SVCHGKFLRGICIFSMADVPEMINMNNKKLFANKFVIGINDEVLKYMEKWFYNRS 1080
            +EE +FPIAF + I+   E FE LL+AIY P N+YC+HVD  S     EA   ++    NV +  +   V+++ +S +++++ CM+ L +   ++W+Y +N  G ++P+K N E+VR LK LNG N +E    N                  R   K   PP    ++ G  + VV R+FV+    +   LN  E+ K TY PDE  ++TL    +   PG    +   D  +   I R   W   EG+         C G     +C++   D+  ++    K LFANKF   ++D  +K +E +   ++
Sbjct:  113 IEERDFPIAFSMVIHEKIEMFERLLRAIYSPQNIYCVHVDTKSSKEFMEAVKAITSCLPNVFVASKLESVVYASWSRVQADINCMQDLLK-SSVQWRYLLNTCGADFPIKTNAEMVRTLKQLNGRNSMESEATNDYKKQRWVYQHNVTTSVIRTSIKKTDPPIKSPMFTGNAYFVVSREFVEHMFSSPEILNFMEWEKDTYSPDEHMWATLQRMPNM--PGSNPPNGKYDESDMLAIARLVKWSYLEGDLRKGAPYPPCTGAHRHAVCVYGAGDIKWIV--RQKHLFANKFDPEVDDIAIKCLEAYLSGQT 418          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Cavefish
Match: gcnt7 (glucosaminyl (N-acetyl) transferase family member 7 [Source:NCBI gene;Acc:103030892])

HSP 1 Score: 143.665 bits (361), Expect = 7.212e-38
Identity = 97/305 (31.80%), Postives = 160/305 (52.46%), Query Frame = 1
Query:  229 EEINFPIAFGISIYRDAEQFEHLLKAIYRPFNLYCIHVDLSSDARVHEAAIRLSKQFQNVLLTKRFIDVIHSEFSVLESEMLCMEALYQYKKIKWKYFINLTGQEWPLKVNLELVRIL-----------------KALNGSNLIEKIKLNSERVPS---KIGPPPDGIKLWKGAVHIVVVRDFVKLALYNKRALNLYEFLKKTYVPDETYFSTLNHDHSFKAPGG-----YSGDLVRDPINYPFINRYKLWEGES--VCHGKFLRGICIFSMADVPEMINMNNKKLFANKFVIGINDEVLKYMEK 1062
            EE ++P+AF I+I+++ E F  LL+AIY P N+YCIHVD  +     ++  +L+  F NV L      V ++ FS L++++ CM+ L +   +KW+  INL GQ++P+  NLEL+R +                 K++     I+ +++N   V     +   PP  ++++ G  +  + R FV   L +  A +L E+ K TY PDE Y+ TLN  H   APG      + G++           ++K  EG +   C G ++R ICI+++ D+P +I  N+  +FANKF      E L  +E+
Sbjct:   97 EEEDYPLAFIITIHKEFEMFVRLLRAIYVPQNIYCIHVDAKAPKDYKDSVRKLAGCFPNVFLASISEKVAYAGFSRLKADINCMQDLAR-SPVKWRKVINLCGQDFPIMSNLELIRYMQEAEWRDRNMTPGIKQPKSMQHRTQIQHVEINGVYVAPRKRRKNLPPHNLQIYFGTAYYALTRAFVDYVLNSSVAKDLLEWSKDTYSPDEHYWVTLN--HVIDAPGSNIEGEWEGNIR--------AIKWKDQEGTAHQGCKGHYVRDICIYAVEDLPWIIEKNS--MFANKFESTSFPEALDCLEQ 388          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Cavefish
Match: gcnt4a (glucosaminyl (N-acetyl) transferase 4 [Source:NCBI gene;Acc:103033386])

HSP 1 Score: 137.887 bits (346), Expect = 8.571e-36
Identity = 89/303 (29.37%), Postives = 154/303 (50.83%), Query Frame = 1
Query:  229 EEINFPIAFGISIYRDAEQFEHLLKAIYRPFNLYCIHVDLSSDARVHEAAIRLSKQFQNVLLTKRFIDVIHSEFSVLESEMLCMEALYQYKKIKWKYFINLTGQEWPLKVNLELVRILKALNGSNLIEKIK---LNSER----------------VPSKI----GPPPDGIKLWKGAVHIVVVRDFVKLALYNKRALNLYEFLKKTYVPDETYFSTLNHDHSFKAPGGYSGDLVRDPINYPFINRYKLWEGE--SVCHGKFLRGICIFSMADVPEMINMNNKKLFANKFVIGINDEVLKYMEK 1062
            EE NFP+A+ + ++++    E +++AIY P N+YCIH D  S      A   L+K F N+ +  +   V ++  + L +++ C+  L    ++KWKY INL GQ++PL+ N ELV  LK LNG+N++E  +   L  ER                +P K       PP  I+++ G+ + V+ RDFV      + A +  ++   TY PDE +++TL            S   V D  +   + +++  EG     C G  +R +CI+  A++  +  +++   FANKF   ++  ++K +E+
Sbjct:  119 EEKNFPLAYSLVVHKNMPMVERIIRAIYAPTNIYCIHYDQKSSESFIAAVKNLAKCFPNIFIASKLESVEYAHITRLNADLNCLSDLMS-SEVKWKYAINLCGQDFPLRSNYELVEELKKLNGANMLESSRPSELKRERFVFQHKLQDVPYEYHKLPIKTTNAKSAPPHDIEMFIGSAYFVLSRDFVHYVQTAQVAKDFLDWSADTYSPDEHFWATLARVPGVPGEIPRSEPDVTDLKSKTRLVKWEYLEGSLYPGCTGTHMRSVCIYGAAELRWL--LDDGHWFANKFDPKVDPVLIKCLEE 418          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Sea Lamprey
Match: GCNT2 (glucosaminyl (N-acetyl) transferase 2 (I blood group) [Source:HGNC Symbol;Acc:HGNC:4204])

HSP 1 Score: 164.081 bits (414), Expect = 2.176e-46
Identity = 109/330 (33.03%), Postives = 163/330 (49.39%), Query Frame = 1
Query:  229 EEINFPIAFGISIYRDAEQFEHLLKAIYRPFNLYCIHVDLSSDARVHEAAIRLSKQFQNVLLTKRFIDVIHSEFSVLESEMLCMEALYQYKKIKWKYFINLTGQEWPLKVNLELVRILK-ALNGSNL---------------------IEKIKLNSERVPSKIGPPPDGIKLWKGAVHIVVVRDFVKLALYNKRALNLYEFLKKTYVPDETYFSTLNHDHSFKAPGGYSGDLVRDPINYPFINRYKLWEGESV-------------CHGKFLRGICIFSMADVPEMINMNNKKLFANKFVIGINDEVLKYMEKWFYNRSRIVYSNVNVNP 1113
            EE +FP+A+ I++++D E F  L + IY P N+YCIHVD+ S     ++  RL+  F NV L  R   V+++ FS L++++ CM  L   +   WKY +NL GQ++PL+ N E+VRILK    G N+                     ++K K    R     GPPP GI L  G  +  V R+FV+  L +K+A +L E+ ++T+ PDE YF TLN      APG                N    WEG +              C G ++R IC++   D+  +   ++  LFANKF +     VL+ +E W   R+ +  S V + P
Sbjct:   88 EEQDFPLAYIITVHKDFETFSILFRNIYMPQNIYCIHVDVKSSESFKKSMQRLAGCFDNVFLASRSETVVYAGFSRLKADINCMRDL-ATRPTPWKYVLNLCGQDFPLRTNQEIVRILKNKWRGKNITPGIFQPPHMKWRTQYVYKEVVDKDKKQMIRTNVAKGPPPHGINLCFGTAYYAVTREFVQYVLDDKKAQDLLEWSQETFSPDEHYFVTLNSLPD--APGA---------------NTVPSWEGNTRAVKWRDGEKTHKGCKGHYVRDICVYGEGDLEWLTKRSD--LFANKFEMQRYPLVLECLEHWARQRT-LNESEVRIQP 396          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Sea Lamprey
Match: gcnt4a (glucosaminyl (N-acetyl) transferase 4a [Source:NCBI gene;Acc:324510])

HSP 1 Score: 153.68 bits (387), Expect = 1.117e-42
Identity = 91/307 (29.64%), Postives = 162/307 (52.77%), Query Frame = 1
Query:  229 EEINFPIAFGISIYRDAEQFEHLLKAIYRPFNLYCIHVDLSSDARVHEAAIRLSKQFQNVLLTKRFIDVIHSEFSVLESEMLCMEALYQYKKIKWKYFINLTGQEWPLKVNLELVRILKALNGSNLIEKIKLNS----------------------ERVPSKIGPPPDGIKLWKGAVHIVVVRDFVKLALYNKRALNLYEFLKKTYVPDETYFSTLNHDHSFKAPGGYSGDLVRDPINYPFINRYKLWEGE--SVCHGKFLRGICIFSMADVPEMINMNNKKLFANKFVIGINDEVLKYMEKWFYNR 1077
            EE +FPIA+ I ++++A   E LL+AI+ P N+YC+HVD  S      A   L+K F NV +  +  +V ++  S L++++ C+  L +   ++WKY INL GQ++PL+ N ELV  LK+L G +++E  K ++                      +   + + P P G++++ G+ + V+ R+FV+ A+ +  A +   +   TY PDE +++TL         GG     V D  +   + ++   EG    VC G+ +R +CI+  A++  +  + +   FANKF   ++  V+K +E+   +R
Sbjct:   57 EERDFPIAYSIVVHKNAATLERLLRAIFVPQNVYCVHVDTKSSTTFKSAVQSLAKCFDNVFVASKLEEVHYAHISRLQADINCLADLLK-SPVRWKYAINLCGQDFPLRSNRELVSELKSLQGRSMLETGKPSAYKQQRFTHKFVLERRDSSLPALQHTQTALAPAPHGLEVFVGSAYFVLSREFVRFAITSAVAADFLRWCADTYSPDEHFWATLARSPQAPGGGGGGKADVSDLQSKTRLVKWSYLEGRLYPVCSGRHVRSVCIYGAAELGWL--LRDGHWFANKFDPHVDPVVVKCLEEEISSR 360          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Sea Lamprey
Match: gcnt4a (glucosaminyl (N-acetyl) transferase 4a [Source:NCBI gene;Acc:324510])

HSP 1 Score: 153.295 bits (386), Expect = 1.198e-42
Identity = 91/307 (29.64%), Postives = 162/307 (52.77%), Query Frame = 1
Query:  229 EEINFPIAFGISIYRDAEQFEHLLKAIYRPFNLYCIHVDLSSDARVHEAAIRLSKQFQNVLLTKRFIDVIHSEFSVLESEMLCMEALYQYKKIKWKYFINLTGQEWPLKVNLELVRILKALNGSNLIEKIKLNS----------------------ERVPSKIGPPPDGIKLWKGAVHIVVVRDFVKLALYNKRALNLYEFLKKTYVPDETYFSTLNHDHSFKAPGGYSGDLVRDPINYPFINRYKLWEGE--SVCHGKFLRGICIFSMADVPEMINMNNKKLFANKFVIGINDEVLKYMEKWFYNR 1077
            EE +FPIA+ I ++++A   E LL+AI+ P N+YC+HVD  S      A   L+K F NV +  +  +V ++  S L++++ C+  L +   ++WKY INL GQ++PL+ N ELV  LK+L G +++E  K ++                      +   + + P P G++++ G+ + V+ R+FV+ A+ +  A +   +   TY PDE +++TL         GG     V D  +   + ++   EG    VC G+ +R +CI+  A++  +  + +   FANKF   ++  V+K +E+   +R
Sbjct:   58 EERDFPIAYSIVVHKNAATLERLLRAIFVPQNVYCVHVDTKSSTTFKSAVQSLAKCFDNVFVASKLEEVHYAHISRLQADINCLADLLK-SPVRWKYAINLCGQDFPLRSNRELVSELKSLQGRSMLETGKPSAYKQQRFTHKFVLERRDSSLPALQHTQTALAPAPHGLEVFVGSAYFVLSREFVRFAITSAVAADFLRWCADTYSPDEHFWATLARSPQAPGGGGGGKADVSDLQSKTRLVKWSYLEGRLYPVCSGRHVRSVCIYGAAELGWL--LRDGHWFANKFDPHVDPVVVKCLEEEISSR 361          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Sea Lamprey
Match: gcnt3 (glucosaminyl (N-acetyl) transferase 3, mucin type [Source:ZFIN;Acc:ZDB-GENE-110411-253])

HSP 1 Score: 154.066 bits (388), Expect = 2.438e-42
Identity = 91/306 (29.74%), Postives = 154/306 (50.33%), Query Frame = 1
Query:  229 EEINFPIAFGISIYRDAEQFEHLLKAIYRPFNLYCIHVDLSSDARVHEAAIRLSKQFQNVLLTKRFIDVIHSEFSVLESEMLCM-EALYQYKKIKWKYFINLTGQEWPLKVNLELVRILKALNGSNLIEKIKLNSER-----VPSKIG------------PPPDGIKLWKGAVHIVVVRDFVKLALYNKRALNLYEFLKKTYVPDETYFSTLNHDHSFKAPGGYSGDLVRDPINYPFINRYKLW---EGESV--------CHGKFLRGICIFSMADVPEMINMNNKKLFANKFVIGINDEVLKYME 1059
            EE  FPIA+ +  +   +  E LL+A+Y P NLYC+HVD  S     EAA  L+  F NV +      V+++ +S +++++ CM E +   +++ W+YFINL G+++P+K NLE+VR L+ LNG N +E +++   +     +  K+             PPP    ++ G+ ++VV R FV+  L +  A  L E+   TY PDE  ++TL        PG      + D  +   + R   W   EG+          C G  +R +C++   D+  ++  ++  LFANK    ++   +  +E
Sbjct:  120 EEEAFPIAYSVVAHHRVDMLERLLRAVYAPQNLYCLHVDAKSPRAYLEAARALAACFPNVFVAAHLERVVYASWSRVQADLNCMSELVAMAERVPWRYFINLCGRDFPIKTNLEMVRALRTLNGRNSLETVRMPRGKRARWTLSYKVAGNEIRSTGLTKRPPPIPTPMFAGSAYVVVTRAFVEHVLSDPAARALIEWAGDTYSPDEHLWATLQRMPGV--PGSTPAHRIHDVTDAAALARLVKWSAFEGDVAGGGAAYPPCRGTHVRDVCVYGAGDLAWVLRQHH--LFANKVDTAVDHVAVHCLE 421          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Sea Lamprey
Match: gcnt3 (glucosaminyl (N-acetyl) transferase 3, mucin type [Source:ZFIN;Acc:ZDB-GENE-110411-253])

HSP 1 Score: 150.984 bits (380), Expect = 3.838e-41
Identity = 99/317 (31.23%), Postives = 157/317 (49.53%), Query Frame = 1
Query:  229 EEINFPIAFGISIYRDAEQFEHLLKAIYRPFNLYCIHVDLSSDARVHEAAIRLSKQFQNVLLTKRFIDVIHSEFSVLESEMLCMEALYQYKKIKWKYFINLTGQEWPLKVNLELVRILKALNGSNLIEKIKLNSERV-----------------PSKIGPPPDGIKLWKGAVHIVVVRDFVKLALYNKRALNLYEFLKKTYVPDETYFSTLNHDHSFKAPGG---YSGDLVRDPINYPFINRYKLWEGESV-------CHGKFLRGICIFSMADVPEMINMNNKKLFANKFVIGINDEVLKYMEKWFYNRS-RIVYS 1095
            EE  FPIA+ +  +   +  E LL+AIY P N+YC+HVD  S     EA   L+  F NV +  R   V+++ +  +++++ CM  L    +  WKYFINL G ++P+K NLE+VR L+ALNG N +E +     +V                   K  PPP    ++ G  +IVV R FV+  L +  A  L E+ K T+ PDE  ++TL        PG    +    V D +    + R+   EG+++       C G  +R ICI S  D+  +  +  + LF NK    +++  +  +E++   ++ R V+S
Sbjct:  117 EEAAFPIAYSVVAHHRVDMLERLLRAIYAPQNVYCLHVDQKSPPPYQEAVRALAACFPNVFMASRQERVVYTSWLRVQADLNCMRDLVAAPQ-PWKYFINLCGLDFPIKTNLEMVRALRALNGENSMESMHTPGGKVGRWQIRHEIVNDGLRSTGEKKSPPPIPTPMFSGNAYIVVTRAFVEHVLSDPTARALMEWEKDTFSPDEHLWATLQRLPGV--PGSTPPHDKYDVEDMMAIARLVRWSYMEGDTLQGAAYPPCRGTHMRAICINSAKDLAWV--LKQRHLFVNKLDSDVDELAVHCLERYLRRKALRQVFS 428          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Nematostella
Match: EDO39617 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9I5])

HSP 1 Score: 177.563 bits (449), Expect = 1.696e-52
Identity = 103/274 (37.59%), Postives = 160/274 (58.39%), Query Frame = 1
Query:  232 EINFPIAFGISIYRDAEQFEHLLKAIYRPFNLYCIHVDLSSDARVHEAAIRLSKQFQNVLLTKRFIDVIHSEFSVLESEMLCMEALYQYKKIKWKYFINLTGQEWPLKVNLELVRILKALNGSNLIEKIKL---NSERVP--------SKIGPPPDGIKLWKGAVHIVVVRDFVKLALYNKRALNLYEFLKKTYVPDETYFSTLNHDHSFKAPGGYSGDLVRDPINYPFINRYKLWEGESVCHGKFLRGICIFSMADVPEMIN-MNNKKLFANK 1017
            E++FPIA+GI IY+    FE LL+A+Y P N YCIH+D  +++   +AA R+     NV + K  ++V   E S++++E+ CM  L  +   KWKY+INL GQ++PL  N+E+VR+LK+L+G N IE I++   N  RV          +  PPP G+ + KG+VH ++ R F +  L +K A +L ++L+  +  DE +F+TL +D +   PGG  G           I R K W     C G+++R IC   + D+  +++  NN+KLF NK
Sbjct:   16 ELDFPIAYGILIYKGLPLFERLLQALYMPQNYYCIHIDKKTNSYFVDAAQRMVACLPNVFIAKTRVNVKWGEISLVKAELSCMTELQTF---KWKYYINLVGQDFPLYNNMEIVRVLKSLHGLNNIESIEMPAYNVHRVEFVRHGQKLLRKSPPPHGLIIRKGSVHGILTRKFTEFVLRDKVARDLLKWLEDVFAADEIFFATLQYDQA--TPGGIHGQ------QPECIARVKRWR-PGYCAGRYVRNICWIDIRDLTWVLSEGNNRKLFVNK 277          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Nematostella
Match: EDO37446 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFS7])

HSP 1 Score: 161.384 bits (407), Expect = 3.795e-46
Identity = 98/298 (32.89%), Postives = 158/298 (53.02%), Query Frame = 1
Query:  232 EINFPIAFGISIYRDAEQFEHLLKAIYRPFNLYCIHVDLSSDARVHEAAIRLSKQFQNVLLTKRFIDVIHSEFSVLESEMLCMEALYQYKKIKWKYFINLTGQEWPLKVNLELVRILKALNGSNLIEKIKLN------------SERVPSKI--GPPPDGIKLWKGAVHIVVVRDFVKLALYNKRALNLYEFLKKTYVPDETYFSTL-NHDHSFKAPGGYSGDLVRDPINYPFINRYKLWEGESVCHGKFLRGICIFSMADVPEMINMNNKK-LFANKFVIGINDEVLKYMEKWFYNR 1077
            E +FP+AFGI IY     FE LL+ IY P N+YCIH+D  +    H+A  ++     NV +  + + V   EFS+++++M C+  L +   +KWKY++++ GQ++PL  N E+VR +K LN +N +E IK+               R  +KI   PPP  I L KG +H ++ R FV+  L ++ A    ++   T VPDET+F+++ NH     APGG  GD        P+I +   W     C+G+ +R +C   + D+  +++  N   LF +K     + E+L  + +    R
Sbjct:    2 ERDFPLAFGIMIYNGLPLFERLLQEIYMPHNVYCIHIDRKTRQSFHKAVKQMISCLPNVFIASKLVKVYWGEFSIVQAKMNCLRNLLK-SPVKWKYYLHMIGQDFPLYTNHEMVRAIKTLNYTNNMESIKVPISNRDRTEYVYIGSRTRTKILKPPPPFNITLRKGNIHAMLTRGFVEFLLESEIANAFIDWCNDTSVPDETFFASMQNHP---GAPGGVVGD------QPPYIFKLIRWYWFDRCYGRIIRQVCWIDIKDLRSVLSQFNLSFLFVHKIPFDYDIELLDCLSQSLVGR 289          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Nematostella
Match: EDO36835 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHI4])

HSP 1 Score: 60.8474 bits (146), Expect = 5.662e-10
Identity = 72/307 (23.45%), Postives = 126/307 (41.04%), Query Frame = 1
Query:  247 IAFGISIY-RDAEQFEHLLKAIYRPFNLYCIHVDLSSDARVHEAAIRLSKQFQNVLLTKRFIDVIHSEFSVLESEMLCMEALYQYKKIKWKYFINLTGQEWPLKVNLELVRILKALNGSNLIEKIKLNSERVPSKIG------------------PPPDGIKLWKGAVHIVVVRDFVKLALYNKRAL--NLYEFLKKTYVPDETYFSTLNHDHSFKAPGGYSGDLVRDPINYPFINRYKLWEGE--SVCHGKFLRGICIFSMADV-PE---MINMNNKK---LFANKFVIGINDEVLKYMEKWFYNR 1077
            IA+ +S++ R   Q   L K IY   + +  H+D  SD    E +  + K F N  L    +  I    ++L+  +  ME L   K+ KW +FINL+G ++P+KVN  L   L++    N ++    +  R   K G                    P  + +  G+  I + R +    + ++  L   L    + T +P E++F      H+    G +  + +   +      R   W+ +    C  K +   C  S  +  PE    I +N  +    FA KF   +N EV+  +++W Y +
Sbjct:   80 IAYVLSLHGRALRQIRRLFKVIYHTHHYFYFHIDTRSDYLRREVS-NMIKDFPNAALAPWSMATIWGGATLLQMLLKSMEDLIARKEWKWDFFINLSGNDFPIKVNTVLSSFLRSHRDVNFLKPHGRDIARFIKKQGLDRTFLQCDEHMWRLGDRKLPADLDIDGGSDWIALNRKYCDYLVTSRDELVTGLKHMYRYTLLPAESFF------HTALRNGPHCQNWLSSNL------RLTNWKRKLGCRCQYKHIVDWCGCSPNNFKPEDMARIKVNQSQSTNFFARKFEAIVNQEVINQLDEWLYGK 373          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Medaka
Match: ENSORLT00000007218.2 (glucosaminyl (N-acetyl) transferase 1 [Source:NCBI gene;Acc:101157299])

HSP 1 Score: 169.859 bits (429), Expect = 1.483e-47
Identity = 100/312 (32.05%), Postives = 161/312 (51.60%), Query Frame = 1
Query:  229 EEINFPIAFGISIYRDAEQFEHLLKAIYRPFNLYCIHVDLSSDARVHEAAIRLSKQFQNVLLTKRFIDVIHSEFSVLESEMLCMEALYQYKKIKWKYFINLTGQEWPLKVNLELVRILKALNGSNLIEKIKLNSER----------VPSKI-------GPPPDGIKLWKGAVHIVVVRDFVKLALYNKRALNLYEFLKKTYVPDETYFSTLNHDHSFKAPGGYSGDLVRDPINYPFINRYKLW---EGES--------VCHGKFLRGICIFSMADVPEMINMNNKKLFANKFVIGINDEVLKYMEKWFYNRS 1080
            EE +FP+A+ + ++   + FE LL+AIY P N YC+HVD  ++  V  A + +S  F NV L  + +DV+++ +  +++++ CM  LY   + +WKYF+NL GQ++PLK NLE+VRILK LNG N +E   +  E+          V  KI        P P  + +  G  +IV  R ++   L++KR   L E++K TY PDE  ++T+        PG    +   D  +   + R   W   EG          VCHG  +R IC++   D+  +  + N   FANKF    +   +  +E++   ++
Sbjct:  116 EEEDFPLAYSMIVHHKVQNFERLLRAIYAPQNFYCVHVDKKAEPSVFAAILAISSCFPNVFLVSQSVDVVYAGWPRVQADLNCMADLYNTSR-RWKYFLNLCGQDFPLKTNLEMVRILKTLNGGNSMESENMPPEKKWRVTNAHQIVDGKIQAKGEAKSPSPFNLPIMSGNAYIVASRGYIHSVLHDKRIQALIEWMKDTYSPDEAIWATIQRIPG--VPGSTRPNRKYDVSDINALARLVKWQWHEGSQDSLDALYPVCHGNHVRAICVYGAGDLQWL--LENHHFFANKFDTDTDPIAIYCLERYLRKKA 422          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Medaka
Match: gcnt7 (beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 7-like [Source:NCBI gene;Acc:101157298])

HSP 1 Score: 160.229 bits (404), Expect = 5.802e-44
Identity = 107/333 (32.13%), Postives = 172/333 (51.65%), Query Frame = 1
Query:  229 EEINFPIAFGISIYRDAEQFEHLLKAIYRPFNLYCIHVDLSSDARVHEAAIRLSKQFQNVLLTKRFIDVIHSEFSVLESEMLCMEALYQYKKIKWKYFINLTGQEWPLKVNLELVRIL--KALNGSNLIEKIK-----------LNSERVPSKI-------GPPPDGIKLWKGAVHIVVVRDFVKLALYNKRALNLYEFLKKTYVPDETYFSTLNH---DHSFKAPGGYSGDLVRDPINYPFINRYKLWEG--ESVCHGKFLRGICIFSMADVPEMINMNNKKLFANKFVIGINDEVLKYMEKWFYNRSRIV-YSNVNVNPFINLKYYSRLSV 1149
            EE ++P+AF ++I++D E F   L+AIY P N+YCIH+D  +     +    L   F+N+ L+ +   V +  +S L++++ CM+ L +   + WK  +NL GQ++P+K NLELV+ +  K     NL   +K            + E V S +        PPPD ++++ G  +  + R FV   L +  ALNL ++ K  Y PDE Y+ TLNH       +  GG+ GD+           ++K  EG     C G ++R IC++ M D+  +IN NN  +FANKF      E L  +E+W  +RS+++  + + V P   L    +LS 
Sbjct:   98 EEEDYPLAFIMTIHKDLEMFVRTLRAIYMPQNVYCIHIDAKAPLEYKKVVRGLVGCFENIFLSSQSETVTYGGYSRLQADLNCMKDLIR-SNVGWKKVVNLCGQDFPIKSNLELVQYMQSKEWRDKNLTPGVKQPAHIRSRTEFQHQEIVGSHVIQKGEKKEPPPDNLQIYFGTAYYALTRAFVDFVLKSPIALNLLKWSKDAYSPDEHYWVTLNHLKEAPGSRVDGGWEGDIR--------AIKWKDQEGTNHQGCKGHYVRDICVYGMGDIEWIINNNN--MFANKFESNAYPEALDCLEQW--HRSKVLNQAKIPVQPSWVLAITEKLST 417          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Medaka
Match: si:dkeyp-87d8.8 (glucosaminyl (N-acetyl) transferase 4 [Source:NCBI gene;Acc:101166645])

HSP 1 Score: 151.754 bits (382), Expect = 9.647e-41
Identity = 91/325 (28.00%), Postives = 178/325 (54.77%), Query Frame = 1
Query:  229 EEINFPIAFGISIYRDAEQFEHLLKAIYRPFNLYCIHVDLSSDARVHEAAIRLSKQFQNVLLTKRFIDVIHSEFSVLESEMLCMEALYQYKKIKWKYFINLTGQEWPLKVNLELVRILKALNGSNLIEKIKLNS-------------------ERVPSKI----GPPPDGIKLWKGAVHIVVVRDFVKLALYNKRALNLYEFLKKTYVPDETYFSTLNHDHSFKAPGGYSGDLVRD-PINYPFINRYKL--W---EGE--SVCHGKFLRGICIFSMADVPEMINMNNKKLFANKFVIGINDEVLKYMEKWFYNRSRIVYSNVNVN 1110
            +E +FP+A+ + ++++A   E LL+A Y P N+YCIH D  S  +   A   L++   NV +  +   V ++  S L++++ C+  L +  ++KWKY INL GQ++PLK N+ELV  L+ LNGSN++E  + ++                   +++P +      PPP GI+++ G  + V+ R+F+     +  A++ +++ K TY PDE +++TL      + P G+ G++ R+ P     +++ +L  W   EG    +C G+ +R +CI+   ++  ++N  +   FANKF   ++  +++ +E+    + R +++  ++ 
Sbjct:  113 QEKDFPLAYSLVVHKNAWMVERLLRATYSPVNVYCIHYDQKSTPQFTAAMEGLARCLPNVFIASKRESVFYASISRLQADLNCLHDLVE-SEVKWKYVINLCGQDFPLKSNMELVSELRKLNGSNMLETSRPSNIKKDRFSFHHELKDASFEYQKLPVRTDQAKSPPPHGIEMFIGNAYFVLSREFILHMTSSVIAMDFFDWSKDTYSPDEHFWATL-----VRVP-GFPGEVAREKPDITDLMSKTRLVKWSYLEGSLYPLCTGEHVRSVCIYGCGELRWLLNYGH--WFANKFEPKVDPVLIQCLEERLEEKQRSLFTRTSLT 428          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Medaka
Match: gcnt3 (glucosaminyl (N-acetyl) transferase 3, mucin type [Source:NCBI gene;Acc:101155272])

HSP 1 Score: 144.821 bits (364), Expect = 2.699e-38
Identity = 91/304 (29.93%), Postives = 147/304 (48.36%), Query Frame = 1
Query:  229 EEINFPIAFGISIYRDAEQFEHLLKAIYRPFNLYCIHVDLSSDARVHEAAIRLSKQFQNVLLTKRFIDVIHSEFSVLESEMLCMEALYQYKKIKWKYFINLTGQEWPLKVNLELVRILKALNGSNLIEKIKLNSE-----------------RVPSKIGPPPDGIKLWKGAVHIVVVRDFVKLALYNKRALNLYEFLKKTYVPDETYFSTLNHDHSFKAPGGYSGDLVRDPINYPFINRYKLW---EGE-------SVCHGKFLRGICIFSMADVPEMINMNNKKLFANKFVIGINDEVLKYME 1059
            EE  FPIA+ + I+   E FE LL+AIY P N+YC+HVD  S      A  R+   F N+ +  +   V+++ +S +++++ CM+ L     + WKY +N  G ++P+K N E+V  LK LNG N +E    N                   R   K  PPP    ++ G  + +V R FVK  + ++ A  L ++ K TY PDE  ++TL      + PG    +   D  +     R   W    G+         C G + R +C++ + D+  ++  ++  LFANKF   ++D  ++ ME
Sbjct:  107 EEKKFPIAYSMVIHEKIEMFERLLRAIYAPQNVYCVHVDQKSSPEYQTAVKRIVSCFPNIFIASKLERVVYASWSRVQADLNCMKDLLN-SDVPWKYLLNTCGTDFPIKTNREMVSALKLLNGRNSMETEVTNDYKKGRWEYHHNVTDTSVIRTGVKKSPPPISSPMYSGNAYFIVSRAFVKHLMKDEEAQRLIDWEKDTYSPDEHLWATLQ--RMPQVPGSLPFNSKYDTSDMLAFARAVKWVYHTGDVRKGAPYPPCTGTYRRAVCVYGVGDLLWLLQTHH--LFANKFDPEVDDIAIRCME 405          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Medaka
Match: ENSORLT00000001297.2 (xylosyltransferase 1 [Source:NCBI gene;Acc:100049491])

HSP 1 Score: 79.337 bits (194), Expect = 2.703e-15
Identity = 75/302 (24.83%), Postives = 130/302 (43.05%), Query Frame = 1
Query:  247 IAFGISIY-RDAEQFEHLLKAIYRPFNLYCIHVDLSSDARVHEAAIRLSKQFQNVLLTKRFIDVIHSEFSVLESEMLCMEALYQYKKIKWKYFINLTGQEWPLKVNLELVRILKALNGSNLIEKIKLNSERVPSKIG------------------PPPDGIKLWKGAVHIVVVRDFVKLALYNKRAL--NLYEFLKKTYVPDETYFSTLNHDHSFKAPGGYSGDLVRDPINYPFINRYKLWEGESVCHGKFLRGICI-----FSMADVPEMINMNNKKLFANKFVIGINDEVLKYMEKWFYN 1074
            IAF + ++ R + Q + L KAIY   + Y IHVD  SD  +H   + L++Q+ NV +T   +  I    S+L   +  ME L       W +FINL+  ++P++ N +LV  L      N I+    ++ R   K G                    P+GI +  G+   ++ R FV   + +   L  ++  F   T +P E++F T+  +        +   +V + +     NR KL      C  K +   C      F  +D+P +   +    FA KF   ++ EV+  ++ + + 
Sbjct:  276 IAFVLVVHGRASRQLQRLFKAIYHTSHYYYIHVDQRSDF-LHREVLSLARQYPNVRVTPWRMATIWGGASLLTMYLRSMEDLLSMTDWSWDFFINLSAADFPIRTNEQLVAFLSKHRSKNFIKSHGRDNARFIRKQGLDRLFLECDAHMWRLGDRKIPEGIAVDGGSDWFLLSRSFVDYVVNSGDELVNSMKRFYAYTLLPAESFFHTVLEN------SAHCETMVDNNLRLTNWNR-KL---GCKCQYKHIVDWCGCSPNDFKPSDLPRLQQTSRPTFFARKFEASVSQEVINQLDAFLFG 566          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Planmine SMEST
Match: SMESG000026549.1 (SMESG000026549.1)

HSP 1 Score: 696.812 bits (1797), Expect = 0.000e+0
Identity = 362/366 (98.91%), Postives = 363/366 (99.18%), Query Frame = 1
Query:   70 MKIISHYQLVSXXXXXXXXXXXXXXXXXXXXNESQNHYQVLDSRIPDWNYYLMEEINFPIAFGISIYRDAEQFEHLLKAIYRPFNLYCIHVDLSSDARVHEAAIRLSKQFQNVLLTKRFIDVIHSEFSVLESEMLCMEALYQYKKIKWKYFINLTGQEWPLKVNLELVRILKALNGSNLIEKIKLNSERVPSKIGPPPDGIKLWKGAVHIVVVRDFVKLALYNKRALNLYEFLKKTYVPDETYFSTLNHDHSFKAPGGYSGDLVRDPINYPFINRYKLWEGESVCHGKFLRGICIFSMADVPEMINMNNKKLFANKFVIGINDEVLKYMEKWFYNRSRIVYSNVNVNPFINLKYYSRLSVVKNHYS 1167
            MKIISHYQLVSLKKLFAFIIAIIIVFVYYKINESQNHYQVLDSRIPDWNYYLMEEINFPIAFGISIYRDAEQFEHLLKAIYRPFNLYCIHVDLSSDARVHEAAIRLSKQFQNVLLTKRFIDVIHSEFSVLESEMLCMEALYQYKKIKWKYFINLTGQEWPLKVNLEL+RILKALNGSNLIEKIKLNSERVPSKIGPPPDGIKLWKGAVHIVVVRDFVKLALYNKRALNLYEFLK TYVPDETYFSTLNHDHSFKAPGGYSGDLVRDPINYPFINRYKLWEGESVCHGKFLRGICIFSM DVPEMINMNNKKLFANKFVIGINDEVLKYMEKWFYNRSRIVYSNVNVNPFINLKYYS LSVVKNHYS
Sbjct:    1 MKIISHYQLVSLKKLFAFIIAIIIVFVYYKINESQNHYQVLDSRIPDWNYYLMEEINFPIAFGISIYRDAEQFEHLLKAIYRPFNLYCIHVDLSSDARVHEAAIRLSKQFQNVLLTKRFIDVIHSEFSVLESEMLCMEALYQYKKIKWKYFINLTGQEWPLKVNLELIRILKALNGSNLIEKIKLNSERVPSKIGPPPDGIKLWKGAVHIVVVRDFVKLALYNKRALNLYEFLKNTYVPDETYFSTLNHDHSFKAPGGYSGDLVRDPINYPFINRYKLWEGESVCHGKFLRGICIFSMVDVPEMINMNNKKLFANKFVIGINDEVLKYMEKWFYNRSRIVYSNVNVNPFINLKYYSSLSVVKNHYS 366          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Planmine SMEST
Match: SMESG000026549.1 (SMESG000026549.1)

HSP 1 Score: 658.677 bits (1698), Expect = 0.000e+0
Identity = 342/346 (98.84%), Postives = 344/346 (99.42%), Query Frame = 1
Query:   70 MKIISHYQLVSXXXXXXXXXXXXXXXXXXXXNESQNHYQVLDSRIPDWNYYLMEEINFPIAFGISIYRDAEQFEHLLKAIYRPFNLYCIHVDLSSDARVHEAAIRLSKQFQNVLLTKRFIDVIHSEFSVLESEMLCMEALYQYKKIKWKYFINLTGQEWPLKVNLELVRILKALNGSNLIEKIKLNSERVPSKIGPPPDGIKLWKGAVHIVVVRDFVKLALYNKRALNLYEFLKKTYVPDETYFSTLNHDHSFKAPGGYSGDLVRDPINYPFINRYKLWEGESVCHGKFLRGICIFSMADVPEMINMNNKKLFANKFVIGINDEVLKYMEKWFYNRSRIVYSNVNV 1107
            MKIISHYQLVSLKKLFAFIIAIIIVFVYYKINESQNHYQVLDSRIPDWNYYLMEEINFPIAFGISIYRDAEQFEHLLKAIYRPFNLYCIHVDLSSDARVHEAAIRLSKQFQNVLLTKRFIDVIHSEFSVLESEMLCMEALYQYKKIKWKYFINLTGQEWPLKVNLEL+RILKALNGSNLIEKIKLNSERVPSKIGPPPDGIKLWKGAVHIVVVRDFVKLALYNKRALNLYEFLK TYVPDETYFSTLNHDHSFKAPGGYSGDLVRDPINYPFINRYKLWEGESVCHGKFLRGICIFSM DVPEMINMNNKKLFANKFVIGINDEVLKYMEKWFYNRSRIVYSNVN+
Sbjct:    1 MKIISHYQLVSLKKLFAFIIAIIIVFVYYKINESQNHYQVLDSRIPDWNYYLMEEINFPIAFGISIYRDAEQFEHLLKAIYRPFNLYCIHVDLSSDARVHEAAIRLSKQFQNVLLTKRFIDVIHSEFSVLESEMLCMEALYQYKKIKWKYFINLTGQEWPLKVNLELIRILKALNGSNLIEKIKLNSERVPSKIGPPPDGIKLWKGAVHIVVVRDFVKLALYNKRALNLYEFLKNTYVPDETYFSTLNHDHSFKAPGGYSGDLVRDPINYPFINRYKLWEGESVCHGKFLRGICIFSMVDVPEMINMNNKKLFANKFVIGINDEVLKYMEKWFYNRSRIVYSNVNL 346          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Planmine SMEST
Match: SMESG000026549.1 (SMESG000026549.1)

HSP 1 Score: 637.491 bits (1643), Expect = 0.000e+0
Identity = 310/314 (98.73%), Postives = 311/314 (99.04%), Query Frame = 1
Query:  226 MEEINFPIAFGISIYRDAEQFEHLLKAIYRPFNLYCIHVDLSSDARVHEAAIRLSKQFQNVLLTKRFIDVIHSEFSVLESEMLCMEALYQYKKIKWKYFINLTGQEWPLKVNLELVRILKALNGSNLIEKIKLNSERVPSKIGPPPDGIKLWKGAVHIVVVRDFVKLALYNKRALNLYEFLKKTYVPDETYFSTLNHDHSFKAPGGYSGDLVRDPINYPFINRYKLWEGESVCHGKFLRGICIFSMADVPEMINMNNKKLFANKFVIGINDEVLKYMEKWFYNRSRIVYSNVNVNPFINLKYYSRLSVVKNHYS 1167
            MEEINFPIAFGISIYRDAEQFEHLLKAIYRPFNLYCIHVDLSSDARVHEAAIRLSKQFQNVLLTKRFIDVIHSEFSVLESEMLCMEALYQYKKIKWKYFINLTGQEWPLKVNLEL+RILKALNGSNLIEKIKLNSERVPSKIGPPPDGIKLWKGAVHIVVVRDFVKLALYNKRALNLYEFLK TYVPDETYFSTLNHDHSFKAPGGYSGDLVRDPINYPFINRYKLWEGESVCHGKFLRGICIFSM DVPEMINMNNKKLFANKFVIGINDEVLKYMEKWFYNRSRIVYSNVNVNPFINLKYYS LSVVKNHYS
Sbjct:    1 MEEINFPIAFGISIYRDAEQFEHLLKAIYRPFNLYCIHVDLSSDARVHEAAIRLSKQFQNVLLTKRFIDVIHSEFSVLESEMLCMEALYQYKKIKWKYFINLTGQEWPLKVNLELIRILKALNGSNLIEKIKLNSERVPSKIGPPPDGIKLWKGAVHIVVVRDFVKLALYNKRALNLYEFLKNTYVPDETYFSTLNHDHSFKAPGGYSGDLVRDPINYPFINRYKLWEGESVCHGKFLRGICIFSMVDVPEMINMNNKKLFANKFVIGINDEVLKYMEKWFYNRSRIVYSNVNVNPFINLKYYSSLSVVKNHYS 314          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Planmine SMEST
Match: SMESG000043068.1 (SMESG000043068.1)

HSP 1 Score: 228.409 bits (581), Expect = 4.272e-70
Identity = 139/348 (39.94%), Postives = 204/348 (58.62%), Query Frame = 1
Query:  172 QNHYQVLDSRIPDWNYYLM-----EEINFPIAFGISIYRDAEQFEHLLKAIYRPFNLYCIHVDLSSDARVHEAAIRLSK----QFQNVLLTKRFIDVIHSEFSVLESEMLCMEALYQYKKIKWKYFINLTGQEWPLKVNLELVRILKALNGSNLIEKI--KLNSERVPSKIGPPPDGIKLWKGAVHIVVVRDFVKLALYNKRALNLYEFLKKTYVPDETYFSTLNHDHSFKAPGGYSGD-----LVRDPINYPFINRYKLWEGESVCHGKFL-RGICIFSMADVPEMINMNNKKLFANKFVIGINDEVLKYMEKWFYNRSRIVYSNVNVNPFINLKYYSRLSVVKNHY 1164
            QN +Q   + + + NY+L      EE NF IAF I  ++   Q E LL+ IYRP+N YCIH+D  SD +  EA   L K    +++N++ T+  +DV   + SVL +++ CM+ LY+  K  WKY INLTGQE+PLK N ELV+ILKA  G+N +E    + N  RVP+   P P  +  +KG+VH+ V RDF+K    + ++ +L + LK  +VPDE +F+TLNH+  F+ PG + GD     L + P+   F+ RYK W GE  C  K + RGICI+ + D+P+++ +    LF NKF        L+ ME+W+Y++      N  VN  IN  +YS L  V + +
Sbjct:   70 QNIHQNCSNFLENQNYFLQFPNTTEEENFRIAFTIVTFKSGSQIERLLRTIYRPWNYYCIHIDKKSDKKFTEALEELVKCLNSRYKNIINTENRVDVQWGKMSVLTADLNCMKELYERFK-DWKYLINLTGQEFPLKTNKELVKILKAYKGANNLEGTYKRRNEYRVPTVKMPFP--LIWYKGSVHVTVNRDFIKFIFGSPKSQDLLKALKGQHVPDEQFFATLNHNPQFRIPGSFIGDPDDLELEKQPL-INFMTRYKNW-GEYTCESKLIVRGICIWGVGDIPKLVKV--PHLFTNKFYEDFQPATLRCMEEWYYDKINKEIQNNGVN--INETFYSTLPFVVHQF 408          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Planmine SMEST
Match: SMESG000008883.1 (SMESG000008883.1)

HSP 1 Score: 219.164 bits (557), Expect = 2.137e-66
Identity = 132/342 (38.60%), Postives = 194/342 (56.73%), Query Frame = 1
Query:  172 QNHYQVLDSRIPDWNYYL----MEEINFPIAFGISIYRDAEQFEHLLKAIYRPFNLYCIHVDLSSDARVHEAAIR----LSKQFQNVLLTKRFIDVIHSEFSVLESEMLCMEALYQYKKIKWKYFINLTGQEWPLKVNLELVRILKALNGSNLIEKI--KLNSERVPSKIGPPPDGIKLWKGAVHIVVVRDFVKLALYNKRALNLYEFLKKTYVPDETYFSTLNHDHSFKAPGGYSGDLVRDPINYPFINRYKLWEGESVCHGKFLRGICIFSMADVPEMINMNNKKLFANKFVIGINDEVLKYMEKWFYNRSRIVYSNVNVNPFINLKYYSRLSVVKNHYS 1167
            QN +   D+ + + NY       EE NFP++F I  ++ + Q E LL+ IYRP+N YCIHVD+ SD +   A       L+ ++ N++ TK  +DV   + SVL +++ CM+ LY+  K  WKYFINLTGQE+PLK N ELV+IL A  G+N +E +  K N ER+P    P P  +  +KG+VHI V RDFV     + ++  L   +K   +PDET+FSTLN++   + PG Y G+       Y F+ RYK W        K +RGICI+   D+P+++   N  LFANKF        L+ +E+W +++ +       V   I+ ++YS L  VK  Y+
Sbjct:   85 QNIHSSCDTFLSNKNYASNHPSKEEKNFPLSFSILAFKSSSQIERLLRTIYRPWNYYCIHVDVKSDKQFLTAIDALVNCLNSKYNNIVNTKNRVDVKWGKMSVLTADLNCMKELYEKYK-DWKYFINLTGQEFPLKTNAELVKILTAYKGANNLEGVYKKRNEERIPHIKMPFP--VVWFKGSVHITVNRDFVAFIFESPKSKTLLNIVKSQLIPDETFFSTLNYNPQLRIPGSYIGNPDEITSEY-FMTRYKNWGQYPCVSNKIVRGICIWGAGDLPKLVTAPN--LFANKFHEEFQPATLRCLERWIHDKVQKEAQTGTVE--IDSEFYSSLPFVKYQYN 418          
The following BLAST results are available for this feature:
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GCNT32.466e-4631.86glucosaminyl (N-acetyl) transferase 3, mucin type ... [more]
GCNT32.466e-4631.86glucosaminyl (N-acetyl) transferase 3, mucin type ... [more]
GCNT21.110e-4131.29glucosaminyl (N-acetyl) transferase 2 (I blood gro... [more]
GCNT24.562e-4130.03glucosaminyl (N-acetyl) transferase 2 (I blood gro... [more]
GCNT16.770e-4032.23glucosaminyl (N-acetyl) transferase 1 [Source:HGNC... [more]
back to top
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gly-178.334e-3132.96GLYcosylation related [Source:UniProtKB/TrEMBL;Ac... [more]
gly-161.396e-2830.77GLY-16; GLYcosylation related [Source:UniProtKB/T... [more]
gly-14.007e-2728.21GLY-1; GLYcosylation related [Source:UniProtKB/Tr... [more]
gly-184.048e-2729.37GLYcosylation related [Source:UniProtKB/TrEMBL;Ac... [more]
gly-191.067e-2531.12GLY-19; GLYcosylation related [Source:UniProtKB/T... [more]
back to top
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
oxt3.443e-1426.50gene:FBgn0015360 transcript:FBtr0072904[more]
back to top
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gcnt71.094e-4332.27glucosaminyl (N-acetyl) transferase family member ... [more]
gcnt35.411e-4231.65glucosaminyl (N-acetyl) transferase 3, mucin type ... [more]
gcnt35.813e-4232.39glucosaminyl (N-acetyl) transferase 3, mucin type ... [more]
gcnt37.145e-4232.26glucosaminyl (N-acetyl) transferase 3, mucin type ... [more]
gcnt4a2.006e-3730.10glucosaminyl (N-acetyl) transferase 4a [Source:NCB... [more]
back to top
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cnksr21.033e-4633.33connector enhancer of kinase suppressor of Ras 2 [... [more]
gcnt2.21.175e-4432.77glucosaminyl (N-acetyl) transferase 2 (I blood gro... [more]
adsl3.001e-4329.81adenylosuccinate lyase [Source:Xenbase;Acc:XB-GENE... [more]
slc24a42.089e-4230.03solute carrier family 24 member 4 [Source:Xenbase;... [more]
ccdc771.181e-3930.55coiled-coil domain containing 77 [Source:Xenbase;A... [more]
back to top
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gcnt33.560e-4329.41glucosaminyl (N-acetyl) transferase 3, mucin type ... [more]
Gcnt23.030e-4231.49glucosaminyl (N-acetyl) transferase 2, I-branching... [more]
Gcnt21.058e-4132.18glucosaminyl (N-acetyl) transferase 2, I-branching... [more]
Gcnt15.198e-4030.55glucosaminyl (N-acetyl) transferase 1, core 2 [Sou... [more]
Gcnt15.198e-4030.55glucosaminyl (N-acetyl) transferase 1, core 2 [Sou... [more]
back to top
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8CH87|GCNT3_RAT6.720e-4632.20Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1... [more]
sp|O95395|GCNT3_HUMAN1.184e-4531.86Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1... [more]
sp|Q866Z6|GCNT3_SHEEP2.580e-4331.86Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1... [more]
sp|Q7YQE1|GCNT3_BOVIN4.263e-4331.86Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1... [more]
sp|Q866Z5|GCNT3_BOSMU4.307e-4331.86Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1... [more]
back to top
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0L8GYB52.764e-7746.06Uncharacterized protein OS=Octopus bimaculoides OX... [more]
A0A2T7P1543.633e-7543.22Uncharacterized protein OS=Pomacea canaliculata OX... [more]
A0A2T7P1445.866e-7442.27Uncharacterized protein OS=Pomacea canaliculata OX... [more]
A0A0B7A2213.868e-7344.19Uncharacterized protein (Fragment) OS=Arion vulgar... [more]
A0A2T7NME59.323e-7342.15Uncharacterized protein OS=Pomacea canaliculata OX... [more]
back to top
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000050168.15.825e-4732.69pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000026751.26.881e-4733.33glucosaminyl (N-acetyl) transferase 1 [Source:NCBI... [more]
gcnt31.294e-4030.23glucosaminyl (N-acetyl) transferase 3, mucin type ... [more]
gcnt77.212e-3831.80glucosaminyl (N-acetyl) transferase family member ... [more]
gcnt4a8.571e-3629.37glucosaminyl (N-acetyl) transferase 4 [Source:NCBI... [more]
back to top
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GCNT22.176e-4633.03glucosaminyl (N-acetyl) transferase 2 (I blood gro... [more]
gcnt4a1.117e-4229.64glucosaminyl (N-acetyl) transferase 4a [Source:NCB... [more]
gcnt4a1.198e-4229.64glucosaminyl (N-acetyl) transferase 4a [Source:NCB... [more]
gcnt32.438e-4229.74glucosaminyl (N-acetyl) transferase 3, mucin type ... [more]
gcnt33.838e-4131.23glucosaminyl (N-acetyl) transferase 3, mucin type ... [more]
back to top
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO396171.696e-5237.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO374463.795e-4632.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO368355.662e-1023.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000007218.21.483e-4732.05glucosaminyl (N-acetyl) transferase 1 [Source:NCBI... [more]
gcnt75.802e-4432.13beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1... [more]
si:dkeyp-87d8.89.647e-4128.00glucosaminyl (N-acetyl) transferase 4 [Source:NCBI... [more]
gcnt32.699e-3829.93glucosaminyl (N-acetyl) transferase 3, mucin type ... [more]
ENSORLT00000001297.22.703e-1524.83xylosyltransferase 1 [Source:NCBI gene;Acc:1000494... [more]
back to top
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000026549.10.000e+098.91SMESG000026549.1[more]
SMESG000026549.10.000e+098.84SMESG000026549.1[more]
SMESG000026549.10.000e+098.73SMESG000026549.1[more]
SMESG000043068.14.272e-7039.94SMESG000043068.1[more]
SMESG000008883.12.137e-6638.60SMESG000008883.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028115 ID=SMED30028115|Name=beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3|organism=Schmidtea mediterranea sexual|type=transcript|length=1373bp
AATCGATATAATTTGTACGCTATATTCACATATAAATTAACTGGAAAGTG
AATAGCAGTAAACTCAATAATGAAGATAATTTCCCATTATCAGTTGGTTT
CGTTAAAAAAATTATTTGCATTTATAATCGCGATAATTATCGTTTTTGTC
TACTATAAAATAAACGAATCCCAAAATCATTACCAAGTGTTGGATTCTCG
GATTCCAGATTGGAATTATTATCTCATGGAAGAAATAAATTTTCCCATCG
CTTTTGGAATTTCAATTTATCGGGACGCTGAACAATTTGAACATTTGTTG
AAAGCGATCTATCGACCATTCAATCTCTATTGTATCCATGTCGACTTGAG
CAGCGATGCCCGTGTTCATGAAGCTGCCATCAGGCTATCAAAACAATTTC
AGAATGTTCTGTTGACAAAAAGGTTTATTGATGTTATCCACAGTGAATTC
AGTGTACTGGAAAGTGAAATGTTGTGTATGGAAGCTTTGTATCAATACAA
GAAAATCAAATGGAAATATTTTATCAATCTAACAGGTCAAGAATGGCCAT
TGAAAGTGAATTTAGAATTGGTACGGATTCTGAAAGCATTAAATGGCTCA
AATTTGATAGAAAAAATCAAATTAAATTCTGAAAGAGTTCCGTCAAAGAT
TGGCCCGCCTCCTGACGGAATCAAATTGTGGAAAGGTGCTGTCCACATTG
TTGTTGTGAGGGATTTTGTGAAGCTTGCACTATACAATAAGCGGGCTTTG
AATCTTTACGAATTTTTAAAAAAGACATATGTTCCAGATGAAACTTATTT
TTCCACTCTGAATCACGATCATAGTTTCAAGGCTCCCGGCGGTTATTCAG
GTGATCTAGTCAGAGATCCGATCAACTACCCTTTTATCAATCGATACAAA
CTCTGGGAAGGCGAGTCGGTTTGTCACGGGAAATTTCTAAGAGGCATCTG
TATTTTCTCGATGGCCGATGTTCCGGAAATGATTAATATGAACAATAAGA
AATTATTCGCCAACAAATTTGTCATTGGTATCAATGATGAAGTGTTGAAG
TACATGGAAAAATGGTTTTATAATCGCAGCCGCATTGTGTATTCCAACGT
CAACGTAAATCCTTTTATCAATTTGAAGTATTACTCAAGACTGTCAGTTG
TGAAAAACCATTATTCCTAGAGGAAACCAGAGTGATCCGTTCATATCATA
GATGTCGACTATACCAATATCAACTGCAACTAGATCAGTTCATTTATTTT
AATCGAAATGATAATAAATTTTTTTAGTAATTTTACAAATTAGTTTTGAA
TGTATATTTTTTATTTCTATGAATCATTGGGAATTTTGCTGTCGTTTTCC
GTAAATTTTCCAATAAATCTTTC
back to top

protein sequence of SMED30028115-orf-1

>SMED30028115-orf-1 ID=SMED30028115-orf-1|Name=SMED30028115-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=367bp
MKIISHYQLVSLKKLFAFIIAIIIVFVYYKINESQNHYQVLDSRIPDWNY
YLMEEINFPIAFGISIYRDAEQFEHLLKAIYRPFNLYCIHVDLSSDARVH
EAAIRLSKQFQNVLLTKRFIDVIHSEFSVLESEMLCMEALYQYKKIKWKY
FINLTGQEWPLKVNLELVRILKALNGSNLIEKIKLNSERVPSKIGPPPDG
IKLWKGAVHIVVVRDFVKLALYNKRALNLYEFLKKTYVPDETYFSTLNHD
HSFKAPGGYSGDLVRDPINYPFINRYKLWEGESVCHGKFLRGICIFSMAD
VPEMINMNNKKLFANKFVIGINDEVLKYMEKWFYNRSRIVYSNVNVNPFI
NLKYYSRLSVVKNHYS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR003406Glyco_trans_14
Vocabulary: molecular function
TermDefinition
GO:0008375acetylglucosaminyltransferase activity
GO:0016740transferase activity
GO:0016757transferase activity, transferring glycosyl groups
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003406Glycosyl transferase, family 14PFAMPF02485Branchcoord: 60..304
e-value: 1.4E-31
score: 109.9
NoneNo IPR availablePANTHERPTHR19297GLYCOSYLTRANSFERASE 14 FAMILY MEMBERcoord: 53..339
NoneNo IPR availablePANTHERPTHR19297:SF179GLUCOSAMINYL (N-ACETYL) TRANSFERASE 2, I-BRANCHING ENZYME (I BLOOD GROUP)coord: 53..339
NoneNo IPR availableTMHMMTMhelixcoord: 7..29