Nou-darake-like-2

Overview
NameNou-darake-like-2
Smed IDSMED30028104
Length (bp)1841
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Nou-darake-like-2 (SMED30028104) t-SNE clustered cells

Violin plots show distribution of expression levels for Nou-darake-like-2 (SMED30028104) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Nou-darake-like-2 (SMED30028104) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Nou-darake-like-2 (SMED30028104) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028104

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 14

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
anterior region of the whole animalSMED30028104SMESG000027359.1 dd_Smed_v4_8340_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
anterior region of the whole animalSMED30028104SMESG000027359.1 dd_Smed_v4_8340_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
headSMED30028104SMESG000027359.1 dd_Smed_v4_8340_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
prepharyngeal regionSMED30028104SMESG000027359.1 dd_Smed_v4_8340_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
tailSMED30028104SMESG000027359.1 dd_Smed_v4_8340_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
headSMED30028104SMESG000027359.1 SmedASXL_013711SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30028104SMESG000027359.1 dd_Smed_v4_8340_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30028104SMESG000027359.1 dd_Smed_v4_8340_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
anterior region of the whole animalSMED30028104SMESG000027359.1 dd_Smed_v4_8340_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30028104SMESG000027359.1 dd_Smed_v6_8340_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30028104SMESG000027359.1 Contig14147newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30028104SMESG000027359.1 Contig14147uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30028104SMESG000027359.1 OX_Smed_1.0.13514ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
headSMED30028104SMESG000027359.1 KT983961smed_ncbi_20200123PMID:30485821
Tewari et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Nou-darake-like-2 vs. Ensembl Human
Match: FGFR3 (fibroblast growth factor receptor 3 [Source:HGNC Symbol;Acc:HGNC:3690])

HSP 1 Score: 60.8474 bits (146), Expect = 5.134e-9
Identity = 62/258 (24.03%), Postives = 106/258 (41.09%), Query Frame = 1
Query:  541 VTLDCTAVGES------LKYYWTFIGNNRMKNQIQAERNISKIIIKSVIPENEGVYKCEVGNIYGEKISRTFTVALTETAPDANMEIIGKKQDDLVTNIGQQVLLRCEVKSKYHRIHSIKWGKRIKSTGPDSLVKPNIVSWDQFTYNLLPETNIKKNFIMQNHIESFFTLAIRDNDQSGIYTCLAMDATGGTAHKIFNISTSSEDSFVEVQTKS--YFFLLYILLPVVLIFAIVCAIIYCSVKSSSKNTHNSVPLKKF 1290
            V   C A G        LK    F G +R+   I+       ++++SV+P + G Y C V N +G  I +T+T+ + E +P   +   G   +     +G  V   C+V S       I+W K ++  G  S V P+   +          T  K+  ++  H  +F        + +G YTCLA ++ G + H  + +   +E+  VE       Y  +L   +   L   +V A+  C ++S  K    S  + K 
Sbjct:  172 VRFRCPAAGNPTPSISWLKNGREFRGEHRIGG-IKLRHQQWSLVMESVVPSDRGNYTCVVENKFG-SIRQTYTLDVLERSPHRPILQAGLPANQTAV-LGSDVEFHCKVYSDAQP--HIQWLKHVEVNG--SKVGPDGTPYVTVLKTAGANTTDKELEVLSLHNVTF--------EDAGEYTCLAGNSIGFSHHSAWLVVLPAEEELVEADEAGSVYAGILSYGVGFFLFILVVAAVTLCRLRSPPKKGLGSPTVHKI 414          
BLAST of Nou-darake-like-2 vs. Ensembl Human
Match: FGFR3 (fibroblast growth factor receptor 3 [Source:HGNC Symbol;Acc:HGNC:3690])

HSP 1 Score: 60.4622 bits (145), Expect = 6.928e-9
Identity = 62/258 (24.03%), Postives = 106/258 (41.09%), Query Frame = 1
Query:  541 VTLDCTAVGES------LKYYWTFIGNNRMKNQIQAERNISKIIIKSVIPENEGVYKCEVGNIYGEKISRTFTVALTETAPDANMEIIGKKQDDLVTNIGQQVLLRCEVKSKYHRIHSIKWGKRIKSTGPDSLVKPNIVSWDQFTYNLLPETNIKKNFIMQNHIESFFTLAIRDNDQSGIYTCLAMDATGGTAHKIFNISTSSEDSFVEVQTKS--YFFLLYILLPVVLIFAIVCAIIYCSVKSSSKNTHNSVPLKKF 1290
            V   C A G        LK    F G +R+   I+       ++++SV+P + G Y C V N +G  I +T+T+ + E +P   +   G   +     +G  V   C+V S       I+W K ++  G  S V P+   +          T  K+  ++  H  +F        + +G YTCLA ++ G + H  + +   +E+  VE       Y  +L   +   L   +V A+  C ++S  K    S  + K 
Sbjct:  172 VRFRCPAAGNPTPSISWLKNGREFRGEHRIGG-IKLRHQQWSLVMESVVPSDRGNYTCVVENKFG-SIRQTYTLDVLERSPHRPILQAGLPANQTAV-LGSDVEFHCKVYSDAQ--PHIQWLKHVEVNG--SKVGPDGTPYVTVLKTAGANTTDKELEVLSLHNVTF--------EDAGEYTCLAGNSIGFSHHSAWLVVLPAEEELVEADEAGSVYAGILSYGVGFFLFILVVAAVTLCRLRSPPKKGLGSPTVHKI 414          
BLAST of Nou-darake-like-2 vs. Ensembl Human
Match: FGFR2 (fibroblast growth factor receptor 2 [Source:HGNC Symbol;Acc:HGNC:3689])

HSP 1 Score: 56.225 bits (134), Expect = 1.647e-7
Identity = 78/345 (22.61%), Postives = 140/345 (40.58%), Query Frame = 1
Query:  301 GKLLTIDPATVDKSGVYECKSXXXXXXXXXXXXXKIIDSQS------------EIVTKSCSNSVSPPIRDVSKGICFFNEEKRKFQPKIGDHVTLDCTAVGESL-KYYWT----------FIGNNRMKNQIQAERNISKIIIKSVIPENEGVYKCEVGNIYGEKISRTFTVALTETAPDANMEIIGKKQDDLVTNIGQQVLLRCEVKSKYHRIHSIKWGKRIKSTGPDSLVKPNIVSWDQFTYNLLPETNIKKNFIMQNHIESFFTLAIRDN--DQSGIYTCLAMDATGGTAHKIFNISTSSEDSFVEV-QTKSYFFLLYILLPVVLIFAIVCAIIYCSVKSSSK 1257
            G+ L I  AT   SG+Y C ++    +      V + D+ S            + V+++ +N  +P   +  K       EKR       + V   C A G  +    W            IG  +++NQ  +      +I++SV+P ++G Y C V N YG  I+ T+ + + E +P   +   G    +  T +G  V   C+V S       I+W K ++  G             ++  + LP   + K   +    +    L IR+   + +G YTCLA ++ G + H  +     +     E+  +  Y  +    + V LI  +V  +I C +K+++K
Sbjct:   89 GEYLQIKGATPRDSGLYACTASRTVDSETWYFMVNVTDAISSGDDEDDTDGAEDFVSENSNNKRAPYWTNTEK------MEKRLHAVPAANTVKFRCPAGGNPMPTMRWLKNGKEFKQEHRIGGYKVRNQHWS------LIMESVVPSDKGNYTCVVENEYG-SINHTYHLDVVERSPHRPILQAGLPA-NASTVVGGDVEFVCKVYSDAQ--PHIQWIKHVEKNG------------SKYGPDGLPYLKVLKAAGVNTTDKEIEVLYIRNVTFEDAGEYTCLAGNSIGISFHSAWLTVLPAPGREKEITASPDYLEIAIYCIGVFLIACMVVTVILCRMKNTTK 405          
BLAST of Nou-darake-like-2 vs. Ensembl Human
Match: FGFR2 (fibroblast growth factor receptor 2 [Source:HGNC Symbol;Acc:HGNC:3689])

HSP 1 Score: 55.8398 bits (133), Expect = 2.008e-7
Identity = 78/345 (22.61%), Postives = 140/345 (40.58%), Query Frame = 1
Query:  301 GKLLTIDPATVDKSGVYECKSXXXXXXXXXXXXXKIIDSQS------------EIVTKSCSNSVSPPIRDVSKGICFFNEEKRKFQPKIGDHVTLDCTAVGESL-KYYWT----------FIGNNRMKNQIQAERNISKIIIKSVIPENEGVYKCEVGNIYGEKISRTFTVALTETAPDANMEIIGKKQDDLVTNIGQQVLLRCEVKSKYHRIHSIKWGKRIKSTGPDSLVKPNIVSWDQFTYNLLPETNIKKNFIMQNHIESFFTLAIRDN--DQSGIYTCLAMDATGGTAHKIFNISTSSEDSFVEV-QTKSYFFLLYILLPVVLIFAIVCAIIYCSVKSSSK 1257
            G+ L I  AT   SG+Y C ++    +      V + D+ S            + V+++ +N  +P   +  K       EKR       + V   C A G  +    W            IG  +++NQ  +      +I++SV+P ++G Y C V N YG  I+ T+ + + E +P   +   G    +  T +G  V   C+V S       I+W K ++  G             ++  + LP   + K   +    +    L IR+   + +G YTCLA ++ G + H  +     +     E+  +  Y  +    + V LI  +V  +I C +K+++K
Sbjct:   89 GEYLQIKGATPRDSGLYACTASRTVDSETWYFMVNVTDAISSGDDEDDTDGAEDFVSENSNNKRAPYWTNTEK------MEKRLHAVPAANTVKFRCPAGGNPMPTMRWLKNGKEFKQEHRIGGYKVRNQHWS------LIMESVVPSDKGNYTCVVENEYG-SINHTYHLDVVERSPHRPILQAGLPA-NASTVVGGDVEFVCKVYSDAQ--PHIQWIKHVEKNG------------SKYGPDGLPYLKVLKAAGVNTTDKEIEVLYIRNVTFEDAGEYTCLAGNSIGISFHSAWLTVLPAPGREKEITASPDYLEIAIYCIGVFLIACMVVTVILCRMKNTTK 405          
BLAST of Nou-darake-like-2 vs. Ensembl Human
Match: FGFR2 (fibroblast growth factor receptor 2 [Source:HGNC Symbol;Acc:HGNC:3689])

HSP 1 Score: 55.4546 bits (132), Expect = 2.856e-7
Identity = 79/348 (22.70%), Postives = 139/348 (39.94%), Query Frame = 1
Query:  301 GKLLTIDPATVDKSGVYECKSXXXXXXXXXXXXXKIIDSQS------------EIVTKSCSNSVSPPIRDVSKGICFFNEEKRKFQPKIGDHVTLDCTAVGESL-KYYWT----------FIGNNRMKNQIQAERNISKIIIKSVIPENEGVYKCEVGNIYGEKISRTFTVALTETAPDANMEIIGKKQDDLVTNIGQQVLLRCEVKSKYHRIHSIKWGKRIKSTGPDSLVKPNIVSWDQFTYNLLPETNIKKNF-----IMQNHIESFFTLAIRDNDQSGIYTCLAMDATGGTAHKIFNISTSSEDSFVEV-QTKSYFFLLYILLPVVLIFAIVCAIIYCSVKSSSK 1257
            G+ L I  AT   SG+Y C ++    +      V + D+ S            + V+++ +N  +P   +  K       EKR       + V   C A G  +    W            IG  +++NQ  +      +I++SV+P ++G Y C V N YG  I+ T+ + + E +P   +   G    +  T +G  V   C+V S       I+W K ++  G             ++  + LP   + K F          IE  +   +   D +G YTCLA ++ G + H  +     +     E+  +  Y  +    + V LI  +V  +I C +K+++K
Sbjct:   89 GEYLQIKGATPRDSGLYACTASRTVDSETWYFMVNVTDAISSGDDEDDTDGAEDFVSENSNNKRAPYWTNTEK------MEKRLHAVPAANTVKFRCPAGGNPMPTMRWLKNGKEFKQEHRIGGYKVRNQHWS------LIMESVVPSDKGNYTCVVENEYG-SINHTYHLDVVERSPHRPILQAGLPA-NASTVVGGDVEFVCKVYSDAQ--PHIQWIKHVEKNG------------SKYGPDGLPYLKVLKVFAAGVNTTDKEIEVLYIRNVTFED-AGEYTCLAGNSIGISFHSAWLTVLPAPGREKEITASPDYLEIAIYCIGVFLIACMVVTVILCRMKNTTK 407          
BLAST of Nou-darake-like-2 vs. Ensembl Zebrafish
Match: fgfr1b (fibroblast growth factor receptor 1b [Source:ZFIN;Acc:ZDB-GENE-060503-14])

HSP 1 Score: 61.2326 bits (147), Expect = 2.979e-9
Identity = 61/248 (24.60%), Postives = 105/248 (42.34%), Query Frame = 1
Query:  541 VTLDCTAVGESL-KYYWTFIGNNRMKNQ----IQAERNISKIIIKSVIPENEGVYKCEVGNIYGEKISRTFTVALTETAPDANMEIIGKKQDDLVTNIGQQVLLRCEVKSKYHRIHSIKWGKRIKSTGPDSLVKPNIVSWDQFTYNLLPETNIKKNFIMQNHIESFFTLAIRDN--DQSGIYTCLAMDATGGTAHKIFNISTSSEDSFVEVQTKSYFFLLYILLPVVLIFAIVCAIIYCSVKSSSKNT 1263
            V   C A G  + K  W   G    ++Q     +   ++  II++SV+P ++G Y C V N YG  I+ T+ + + E +P   +   G   +     +G  V   C+V S       I+W K I+  G             Q   + LP   + K   +    +    L +R+   + +G YTCLA ++ G + H  +     +  +   V ++SY  +L   +   LIF +V       ++SSSK +
Sbjct:   94 VKFRCQAEGNPIPKLRWLKNGKEFKRDQRIGGYKLREHMWTIIMESVVPSDKGNYTCLVENEYGS-INHTYQLDVVERSPHRPILYAGLPANRTAV-VGSDVEFVCKVFSDPQP--HIQWLKHIRVNG------------SQLGPDGLPYVRVLKTAGLNTTDKEMEVLQLRNVSFEDAGEYTCLAGNSIGISHHSAWLTVVKAPTAPSAVPSQSYLEVLIYCIGFFLIFLMVGIATIVKIRSSSKKS 325          
BLAST of Nou-darake-like-2 vs. Ensembl Zebrafish
Match: fgfr3 (fibroblast growth factor receptor 3 [Source:NCBI gene;Acc:58129])

HSP 1 Score: 57.3806 bits (137), Expect = 4.477e-8
Identity = 66/276 (23.91%), Postives = 109/276 (39.49%), Query Frame = 1
Query:  505 EKRKFQPKIGDHVTLDCTAVGES------LKYYWTFIGNNRMKNQIQAERNISKIIIKSVIPENEGVYKCEVGNIYGEKISRTFTVALTETAPDANMEIIGKKQDDLVTNIGQQVLLRCEVKSKYHRIHSIKWGKRIKSTGPDSLVKPNIVSWDQFTYNLLPETNIKKNF---IMQNHIESFFTLAIRDNDQSGIYTCLAMDATGGTAHKIF-----NISTSSEDSFVEVQTKSYFFLLYILLPVVLIFAIVCAIIYCSVKSSSKNTHNSVPLKKF 1290
            EK+       + V   C A G        LK    F G  RM   I+       ++++S +P + G Y C V N YG  I  T+ + + E +P   +   G   +  V  +G  V   C+V S       I+W K I+  G             Q+  N  P  N+ K          +E  +   +   D +G YTCLA ++ G   H  +      +    ED + ++       L+Y+   V+ I  +V  II C +  +++ T  + P++K 
Sbjct:  172 EKKLLAVPAANTVKFRCPAAGNPTPSIHWLKNGKEFKGEQRMGG-IKLRDQQWSLVMESAVPSDRGNYTCVVQNKYG-TIKHTYQLDVLERSPHRPILQAGLPANQTVV-VGSDVEFHCKVYSDAQP--HIQWLKHIEVNG------------SQYGPNGAPYVNVLKTAGINTTDKELEILYLTNVSFED-AGQYTCLAGNSIGYNHHSAWLTVLPAVEMEREDDYADI-------LIYVTSCVLFILTMVI-IILCRMWINTQKTLPAPPVQKL 421          
BLAST of Nou-darake-like-2 vs. Ensembl Zebrafish
Match: fgfr3 (fibroblast growth factor receptor 3 [Source:NCBI gene;Acc:58129])

HSP 1 Score: 56.9954 bits (136), Expect = 5.092e-8
Identity = 66/276 (23.91%), Postives = 109/276 (39.49%), Query Frame = 1
Query:  505 EKRKFQPKIGDHVTLDCTAVGES------LKYYWTFIGNNRMKNQIQAERNISKIIIKSVIPENEGVYKCEVGNIYGEKISRTFTVALTETAPDANMEIIGKKQDDLVTNIGQQVLLRCEVKSKYHRIHSIKWGKRIKSTGPDSLVKPNIVSWDQFTYNLLPETNIKKNF---IMQNHIESFFTLAIRDNDQSGIYTCLAMDATGGTAHKIF-----NISTSSEDSFVEVQTKSYFFLLYILLPVVLIFAIVCAIIYCSVKSSSKNTHNSVPLKKF 1290
            EK+       + V   C A G        LK    F G  RM   I+       ++++S +P + G Y C V N YG  I  T+ + + E +P   +   G   +  V  +G  V   C+V S       I+W K I+  G             Q+  N  P  N+ K          +E  +   +   D +G YTCLA ++ G   H  +      +    ED + ++       L+Y+   V+ I  +V  II C +  +++ T  + P++K 
Sbjct:  153 EKKLLAVPAANTVKFRCPAAGNPTPSIHWLKNGKEFKGEQRMGG-IKLRDQQWSLVMESAVPSDRGNYTCVVQNKYG-TIKHTYQLDVLERSPHRPILQAGLPANQTVV-VGSDVEFHCKVYSDAQP--HIQWLKHIEVNG------------SQYGPNGAPYVNVLKTAGINTTDKELEILYLTNVSFED-AGQYTCLAGNSIGYNHHSAWLTVLPAVEMEREDDYADI-------LIYVTSCVLFILTMVI-IILCRMWINTQKTLPAPPVQKL 402          
BLAST of Nou-darake-like-2 vs. Ensembl Zebrafish
Match: fgfr4 (fibroblast growth factor receptor 4 [Source:NCBI gene;Acc:100000160])

HSP 1 Score: 56.9954 bits (136), Expect = 6.569e-8
Identity = 64/271 (23.62%), Postives = 115/271 (42.44%), Query Frame = 1
Query:  505 EKRKFQPKIGDHVTLDCTAVGESL-KYYW-----TFIGNNRMKNQIQAERNISKIIIKSVIPENEGVYKCEVGNIYGEKISRTFTVALTETAPDANMEIIGKKQDDLVTNIGQQVLLRCEVKSKYHRIHSIKWGKRIKSTGPDSLVKPNIVSWDQFTYNLLPETNIKKNFIMQNHIESFFTLAIRDNDQSGIYTCLAMDATGGTAHKIFNISTSSEDSFVEV---QTKSYFFLLYILLPVVLIFAIVCAIIYCSVKSSSKNTHNSVPLKKF 1290
            EK+ +    G+ V   C A G  L    W      F G +R+   I+       ++++SV+P + G Y C V N YG  I+ T+ + + E +P   +   G  ++     +G      C+V S       I+W K I+  G  S   P+ + + +          +K   +  + +E  +   I   D +G YTCLA ++ G +    +    S ED   EV   + K    ++Y    + L+ AIV  ++       S+   +++P++K 
Sbjct:  267 EKKLYAVPAGNTVKFRCPATGSPLPTIRWLKNGREFRGEHRIGG-IKLRHQHWSLVMESVVPSDRGNYSCVVENKYG-SIAHTYLLDVLERSPHRPILQAGLPKNTTAI-VGGDAQFLCKVYSDAQP--HIQWLKHIEMNG--SRYGPDGIPYVKI---------VKTGSLNMSEVEVLYLTNISMED-AGEYTCLAGNSIGFSHQSAWLTVLSEEDVAKEVDLMEAKYTDIIIYASGFLALVMAIVIVVLCRMQVHPSREPFDTLPVQKL 520          
BLAST of Nou-darake-like-2 vs. Ensembl Zebrafish
Match: fgfr4 (fibroblast growth factor receptor 4 [Source:NCBI gene;Acc:100000160])

HSP 1 Score: 56.9954 bits (136), Expect = 6.859e-8
Identity = 64/271 (23.62%), Postives = 115/271 (42.44%), Query Frame = 1
Query:  505 EKRKFQPKIGDHVTLDCTAVGESL-KYYW-----TFIGNNRMKNQIQAERNISKIIIKSVIPENEGVYKCEVGNIYGEKISRTFTVALTETAPDANMEIIGKKQDDLVTNIGQQVLLRCEVKSKYHRIHSIKWGKRIKSTGPDSLVKPNIVSWDQFTYNLLPETNIKKNFIMQNHIESFFTLAIRDNDQSGIYTCLAMDATGGTAHKIFNISTSSEDSFVEV---QTKSYFFLLYILLPVVLIFAIVCAIIYCSVKSSSKNTHNSVPLKKF 1290
            EK+ +    G+ V   C A G  L    W      F G +R+   I+       ++++SV+P + G Y C V N YG  I+ T+ + + E +P   +   G  ++     +G      C+V S       I+W K I+  G  S   P+ + + +          +K   +  + +E  +   I   D +G YTCLA ++ G +    +    S ED   EV   + K    ++Y    + L+ AIV  ++       S+   +++P++K 
Sbjct:  268 EKKLYAVPAGNTVKFRCPATGSPLPTIRWLKNGREFRGEHRIGG-IKLRHQHWSLVMESVVPSDRGNYSCVVENKYG-SIAHTYLLDVLERSPHRPILQAGLPKNTTAI-VGGDAQFLCKVYSDAQP--HIQWLKHIEMNG--SRYGPDGIPYVKI---------VKTGSLNMSEVEVLYLTNISMED-AGEYTCLAGNSIGFSHQSAWLTVLSEEDVAKEVDLMEAKYTDIIIYASGFLALVMAIVIVVLCRMQVHPSREPFDTLPVQKL 521          
BLAST of Nou-darake-like-2 vs. Ensembl Mouse
Match: Fgfr3 (fibroblast growth factor receptor 3 [Source:MGI Symbol;Acc:MGI:95524])

HSP 1 Score: 60.4622 bits (145), Expect = 4.866e-9
Identity = 62/257 (24.12%), Postives = 107/257 (41.63%), Query Frame = 1
Query:  541 VTLDCTAVGES------LKYYWTFIGNNRMKNQIQAERNISKIIIKSVIPENEGVYKCEVGNIYGEKISRTFTVALTETAPDANMEIIGKKQDDLVTNIGQQVLLRCEVKSKYHRIHSIKWGKRIKSTGPDSLVKPNIVSWDQFTYNLLPETNIKKNFIMQNHIESFFTLAIRDNDQSGIYTCLAMDATGGTAHKIFNISTSSEDSFVEVQTKSYFFLLYILLPVV--LIFAIVCAIIYCSVKSSSKNTHNSVPLKK 1287
            V   C A G        LK    F G +R+   I+       ++++SV+P + G Y C V N +G  I +T+T+ + E +P   +   G   +     +G  V   C+V S       I+W K ++  G  S V P+   +          T  K+  ++  H  +F        + +G YTCLA ++ G + H  + +   +E+  +E       +   +   VV  L   +V A+I C ++S  K    S  + K
Sbjct:  166 VRFRCPAAGNPTPSISWLKNGKEFRGEHRIGG-IKLRHQQWSLVMESVVPSDRGNYTCVVENKFG-SIRQTYTLDVLERSPHRPILQAGLPANQTAI-LGSDVEFHCKVYSDAQP--HIQWLKHVEVNG--SKVGPDGTPYVTVLKTAGANTTDKELEVLSLHNVTF--------EDAGEYTCLAGNSIGFSHHSAWLVVLPAEEELMETDEAGSVYAGVLSYGVVFFLFILVVAAVILCRLRSPPKKGLGSPTVHK 407          
BLAST of Nou-darake-like-2 vs. Ensembl Mouse
Match: Fgfr3 (fibroblast growth factor receptor 3 [Source:MGI Symbol;Acc:MGI:95524])

HSP 1 Score: 60.4622 bits (145), Expect = 4.866e-9
Identity = 62/257 (24.12%), Postives = 107/257 (41.63%), Query Frame = 1
Query:  541 VTLDCTAVGES------LKYYWTFIGNNRMKNQIQAERNISKIIIKSVIPENEGVYKCEVGNIYGEKISRTFTVALTETAPDANMEIIGKKQDDLVTNIGQQVLLRCEVKSKYHRIHSIKWGKRIKSTGPDSLVKPNIVSWDQFTYNLLPETNIKKNFIMQNHIESFFTLAIRDNDQSGIYTCLAMDATGGTAHKIFNISTSSEDSFVEVQTKSYFFLLYILLPVV--LIFAIVCAIIYCSVKSSSKNTHNSVPLKK 1287
            V   C A G        LK    F G +R+   I+       ++++SV+P + G Y C V N +G  I +T+T+ + E +P   +   G   +     +G  V   C+V S       I+W K ++  G  S V P+   +          T  K+  ++  H  +F        + +G YTCLA ++ G + H  + +   +E+  +E       +   +   VV  L   +V A+I C ++S  K    S  + K
Sbjct:  166 VRFRCPAAGNPTPSISWLKNGKEFRGEHRIGG-IKLRHQQWSLVMESVVPSDRGNYTCVVENKFG-SIRQTYTLDVLERSPHRPILQAGLPANQTAI-LGSDVEFHCKVYSDAQP--HIQWLKHVEVNG--SKVGPDGTPYVTVLKTAGANTTDKELEVLSLHNVTF--------EDAGEYTCLAGNSIGFSHHSAWLVVLPAEEELMETDEAGSVYAGVLSYGVVFFLFILVVAAVILCRLRSPPKKGLGSPTVHK 407          
BLAST of Nou-darake-like-2 vs. Ensembl Mouse
Match: Fgfr3 (fibroblast growth factor receptor 3 [Source:MGI Symbol;Acc:MGI:95524])

HSP 1 Score: 60.4622 bits (145), Expect = 4.953e-9
Identity = 62/257 (24.12%), Postives = 107/257 (41.63%), Query Frame = 1
Query:  541 VTLDCTAVGES------LKYYWTFIGNNRMKNQIQAERNISKIIIKSVIPENEGVYKCEVGNIYGEKISRTFTVALTETAPDANMEIIGKKQDDLVTNIGQQVLLRCEVKSKYHRIHSIKWGKRIKSTGPDSLVKPNIVSWDQFTYNLLPETNIKKNFIMQNHIESFFTLAIRDNDQSGIYTCLAMDATGGTAHKIFNISTSSEDSFVEVQTKSYFFLLYILLPVV--LIFAIVCAIIYCSVKSSSKNTHNSVPLKK 1287
            V   C A G        LK    F G +R+   I+       ++++SV+P + G Y C V N +G  I +T+T+ + E +P   +   G   +     +G  V   C+V S       I+W K ++  G  S V P+   +          T  K+  ++  H  +F        + +G YTCLA ++ G + H  + +   +E+  +E       +   +   VV  L   +V A+I C ++S  K    S  + K
Sbjct:  166 VRFRCPAAGNPTPSISWLKNGKEFRGEHRIGG-IKLRHQQWSLVMESVVPSDRGNYTCVVENKFG-SIRQTYTLDVLERSPHRPILQAGLPANQTAI-LGSDVEFHCKVYSDAQP--HIQWLKHVEVNG--SKVGPDGTPYVTVLKTAGANTTDKELEVLSLHNVTF--------EDAGEYTCLAGNSIGFSHHSAWLVVLPAEEELMETDEAGSVYAGVLSYGVVFFLFILVVAAVILCRLRSPPKKGLGSPTVHK 407          
BLAST of Nou-darake-like-2 vs. Ensembl Mouse
Match: Fgfr3 (fibroblast growth factor receptor 3 [Source:MGI Symbol;Acc:MGI:95524])

HSP 1 Score: 60.077 bits (144), Expect = 6.185e-9
Identity = 62/257 (24.12%), Postives = 107/257 (41.63%), Query Frame = 1
Query:  541 VTLDCTAVGES------LKYYWTFIGNNRMKNQIQAERNISKIIIKSVIPENEGVYKCEVGNIYGEKISRTFTVALTETAPDANMEIIGKKQDDLVTNIGQQVLLRCEVKSKYHRIHSIKWGKRIKSTGPDSLVKPNIVSWDQFTYNLLPETNIKKNFIMQNHIESFFTLAIRDNDQSGIYTCLAMDATGGTAHKIFNISTSSEDSFVEVQTKSYFFLLYILLPVV--LIFAIVCAIIYCSVKSSSKNTHNSVPLKK 1287
            V   C A G        LK    F G +R+   I+       ++++SV+P + G Y C V N +G  I +T+T+ + E +P   +   G   +     +G  V   C+V S       I+W K ++  G  S V P+   +          T  K+  ++  H  +F        + +G YTCLA ++ G + H  + +   +E+  +E       +   +   VV  L   +V A+I C ++S  K    S  + K
Sbjct:  148 VRFRCPAAGNPTPSISWLKNGKEFRGEHRIGG-IKLRHQQWSLVMESVVPSDRGNYTCVVENKFG-SIRQTYTLDVLERSPHRPILQAGLPANQTAI-LGSDVEFHCKVYSDAQP--HIQWLKHVEVNG--SKVGPDGTPYVTVLKTAGANTTDKELEVLSLHNVTF--------EDAGEYTCLAGNSIGFSHHSAWLVVLPAEEELMETDEAGSVYAGVLSYGVVFFLFILVVAAVILCRLRSPPKKGLGSPTVHK 389          
BLAST of Nou-darake-like-2 vs. Ensembl Mouse
Match: Fgfr3 (fibroblast growth factor receptor 3 [Source:MGI Symbol;Acc:MGI:95524])

HSP 1 Score: 60.077 bits (144), Expect = 6.185e-9
Identity = 62/257 (24.12%), Postives = 107/257 (41.63%), Query Frame = 1
Query:  541 VTLDCTAVGES------LKYYWTFIGNNRMKNQIQAERNISKIIIKSVIPENEGVYKCEVGNIYGEKISRTFTVALTETAPDANMEIIGKKQDDLVTNIGQQVLLRCEVKSKYHRIHSIKWGKRIKSTGPDSLVKPNIVSWDQFTYNLLPETNIKKNFIMQNHIESFFTLAIRDNDQSGIYTCLAMDATGGTAHKIFNISTSSEDSFVEVQTKSYFFLLYILLPVV--LIFAIVCAIIYCSVKSSSKNTHNSVPLKK 1287
            V   C A G        LK    F G +R+   I+       ++++SV+P + G Y C V N +G  I +T+T+ + E +P   +   G   +     +G  V   C+V S       I+W K ++  G  S V P+   +          T  K+  ++  H  +F        + +G YTCLA ++ G + H  + +   +E+  +E       +   +   VV  L   +V A+I C ++S  K    S  + K
Sbjct:  148 VRFRCPAAGNPTPSISWLKNGKEFRGEHRIGG-IKLRHQQWSLVMESVVPSDRGNYTCVVENKFG-SIRQTYTLDVLERSPHRPILQAGLPANQTAI-LGSDVEFHCKVYSDAQP--HIQWLKHVEVNG--SKVGPDGTPYVTVLKTAGANTTDKELEVLSLHNVTF--------EDAGEYTCLAGNSIGFSHHSAWLVVLPAEEELMETDEAGSVYAGVLSYGVVFFLFILVVAAVILCRLRSPPKKGLGSPTVHK 389          
BLAST of Nou-darake-like-2 vs. UniProt/SwissProt
Match: sp|Q61851|FGFR3_MOUSE (Fibroblast growth factor receptor 3 OS=Mus musculus OX=10090 GN=Fgfr3 PE=1 SV=1)

HSP 1 Score: 60.8474 bits (146), Expect = 3.071e-8
Identity = 62/257 (24.12%), Postives = 107/257 (41.63%), Query Frame = 1
Query:  541 VTLDCTAVGES------LKYYWTFIGNNRMKNQIQAERNISKIIIKSVIPENEGVYKCEVGNIYGEKISRTFTVALTETAPDANMEIIGKKQDDLVTNIGQQVLLRCEVKSKYHRIHSIKWGKRIKSTGPDSLVKPNIVSWDQFTYNLLPETNIKKNFIMQNHIESFFTLAIRDNDQSGIYTCLAMDATGGTAHKIFNISTSSEDSFVEVQTKSYFFLLYILLPVV--LIFAIVCAIIYCSVKSSSKNTHNSVPLKK 1287
            V   C A G        LK    F G +R+   I+       ++++SV+P + G Y C V N +G  I +T+T+ + E +P   +   G   +     +G  V   C+V S       I+W K ++  G  S V P+   +          T  K+  ++  H  +F        + +G YTCLA ++ G + H  + +   +E+  +E       +   +   VV  L   +V A+I C ++S  K    S  + K
Sbjct:  166 VRFRCPAAGNPTPSISWLKNGKEFRGEHRIGG-IKLRHQQWSLVMESVVPSDRGNYTCVVENKFG-SIRQTYTLDVLERSPHRPILQAGLPANQTAI-LGSDVEFHCKVYSDAQP--HIQWLKHVEVNG--SKVGPDGTPYVTVLKTAGANTTDKELEVLSLHNVTF--------EDAGEYTCLAGNSIGFSHHSAWLVVLPAEEELMETDEAGSVYAGVLSYGVVFFLFILVVAAVILCRLRSPPKKGLGSPTVHK 407          
BLAST of Nou-darake-like-2 vs. UniProt/SwissProt
Match: sp|P22607|FGFR3_HUMAN (Fibroblast growth factor receptor 3 OS=Homo sapiens OX=9606 GN=FGFR3 PE=1 SV=1)

HSP 1 Score: 60.4622 bits (145), Expect = 3.327e-8
Identity = 62/258 (24.03%), Postives = 106/258 (41.09%), Query Frame = 1
Query:  541 VTLDCTAVGES------LKYYWTFIGNNRMKNQIQAERNISKIIIKSVIPENEGVYKCEVGNIYGEKISRTFTVALTETAPDANMEIIGKKQDDLVTNIGQQVLLRCEVKSKYHRIHSIKWGKRIKSTGPDSLVKPNIVSWDQFTYNLLPETNIKKNFIMQNHIESFFTLAIRDNDQSGIYTCLAMDATGGTAHKIFNISTSSEDSFVEVQTKS--YFFLLYILLPVVLIFAIVCAIIYCSVKSSSKNTHNSVPLKKF 1290
            V   C A G        LK    F G +R+   I+       ++++SV+P + G Y C V N +G  I +T+T+ + E +P   +   G   +     +G  V   C+V S       I+W K ++  G  S V P+   +          T  K+  ++  H  +F        + +G YTCLA ++ G + H  + +   +E+  VE       Y  +L   +   L   +V A+  C ++S  K    S  + K 
Sbjct:  172 VRFRCPAAGNPTPSISWLKNGREFRGEHRIGG-IKLRHQQWSLVMESVVPSDRGNYTCVVENKFG-SIRQTYTLDVLERSPHRPILQAGLPANQTAV-LGSDVEFHCKVYSDAQ--PHIQWLKHVEVNG--SKVGPDGTPYVTVLKTAGANTTDKELEVLSLHNVTF--------EDAGEYTCLAGNSIGFSHHSAWLVVLPAEEELVEADEAGSVYAGILSYGVGFFLFILVVAAVTLCRLRSPPKKGLGSPTVHKI 414          
BLAST of Nou-darake-like-2 vs. UniProt/SwissProt
Match: sp|Q9I8X3|FGFR3_DANRE (Fibroblast growth factor receptor 3 OS=Danio rerio OX=7955 GN=fgfr3 PE=2 SV=1)

HSP 1 Score: 58.151 bits (139), Expect = 1.900e-7
Identity = 66/276 (23.91%), Postives = 109/276 (39.49%), Query Frame = 1
Query:  505 EKRKFQPKIGDHVTLDCTAVGES------LKYYWTFIGNNRMKNQIQAERNISKIIIKSVIPENEGVYKCEVGNIYGEKISRTFTVALTETAPDANMEIIGKKQDDLVTNIGQQVLLRCEVKSKYHRIHSIKWGKRIKSTGPDSLVKPNIVSWDQFTYNLLPETNIKKNF---IMQNHIESFFTLAIRDNDQSGIYTCLAMDATGGTAHKIF-----NISTSSEDSFVEVQTKSYFFLLYILLPVVLIFAIVCAIIYCSVKSSSKNTHNSVPLKKF 1290
            EK+       + V   C A G        LK    F G  RM   I+       ++++S +P + G Y C V N YG  I  T+ + + E +P   +   G   +  V  +G  V   C+V S       I+W K I+  G             Q+  N  P  N+ K          +E  +   +   D +G YTCLA ++ G   H  +      +    ED + ++       L+Y+   V+ I  +V  II C +  +++ T  + P++K 
Sbjct:  153 EKKLLAVPAANTVKFRCPAAGNPTPSIHWLKNGKEFKGEQRMGG-IKLRHQQWSLVMESAVPSDRGNYTCVVQNKYG-SIKHTYQLDVLERSPHRPILQAGLPANQTVV-VGSDVEFHCKVYSDAQP--HIQWLKHIEVNG------------SQYGPNGAPYVNVLKTAGINTTDKELEILYLTNVSFED-AGQYTCLAGNSIGYNHHSAWLTVLPAVEMEREDDYADI-------LIYVTSCVLFILTMVI-IILCRMWINTQKTLPAPPVQKL 402          
BLAST of Nou-darake-like-2 vs. UniProt/SwissProt
Match: sp|P21802|FGFR2_HUMAN (Fibroblast growth factor receptor 2 OS=Homo sapiens OX=9606 GN=FGFR2 PE=1 SV=1)

HSP 1 Score: 55.8398 bits (133), Expect = 9.645e-7
Identity = 78/345 (22.61%), Postives = 140/345 (40.58%), Query Frame = 1
Query:  301 GKLLTIDPATVDKSGVYECKSXXXXXXXXXXXXXKIIDSQS------------EIVTKSCSNSVSPPIRDVSKGICFFNEEKRKFQPKIGDHVTLDCTAVGESL-KYYWT----------FIGNNRMKNQIQAERNISKIIIKSVIPENEGVYKCEVGNIYGEKISRTFTVALTETAPDANMEIIGKKQDDLVTNIGQQVLLRCEVKSKYHRIHSIKWGKRIKSTGPDSLVKPNIVSWDQFTYNLLPETNIKKNFIMQNHIESFFTLAIRDN--DQSGIYTCLAMDATGGTAHKIFNISTSSEDSFVEV-QTKSYFFLLYILLPVVLIFAIVCAIIYCSVKSSSK 1257
            G+ L I  AT   SG+Y C ++    +      V + D+ S            + V+++ +N  +P   +  K       EKR       + V   C A G  +    W            IG  +++NQ  +      +I++SV+P ++G Y C V N YG  I+ T+ + + E +P   +   G    +  T +G  V   C+V S       I+W K ++  G             ++  + LP   + K   +    +    L IR+   + +G YTCLA ++ G + H  +     +     E+  +  Y  +    + V LI  +V  +I C +K+++K
Sbjct:   89 GEYLQIKGATPRDSGLYACTASRTVDSETWYFMVNVTDAISSGDDEDDTDGAEDFVSENSNNKRAPYWTNTEK------MEKRLHAVPAANTVKFRCPAGGNPMPTMRWLKNGKEFKQEHRIGGYKVRNQHWS------LIMESVVPSDKGNYTCVVENEYG-SINHTYHLDVVERSPHRPILQAGLPA-NASTVVGGDVEFVCKVYSDAQ--PHIQWIKHVEKNG------------SKYGPDGLPYLKVLKAAGVNTTDKEIEVLYIRNVTFEDAGEYTCLAGNSIGISFHSAWLTVLPAPGREKEITASPDYLEIAIYCIGVFLIACMVVTVILCRMKNTTK 405          
BLAST of Nou-darake-like-2 vs. UniProt/SwissProt
Match: sp|Q90413|FGFR4_DANRE (Fibroblast growth factor receptor 4 OS=Danio rerio OX=7955 GN=fgfr4 PE=1 SV=1)

HSP 1 Score: 55.4546 bits (132), Expect = 1.273e-6
Identity = 63/271 (23.25%), Postives = 115/271 (42.44%), Query Frame = 1
Query:  505 EKRKFQPKIGDHVTLDCTAVGESL-KYYW-----TFIGNNRMKNQIQAERNISKIIIKSVIPENEGVYKCEVGNIYGEKISRTFTVALTETAPDANMEIIGKKQDDLVTNIGQQVLLRCEVKSKYHRIHSIKWGKRIKSTGPDSLVKPNIVSWDQFTYNLLPETNIKKNFIMQNHIESFFTLAIRDNDQSGIYTCLAMDATGGTAHKIFNISTSSEDSFVEV---QTKSYFFLLYILLPVVLIFAIVCAIIYCSVKSSSKNTHNSVPLKKF 1290
            EK+ +    G+ V   C A G  L    W      F G +R+   I+       ++++SV+P + G Y C V N YG  I+ T+ + + E +P   +   G  ++     +G      C+V S       I+W K I+  G  S   P+ + + +          +K   +  + +E  +   I   D +G Y+CLA ++ G +    +    S ED   EV   + K    ++Y    + L+ AIV  ++       S+   +++P++K 
Sbjct:  267 EKKLYAVPAGNTVKFRCPATGSPLPTIRWLKNGREFRGEHRIGG-IKLRHQHWSLVMESVVPSDRGNYSCVVENKYG-SIAHTYLLDVLERSPHRPILQAGLPKNTTAI-VGGDAQFLCKVYSDAQP--HIQWLKHIEMNG--SRYGPDGIPYVKI---------VKTGSLNMSEVEVLYLTNISMED-AGEYSCLAGNSIGFSHQSAWLTVLSEEDVAKEVDLMEAKYTDIIIYASGFLALVMAIVIVVLCRMQVHPSREPFDTLPVQKL 520          
BLAST of Nou-darake-like-2 vs. TrEMBL
Match: A0A068Q6P3 (Nou-darake like-2 protein OS=Dugesia japonica OX=6161 PE=2 SV=1)

HSP 1 Score: 583.948 bits (1504), Expect = 0.000e+0
Identity = 305/457 (66.74%), Postives = 365/457 (79.87%), Query Frame = 1
Query:  127 SGFSQPITVKNLNYIYSGASKLGYINSKLIVECPAKAQFYLWKFYQMQSDPQVLLQQEGKLLTIDPATVDKSGVYECKSXXXXXXXXXXXXXKIIDSQSEIVTKSCSNSVSPPIRDVSKGICFFNEEKRK-FQPKIGDHVTLDCTAVGESLKYYWTFIGNNRMKNQIQAERNISKIIIKSVIPENEGVYKCEVGNIYGEKISRTFTVALTETAPDANMEIIGKKQDDLVTNIGQQVLLRCEVKSKYHRIHSIKWGKRIKSTGPDSLVKPNIVSWDQFTYNLLPETNIKKNFIMQNHIESFFTLAIRDNDQSGIYTCLAMDATGGTAHKIFNISTSSEDSFVEVQTKSYFFLLYILLPVVLIFAIVCAIIYCSVKSSSKNTHNSVPLKKFXXXXXXXXXKEPVSNYYYPVSNNRPPLPQPNESQISLASPNTLTSYSSYGNYHMPSTNQPSCCSGNGV 1494
            + F   I+ KNL + YSG SKLG++N K+IVECP KAQFYLWK YQM ++PQVLLQQEGK LTIDP T DKSG+YECKSTTGF+NTDTN+TVKIID QSEIVT+ CS S+SP IRDV+KGICFFNE   K  + K+GD++ +DCTA G  LKY+W+FI +NRMK  +  E NISK+IIKSVIPENEG YKC++ N YG K+SRTF V L++  PD  ++IIG+KQDD+   IGQ++  +CEVKS Y+RIHSIKWGKRI+    DS  K N+VSWDQ+TY+LL E++I K  +  NH+ES   ++I D DQSGIYTCLAMDATG TAHK+FNI+ ++E    E  +KSYFFLLYILLPV+L+F  VCAIIYC VKSSSK ++NS+PLKK  T  TNN  K+P +NYYYPVSNNRPPLPQPNESQ SL SPNT+TSYSSYGNYHM STNQPSCCS NGV
Sbjct:   15 ANFHLSISFKNLIFTYSGISKLGFVNEKIIVECPVKAQFYLWKLYQMHTEPQVLLQQEGKFLTIDPVTADKSGIYECKSTTGFSNTDTNITVKIIDPQSEIVTELCSMSMSPKIRDVNKGICFFNERSSKVLRYKVGDNIEMDCTAAGTDLKYFWSFIDSNRMKRSLNREMNISKVIIKSVIPENEGSYKCDITNEYGNKLSRTFKVTLSDLPPD--LKIIGEKQDDVAAYIGQKIFFKCEVKSNYNRIHSIKWGKRIRHPISDSNTKLNLVSWDQYTYSLLSESDINKIILNPNHMESSINISIIDPDQSGIYTCLAMDATGRTAHKVFNITVTTEYQVAESNSKSYFFLLYILLPVILLFLFVCAIIYCCVKSSSKKSNNSLPLKKIATPTTNNVYKDP-ANYYYPVSNNRPPLPQPNESQASLVSPNTMTSYSSYGNYHMQSTNQPSCCSSNGV 468          
BLAST of Nou-darake-like-2 vs. TrEMBL
Match: A0A165FVL1 (Nou-darake-like-2 (Fragment) OS=Schmidtea mediterranea OX=79327 GN=ndl-2 PE=2 SV=1)

HSP 1 Score: 550.051 bits (1416), Expect = 0.000e+0
Identity = 285/289 (98.62%), Postives = 288/289 (99.65%), Query Frame = 1
Query:  619 QIQAERNISKIIIKSVIPENEGVYKCEVGNIYGEKISRTFTVALTETAPDANMEIIGKKQDDLVTNIGQQVLLRCEVKSKYHRIHSIKWGKRIKSTGPDSLVKPNIVSWDQFTYNLLPETNIKKNFIMQNHIESFFTLAIRDNDQSGIYTCLAMDATGGTAHKIFNISTSSEDSFVEVQTKSYFFLLYILLPVVLIFAIVCAIIYCSVKSSSKNTHNSVPLKKFXXXXXXXXXKEPVSNYYYPVSNNRPPLPQPNESQISLASPNTLTSYSSYGNYHMPSTNQPSCCSG 1485
            +++AERNISKIIIK VIPENEGVYKCEVGNIYGEKISRTFTVALTETAPDANMEIIGKKQDDLVTNIGQQVLLRCEVKSKYHRIHSIKWGKRIKSTGPDSLVKPNIVSWDQFTYNLLPETNIKKNFIMQNHIESFFTLAIRDNDQSGIYTCLAMDATGGTAHKIFNISTSSEDSFVEVQTKSYFFLLYILLPVVLIFAIVCAIIYCSVKSSSKNTHNSVPLKKFNTTNTNNTNKEPVSNYYYPVSNNRPPLPQPNESQISLASPNTLTSYSSYGNYHMPSTNQPSCCSG
Sbjct:    8 ELEAERNISKIIIKXVIPENEGVYKCEVGNIYGEKISRTFTVALTETAPDANMEIIGKKQDDLVTNIGQQVLLRCEVKSKYHRIHSIKWGKRIKSTGPDSLVKPNIVSWDQFTYNLLPETNIKKNFIMQNHIESFFTLAIRDNDQSGIYTCLAMDATGGTAHKIFNISTSSEDSFVEVQTKSYFFLLYILLPVVLIFAIVCAIIYCSVKSSSKNTHNSVPLKKFNTTNTNNTNKEPVSNYYYPVSNNRPPLPQPNESQISLASPNTLTSYSSYGNYHMPSTNQPSCCSG 296          
BLAST of Nou-darake-like-2 vs. TrEMBL
Match: T1DBL7 (NDK-6 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 375.941 bits (964), Expect = 9.022e-121
Identity = 211/462 (45.67%), Postives = 289/462 (62.55%), Query Frame = 1
Query:  130 GFSQPITVKNLNYIYSGASKLGYINSKLIVECPAKAQFYLWKFYQMQSDPQVLLQQEGKLLTIDPATVDKSGVYECKSXXXXXXXXXXXXXKIIDSQSEIVTKSCSNSVSPPIRDVSKGICFFNEE-KRKFQPKIGDHVTLDCTAVGESLKYYWTFIGNNRMKNQIQAERNISKIIIKSVIPENEGVYKCEVGNIYGEKISRTFTVALTETAPDANMEIIGKKQDDLVTNIGQQVLLRCEVKSKYHRIHSIKWGKRIKSTGPDSLVKPNIVSWDQFTYNLLPETNIKKNFIMQNHIESFFTLAIRDNDQSGIYTCLAMDATGGTAHKIFNISTSSEDSFVEVQT-KSYFFLLYILLPVVLIFAIVCAIIYCSVKSSSKNTHNSVPLKKFXXXXXXXXXKEPVSNYYYP-----VSNNRPPLPQPNESQISLASPNTLTSYSSYGNYHMPSTNQPSCCSGNGV 1494
              +QP   +N+ Y Y G SKLG + SK I+ECP    FY W+ +Q   D +VLL Q+ K +T D AT DKSG+YECKSTTGF N   N+T+KI+D +SEI  + CS       +D   G+CF N++ ++K + K+G ++ LDC  VG +L Y W FI    ++ ++    NIS+III ++IPENEG+YKCEV N  G KI R+F+V++++ + ++ +EIIG+K        G+ + + CE+K+ Y RIHSIKWGKRI     +S +  NIV WDQ  Y +LP   I +     N I S   L   +   SGIY CLAM+  GGTA+K+FN+ T S D F+E    +S FF LYIL P +LIF  +C +IYC VK+++  + N+VPLK+ N++  +N NK   SNYYYP     V+ N   LPQP ESQ S  SPNTL  Y+SYGNYH    +Q   C+ NGV
Sbjct:   19 AIAQP---RNIKYKYQGISKLGLVGSKFIIECPLTGPFYFWRLFQANLDSRVLLDQDSKSITFDFATTDKSGIYECKSTTGFGNAVINITIKILDPKSEISKEICSFRDIESSQDYLGGVCFLNDKYQKKTRYKMGSNIELDCQGVGLNLMYTWKFIDQTGLQVKMSKSDNISRIIITNLIPENEGIYKCEVMNEQGSKIYRSFSVSISDLSAESGIEIIGEKLVFHAVKYGENISMSCEIKNSYQRIHSIKWGKRIDDHIMESKMSNNIVLWDQHNYKVLPTLGIIEAVKEPNRITSTLILKNLEISSSGIYICLAMNTFGGTAYKLFNL-TVSPDIFMEHSVRRSQFFFLYILTPTILIFICICGVIYCCVKTNTTKSSNTVPLKQCNSSIPSNGNKSAASNYYYPATSPRVNTNYSSLPQPTESQSSFVSPNTLMPYNSYGNYHFAPQSQTPFCNSNGV 476          
BLAST of Nou-darake-like-2 vs. TrEMBL
Match: A0A0B6VQJ8 (Uncharacterized protein OS=Dugesia japonica OX=6161 GN=ndl-3 PE=2 SV=1)

HSP 1 Score: 114.005 bits (284), Expect = 3.282e-23
Identity = 101/364 (27.75%), Postives = 166/364 (45.60%), Query Frame = 1
Query:  184 SKLGYINSKLIVECPAKAQFYLWKFYQMQSDPQVLLQQEGKLLTIDPATVDKSGVYECKSXXXXXXXXXXXXXKIIDSQSEIVTKSCSNSVSPPIRDVSKGI------CFFNEEKRK-FQPKIGDHVTLDCTAVGESLKYYWTFIGNNRMKNQIQAERNISKII-IKSVIPENEGVYKCEVGNIYGEKISRTFTVALTETAPDANMEIIGKKQD--DLVTNIGQQVLLRCEVKSKY-HRIHSIKWGKRIKSTGPDSLVKPNIVSWDQFTYNLLPETNIKKNFIMQNHIESFFTLAIRDNDQSGIYTCLAMDATGGTAHKIFNISTSSEDSFVEVQTKSYFFLLYILLPVVLIFAIVCAIIYCSV 1242
            +KL +I S + + CP  A FY WK Y       +  Q + K L +     +    YEC +T+GF N + N+T+ ++D  S+   + C N    P    S G       CF N++K   F+   G  V LDC A G ++ Y W  +       Q   + N S +  + +V  ++ G Y C+V    G+K+ R F ++L E     N  I  +  +  ++ T + +   L C   +     I +IKWGK++ S   + L K  I+ W+  +Y LLPE  I       +   S +      +D +G Y C+ +  +G   +K F +S  +     E +    FF LYIL+P ++I   +   IY ++
Sbjct:   23 NKLFFIGSNVEILCPLDAPFYQWKKYYNDKVTNIF-QDDKKKLNVSLKLEESPTTYECGATSGFDNRNFNITIYVLDQNSKKAQELCYNE---PFGQKSAGKYRVKYPCFLNDQKETTFRIAKGSSVRLDCEASGTNVSYQWFSVNTINNHKQFLMKYNNSYVAEVDNVNDKSIGQYLCQVNTNSGKKLERNFEISLLEEPVRGNSLISIETPEIINISTKLNRNQKLNCRTNTLITETIRAIKWGKKLDSDSAN-LDKNQIIPWEGNSYKLLPENQISSRIDPDSKTVSTYLFKDVTSDTTGEYICVVITDSGQIKYKTFYVSVINNSG--EEEAPRSFFFLYILIPSLVIAICLFIGIYLTI 379          
BLAST of Nou-darake-like-2 vs. TrEMBL
Match: D4P939 (Smed-NDK-3 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 106.301 bits (264), Expect = 9.557e-21
Identity = 99/360 (27.50%), Postives = 160/360 (44.44%), Query Frame = 1
Query:  184 SKLGYINSKLIVECPAKAQFYLWKFYQMQSDPQVLLQQEGKLLTIDPATVDKSGVYECKSXXXXXXXXXXXXXKIIDSQSEIVTKSCSNSVSPPIRDVSKGI---CFFNEEKRK-FQPKIGDHVTLDCTAVGESLKYYWTFI--GNNRMKNQIQAERNISKIIIKSVIPENEGVYKCEVGNIYGEKISRTFTV-ALTETAPDANMEIIGKKQDDL---VTNIGQQVLLRCEVKSK-YHRIHSIKWGKRIKSTGPDSLVKPNIVSWDQFTYNLLPETNIKKNFIMQNHIESFFTLAIRDNDQSGIYTCLAMDATGGTAHKIFNISTSSEDSFVEVQTKSYFFLLYILLPVVLIFAIVCAII 1230
            +KL +I S + + CP  A FY WK Y       +  Q + + L +     +   +YEC +T+GF     N+TV IID  S++  + C      P   V   +   CF  E+K   F+   G  V  DC + G ++ Y W F    NNR   +     N S  +   V  ++ G Y CEV    G K+ R F +  ++E     N  I  +  + +   + N+ +Q  L C    + + +I ++KWGK++      +  K   + W+   Y LLPE  I       N I S +       + +G Y C  +  +G   +K FN+   +    VE + +   F LYIL+P ++I   +C+ I
Sbjct:    8 NKLFFIGSNMEIICPLDASFYQWKKYHNNKVTNIF-QDDKRKLNVSLKLEESPTIYECGATSGFGQRSVNITVFIIDQNSKLAQELCYVVPFDPASRVKHQVQYPCFVREQKEATFRMAKGLSVEFDCESSGSNVTYAWLFASSANNR---KTILTNNKSSTLKLDVNDKSAGNYFCEVRTKAGAKLERVFELLVISEENTHNNFAISIENTETINITMKNLKKQ-QLNCRTNEQIFEKIQTVKWGKKL-DLAMKNFDKSQTIPWEGNLYKLLPENQIVTPTDPGNRIVSSYYFKDVSLEMAGEYMCAIITNSGTIKYKTFNVYVINNS--VEEEIRQSLFFLYILIPSLII--AICSFI 357          
BLAST of Nou-darake-like-2 vs. Ensembl Cavefish
Match: fgfr3 (fibroblast growth factor receptor 3 [Source:NCBI gene;Acc:58129])

HSP 1 Score: 58.151 bits (139), Expect = 2.444e-8
Identity = 67/276 (24.28%), Postives = 109/276 (39.49%), Query Frame = 1
Query:  505 EKRKFQPKIGDHVTLDCTAVGES------LKYYWTFIGNNRMKNQIQAERNISKIIIKSVIPENEGVYKCEVGNIYGEKISRTFTVALTETAPDANMEIIGKKQDDLVTNIGQQVLLRCEVKSKYHRIHSIKWGKRIKSTGPDSLVKPNIVSWDQFTYNLLPETNIKKNF---IMQNHIESFFTLAIRDNDQSGIYTCLAMDATGGTAHKIF-----NISTSSEDSFVEVQTKSYFFLLYILLPVVLIFAIVCAIIYCSVKSSSKNTHNSVPLKKF 1290
            EK+       + V   C A G        LK    F G  RM   I+       ++++S +P + G Y C V N YG  I+ T+ + + E +P   +   G   +  V  +G  V   C+V S       I+W K I+  G             ++  N  P   + K          +E  F   +   D +G YTCLA ++ G   H  +      +    ED +         FL+   + V+ +F IV  II C ++ S++ T  + P++K 
Sbjct:  168 EKKLLAVPAANTVKFRCAAAGNPTPTIHWLKNGKEFKGEQRMGG-IKLRHLQWSLVMESAVPSDRGNYTCVVQNKYG-TITHTYQLDVLERSPHRPILQAGLPANQTV-EVGSNVEFYCKVYSDAQP--HIQWLKHIEVNG------------SRYGSNGAPYVTVLKTAGINTTDKELEVLFLTNVSYED-AGEYTCLAGNSIGYAYHSAWLTVIPAVELDKEDDYAN-------FLISGTVCVLFVFTIV-IIILCRLRMSTQKTLPTPPVQKL 417          
BLAST of Nou-darake-like-2 vs. Ensembl Cavefish
Match: fgfr1a (fibroblast growth factor receptor 1a [Source:NCBI gene;Acc:30705])

HSP 1 Score: 55.4546 bits (132), Expect = 1.452e-7
Identity = 61/250 (24.40%), Postives = 106/250 (42.40%), Query Frame = 1
Query:  541 VTLDCTAVGE---SLKYYWTFIGNNRMKNQ----IQAERNISKIIIKSVIPENEGVYKCEVGNIYGEKISRTFTVALTETAPDANMEIIGKKQDDLVTNIGQQVLLRCEVKSKYHRIHSIKWGKRIKSTGPDSLVKPNIVSWDQFTYNLLPETNIKKNFIMQNHIESFFTLAIRDN--DQSGIYTCLAMDATGGTAHKIFNISTSSEDSFVEVQTKSYFFLLYILLPVVLIFAIVCAIIYCSVKSSSKNT 1263
            V   C AVG    +LK  W   G    ++Q     +   ++  II+ SV+P ++G Y C V N YG  I+ T+ + + E +P   +   G   +  V  +G  V   C+V S       I+W K I+  G             +   + LP   + K   +    +    L +R+   + SG+YTCLA ++ G + H  + ++         +  ++Y  +L   +   LI  +V   +   + SSSK +
Sbjct:   90 VKFRCPAVGSPNPTLK--WLKNGKEFKRDQRIGGFKVRDHMWSIIMDSVVPSDKGNYTCLVENKYGS-INHTYQLDVVERSPHRPILQAGLPANRTVV-VGSDVEFECKVFSDPQP--HIQWLKHIEVNG------------SKVGSDGLPYVRVLKTAGLNTTDKDMEVLQLRNVTIEDSGVYTCLAGNSIGNSHHSAW-LTVYEAVPPTPLPNQTYLEVLIYCVGFFLICVMVVIAVGVKMHSSSKKS 320          
BLAST of Nou-darake-like-2 vs. Ensembl Cavefish
Match: fgfr3 (fibroblast growth factor receptor 3 [Source:NCBI gene;Acc:58129])

HSP 1 Score: 53.9138 bits (128), Expect = 4.026e-7
Identity = 68/272 (25.00%), Postives = 110/272 (40.44%), Query Frame = 1
Query:  505 EKRKFQPKIGDHVTLDCTAVGES------LKYYWTFIGNNRMKNQIQAERNISKIIIKSVIPENEGVYKCEVGNIYGEKISRTFTVALTETAPDANMEIIGKKQDDLVTNIGQQVLLRCEVKSKYHRIHSIKWGKRIKSTGPDSLVKPNIVSWDQFTYNLLPETNIKKNF---IMQNHIESFFTLAIRDNDQSGIYTCLAMDATGGTAHKIFNISTSSEDSFVEVQTKSYF-FLLYILLPVVLIFAIVCAIIYCSVKSSSKNTHNSVPLKKF 1290
            EK+       + V   C A G        LK    F G  RM   I+   + S ++++S +P + G Y C V N YG  I+ T+ + + E +P   +   G   +  V  +G  V   C+V S       I+W K I+  G             ++  N  P   + K          +E  F   +   D +G YTCLA ++ G   H  +            V +  Y  FL+   + V+ +F IV  II C ++ S++ T  + P++K 
Sbjct:    2 EKKLLAVPAANTVKFRCAAAGNPTPTIHWLKNGKEFKGEQRMGG-IKVRLSWS-LVMESAVPSDRGNYTCVVQNKYG-TITHTYQLDVLERSPHRPILQAGLPANQTV-EVGSNVEFYCKVYSDAQP--HIQWLKHIEVNG------------SRYGSNGAPYVTVLKTAGINTTDKELEVLFLTNVSYED-AGEYTCLAGNSIGYAYHSAWLTVIPG----TAVLSDDYANFLISGTVCVLFVFTIVI-IILCRLRMSTQKTLPTPPVQKL 249          
BLAST of Nou-darake-like-2 vs. Ensembl Cavefish
Match: fgfr4 (fibroblast growth factor receptor 4 [Source:NCBI gene;Acc:103029904])

HSP 1 Score: 53.1434 bits (126), Expect = 9.067e-7
Identity = 63/273 (23.08%), Postives = 117/273 (42.86%), Query Frame = 1
Query:  505 EKRKFQPKIGDHVTLDCTAVG------ESLKYYWTFIGNNRMKNQIQAERNISKIIIKSVIPENEGVYKCEVGNIYGEKISRTFTVALTETAPDANMEIIGKKQDDLVTNI----GQQVLLRCEVKSKYHRIHSIKWGKRIKSTGPDSLVKPNIVSWDQFTYNLLPETNIKKNFIMQNHIESFFTLAIRDNDQSGIYTCLAMDATGGTAHKIFNISTSSEDSFVEV-QTKSYFFLLYILLPVVLIFAIVCAIIYCSVKSSSKNTHNSVPLKKF 1290
            EK+ +    G+ +   C A G        LK    F G +R+   I+       ++++SV+P + G Y C V N YG  I+ ++ + + E +P   +      Q  L TNI    G+     C+V S       I+W K I+  G  S   P+   + +          +K   +  + +E  +   I   D +G YTCLA ++ G +    +    S E   +++ +TK    ++Y    + L+ AIV  ++       ++   +++P++K 
Sbjct:  285 EKKLYAVPAGNTIKFRCPATGIPLPTIRWLKNGREFRGEHRIGG-IKLRHQHWSLVMESVVPSDRGNYTCVVENKYG-SIAHSYLLDVLERSPHRPI-----LQAGLPTNITAVVGEDAQFLCKVYSDAQ--PHIQWLKHIEVNG--SRYGPDGTPYVKV---------VKTGSLNMSEVEVLYLTNITMED-AGEYTCLAGNSIGFSHQSAWLTVLSEEAKEIDLMETKYTDIIIYASGFLALVMAIVIVVLCRMQVHPTREPFDALPVQKL 536          
BLAST of Nou-darake-like-2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006750.1 (pep scaffold:Pmarinus_7.0:GL477426:19036:34193:1 gene:ENSPMAG00000006079.1 transcript:ENSPMAT00000006750.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.5286 bits (127), Expect = 8.020e-8
Identity = 47/196 (23.98%), Postives = 85/196 (43.37%), Query Frame = 1
Query:  505 EKRKFQPKIGDHVTLDCTAVGESLKYYWTFIGNNRMKNQIQAERNISKIIIKSVIPENEGVYKCEVGNIYGEKISRTFTVALTETAPDANMEIIGKKQDDLVTNIGQQVLLRCEVKSKYHRIHSIKWGKRIKSTGPDSLVKPNIVSWDQFTYNLLPETNIKKNFIMQNHIESFFTLAIRDNDQSGIYTCLAMDATG 1092
             +R     +G  V L C A G        F   +   +  Q ++  + +I++S+ PE+ G Y C V N +GE IS T+ + + E    +   + G    +   + G    L+C+V+S    +  I+W KR++  G   L     V   +F   +LP   +       +++     +  R  D +G+Y CL  ++ G
Sbjct:  159 RRRVIARPVGSSVRLKCNAGGSPRPDVVWFKDEHVFGDAAQGKKRWT-LILRSLRPEDAGRYTCRVSNRFGE-ISATYKIDVIERM-RSKPVLTGTHPVNTTVDFGGSTSLQCKVRSDVKPV--IQWLKRVEPGGVHGLNSTIDVRGQRFA--VLPTGEVWSR-PDGSYLNKLVIVRARAED-AGMYICLGANSMG 345          
BLAST of Nou-darake-like-2 vs. Ensembl Medaka
Match: fgfr4 (fibroblast growth factor receptor 4 [Source:NCBI gene;Acc:100049521])

HSP 1 Score: 63.1586 bits (152), Expect = 6.881e-10
Identity = 67/273 (24.54%), Postives = 119/273 (43.59%), Query Frame = 1
Query:  505 EKRKFQPKIGDHVTLDCTAVG------ESLKYYWTFIGNNRMKNQIQAERNISKIIIKSVIPENEGVYKCEVGNIYGEKISRTFTVALTETAPDANMEIIGKKQDDLVTNIGQQVLLRCEVKSKYHRIHSIKWGKRIKSTGPDSLVKPNIVSWDQFTYNLLPETNI-KKNFIMQNHIESFFTLAIRDNDQSGIYTCLAMDATGGTAHKIFNISTSSE----DSFVEVQTKSYFFLLYILLPVVLIFAIVCAIIYCSVKSSSKNTHNSVPLKKF 1290
            EK+ +    G+ V   C A+G        LK    F G +R+   I+       ++++SV+P + G Y C V N YG  IS  + + + E +P   +   G   +     IG  V  RC+V S       I+W K I+  G             +F  + +P  N+ K   +  + +E  +   +   D +G YTCLA ++  G AH+   ++  SE    DS   ++TK    ++Y    + LI A++  ++        +   +++P++K 
Sbjct:  420 EKKLYAVPAGNTVRFRCPAMGTPIPTIRWLKNGREFRGEHRIGG-IKLRHQHWSLVMESVVPSDRGNYTCVVENEYG-SISHNYVLDVLERSPHRPILQAGLPANTTAV-IGSDVQFRCKVYSDAQ--PHIQWLKHIEING------------SRFAPDGVPYVNVLKTGSLNMSDVEVLYLSKVTMED-AGEYTCLAGNSI-GYAHQSAWLTVLSEEEAADSMETMETKYTDIVIYACGFLALIMAVIIVVLCRMQVQPRREPFDALPVQKL 673          
BLAST of Nou-darake-like-2 vs. Ensembl Medaka
Match: fgfr3 (fibroblast growth factor receptor 3 [Source:NCBI gene;Acc:100049424])

HSP 1 Score: 57.7658 bits (138), Expect = 2.444e-8
Identity = 67/273 (24.54%), Postives = 118/273 (43.22%), Query Frame = 1
Query:  505 EKRKFQPKIGDHVTLDCTAVGESL-KYYW-----TFIGNNRMKNQIQAERNISKIIIKSVIPENEGVYKCEVGNIYGEKISRTFTVALTETAPDANMEIIGKKQDDLVTNIGQQVLLRCEVKSKYHRIHSIKWGKRIKSTGPDSLVKPNIVSWDQFTYNLLPETNIKKNFIMQNHIESFFTLAIRDNDQSGIYTCLAMDATGGTAHK----IFNISTSS-EDSFVEVQTKSYFFLLYILLPVVLIFAIVCAIIYCSVKSSSKNTHNSVPLKKF 1290
            +K+       + V   C A G  +   +W      F G  RM   I+       ++++S +P + G Y C V N YG  IS+T+ + + E +P   +   G   +  V  +G  V   C+V S       I+W K I+  G  +   P+ V +     N+L    I         +E  F   +   D +G YTCLA ++ G T +     +  +S    ED + ++       L+Y+   V+ I A+V  +I C ++ +++ T  + P++K 
Sbjct:   42 DKKLLAVPAANTVKFRCPANGNPIPTIHWLKNGKEFKGEQRMGG-IKVREEQWSLVMESAVPSDRGNYTCVVQNKYG-TISQTYQLDVLERSPHRPILQAGLPANQTVF-VGNDVEFHCKVYSDAQ--PHIQWLKHIEVNG--TRYGPDGVPY----VNILKTAGINTT---DKELEVLFLSNVSFED-AGEYTCLAGNSIGFTHNSAWLTVLPVSNPKLEDEYADI-------LIYVTGCVLFILAVV-IVILCRMRMTTQKTVPAPPVQKL 291          
BLAST of Nou-darake-like-2 vs. Ensembl Medaka
Match: fgfr3 (fibroblast growth factor receptor 3 [Source:NCBI gene;Acc:100049424])

HSP 1 Score: 57.7658 bits (138), Expect = 2.675e-8
Identity = 63/272 (23.16%), Postives = 119/272 (43.75%), Query Frame = 1
Query:  505 EKRKFQPKIGDHVTLDCTAVGESL-KYYW-----TFIGNNRMKNQIQAERNISKIIIKSVIPENEGVYKCEVGNIYGEKISRTFTVALTETAPDANMEIIGKKQDDLVTNIGQQVLLRCEVKSKYHRIHSIKWGKRIKST----GPDSLVKPNIVSWDQFTYNLLPETNIKKNFIMQNHIESFFTLAIRDNDQSGIYTCLAMDATGGTAHKIFNISTSSEDSFVEVQTKSYFFLLYILLPVVLIFAIVCAIIYCSVKSSSKNTHNSVPLKKF 1290
            +K+       + V   C A G  +   +W      F G  RM   I+       ++++S +P + G Y C V N YG  IS+T+ + + E +P   +   G   +  V  +G  V   C+V S       I+W K I+      GPD +   NI+           ++N+ +  +  + ++  F +  +D    G Y C A +   G + K F +  +   S  +++ +    L+Y+   V+ I A+V  +I C ++ +++ T  + P++K 
Sbjct:  172 DKKLLAVPAANTVKFRCPANGNPIPTIHWLKNGKEFKGEQRMGG-IKLRHQQWSLVMESAVPSDRGNYTCVVQNKYG-TISQTYQLDVLERSPHRPILQAGLPANQTVF-VGNDVEFHCKVYSDAQ--PHIQWLKHIEVNGTRYGPDGVPYVNIL-----------KSNVSRQTVTHSKLK-LFNVTEKDE---GKYWCRASNFV-GKSEKAFWLEVTESVSNPKLEDEYADILIYVTGCVLFILAVVI-VILCRMRMTTQKTVPAPPVQKL 421          
BLAST of Nou-darake-like-2 vs. Ensembl Medaka
Match: fgfr3 (fibroblast growth factor receptor 3 [Source:NCBI gene;Acc:100049424])

HSP 1 Score: 57.7658 bits (138), Expect = 3.150e-8
Identity = 67/273 (24.54%), Postives = 118/273 (43.22%), Query Frame = 1
Query:  505 EKRKFQPKIGDHVTLDCTAVGESL-KYYW-----TFIGNNRMKNQIQAERNISKIIIKSVIPENEGVYKCEVGNIYGEKISRTFTVALTETAPDANMEIIGKKQDDLVTNIGQQVLLRCEVKSKYHRIHSIKWGKRIKSTGPDSLVKPNIVSWDQFTYNLLPETNIKKNFIMQNHIESFFTLAIRDNDQSGIYTCLAMDATGGTAHK----IFNISTSS-EDSFVEVQTKSYFFLLYILLPVVLIFAIVCAIIYCSVKSSSKNTHNSVPLKKF 1290
            +K+       + V   C A G  +   +W      F G  RM   I+       ++++S +P + G Y C V N YG  IS+T+ + + E +P   +   G   +  V  +G  V   C+V S       I+W K I+  G  +   P+ V +     N+L    I         +E  F   +   D +G YTCLA ++ G T +     +  +S    ED + ++       L+Y+   V+ I A+V  +I C ++ +++ T  + P++K 
Sbjct:  172 DKKLLAVPAANTVKFRCPANGNPIPTIHWLKNGKEFKGEQRMGG-IKLRHQQWSLVMESAVPSDRGNYTCVVQNKYG-TISQTYQLDVLERSPHRPILQAGLPANQTVF-VGNDVEFHCKVYSDAQ--PHIQWLKHIEVNG--TRYGPDGVPY----VNILKTAGINTT---DKELEVLFLSNVSFED-AGEYTCLAGNSIGFTHNSAWLTVLPVSNPKLEDEYADI-------LIYVTGCVLFILAVVI-VILCRMRMTTQKTVPAPPVQKL 421          
BLAST of Nou-darake-like-2 vs. Ensembl Medaka
Match: ENSORLT00000000391.2 (fibroblast growth factor receptor 1-A [Source:NCBI gene;Acc:101155126])

HSP 1 Score: 51.2174 bits (121), Expect = 3.061e-6
Identity = 61/255 (23.92%), Postives = 108/255 (42.35%), Query Frame = 1
Query:  541 VTLDCTAVGESL-KYYWTFIGNNRMKNQ----IQAERNISKIIIKSVIPENEGVYKCEVGNIYGEKISRTFTVALTETAPDANMEIIGKKQDDLVTNIGQQVLLRCEVKSKYHRIHSIKWGKRIKSTGPDSLVKPNIVSWDQFTYNLLPETNIKKNFIMQNHIESFFTLAIRDN--DQSGIYTCLAMDATGGTAHKIF-NISTSSEDSFVEVQT--KSYFFLLYILLPVVLIFAIVCAIIYCSVKSSSKNTHNSV 1275
            V   C A G  +   +W   G    ++Q     + + +   +I++SV+P +EG Y C V N +G  +  T+ + + E +P   +   G   +     +G      C V S       I+W K I   G  S   P   S+ Q          + K   + +  +    L +R+   + +G+YTCLA ++ G + H  +  + +    S V  QT    +F+ L   + +VL  A V   +YC+ K S  ++  +V
Sbjct:   92 VRFRCPATGNPVPTLHWLKNGEEFSRDQRIGGFKIKDHTWSLIMESVVPSDEGNYTCVVENEHG-SLRHTYQLDIVERSPHRPILQAGLPANQTAV-VGGDAQFVCRVFSDPQ--PHIQWLKHIVVNG--SREGPEGHSFVQ----------VLKTAGLNSTDKEMEVLTLRNVTLEDAGVYTCLAQNSIGMSYHSAWLTVLSEPPPSAVPSQTFLDIFFYCLGFSVIIVLAIAAVICRLYCTPKKSDFSSQLAV 330          
BLAST of Nou-darake-like-2 vs. Planmine SMEST
Match: SMESG000027359.1 (SMESG000027359.1)

HSP 1 Score: 868.611 bits (2243), Expect = 0.000e+0
Identity = 469/470 (99.79%), Postives = 470/470 (100.00%), Query Frame = 1
Query:   85 MKNXXXXXXXXXXXSGFSQPITVKNLNYIYSGASKLGYINSKLIVECPAKAQFYLWKFYQMQSDPQVLLQQEGKLLTIDPATVDKSGVYECKSXXXXXXXXXXXXXKIIDSQSEIVTKSCSNSVSPPIRDVSKGICFFNEEKRKFQPKIGDHVTLDCTAVGESLKYYWTFIGNNRMKNQIQAERNISKIIIKSVIPENEGVYKCEVGNIYGEKISRTFTVALTETAPDANMEIIGKKQDDLVTNIGQQVLLRCEVKSKYHRIHSIKWGKRIKSTGPDSLVKPNIVSWDQFTYNLLPETNIKKNFIMQNHIESFFTLAIRDNDQSGIYTCLAMDATGGTAHKIFNISTSSEDSFVEVQTKSYFFLLYILLPVVLIFAIVCAIIYCSVKSSSKNTHNSVPLKKFXXXXXXXXXKEPVSNYYYPVSNNRPPLPQPNESQISLASPNTLTSYSSYGNYHMPSTNQPSCCSGNGV 1494
            MKNLILELIIITIISGFSQPITVKNLNYIYSGASKLGYINSKLIVECPAKAQFYLWKFYQMQSDPQVLLQQEGKLLTIDPATVDKSGVYECKSTTGFTNTDTNVTVKIIDSQSEIVTKSCSNSVSPPIRDVSKGICFFNEEKRKFQPKIGDHVTLDCTAVGE+LKYYWTFIGNNRMKNQIQAERNISKIIIKSVIPENEGVYKCEVGNIYGEKISRTFTVALTETAPDANMEIIGKKQDDLVTNIGQQVLLRCEVKSKYHRIHSIKWGKRIKSTGPDSLVKPNIVSWDQFTYNLLPETNIKKNFIMQNHIESFFTLAIRDNDQSGIYTCLAMDATGGTAHKIFNISTSSEDSFVEVQTKSYFFLLYILLPVVLIFAIVCAIIYCSVKSSSKNTHNSVPLKKFNTTNTNNTNKEPVSNYYYPVSNNRPPLPQPNESQISLASPNTLTSYSSYGNYHMPSTNQPSCCSGNGV
Sbjct:    1 MKNLILELIIITIISGFSQPITVKNLNYIYSGASKLGYINSKLIVECPAKAQFYLWKFYQMQSDPQVLLQQEGKLLTIDPATVDKSGVYECKSTTGFTNTDTNVTVKIIDSQSEIVTKSCSNSVSPPIRDVSKGICFFNEEKRKFQPKIGDHVTLDCTAVGENLKYYWTFIGNNRMKNQIQAERNISKIIIKSVIPENEGVYKCEVGNIYGEKISRTFTVALTETAPDANMEIIGKKQDDLVTNIGQQVLLRCEVKSKYHRIHSIKWGKRIKSTGPDSLVKPNIVSWDQFTYNLLPETNIKKNFIMQNHIESFFTLAIRDNDQSGIYTCLAMDATGGTAHKIFNISTSSEDSFVEVQTKSYFFLLYILLPVVLIFAIVCAIIYCSVKSSSKNTHNSVPLKKFNTTNTNNTNKEPVSNYYYPVSNNRPPLPQPNESQISLASPNTLTSYSSYGNYHMPSTNQPSCCSGNGV 470          
BLAST of Nou-darake-like-2 vs. Planmine SMEST
Match: SMESG000046208.1 (SMESG000046208.1)

HSP 1 Score: 108.997 bits (271), Expect = 3.292e-25
Identity = 100/363 (27.55%), Postives = 163/363 (44.90%), Query Frame = 1
Query:  175 SGASKLGYINSKLIVECPAKAQFYLWKFYQMQSDPQVLLQQEGKLLTIDPATVDKSGVYECKSXXXXXXXXXXXXXKIIDSQSEIVTKSCSNSVSPPIRDVSKGI---CFFNEEKRK-FQPKIGDHVTLDCTAVGESLKYYWTFI--GNNRMKNQIQAERNISKIIIKSVIPENEGVYKCEVGNIYGEKISRTFTV-ALTETAPDANMEIIGKKQDDL---VTNIGQQVLLRCEVKSK-YHRIHSIKWGKRIKSTGPDSLVKPNIVSWDQFTYNLLPETNIKKNFIMQNHIESFFTLAIRDNDQSGIYTCLAMDATGGTAHKIFNISTSSEDSFVEVQTKSYFFLLYILLPVVLIFAIVCAII 1230
            +  +KL +I S + + CP  A FY WK Y       +  Q + + L +     +   +YEC +T+GF     N+TV IID  S++  + C      P   V   +   CF  E+K   F+   G  V  DC + G ++ Y W F    NNR   +     N S  +   V  ++ G Y CEV    G K+ R F +  ++E     N  I  +  + +   + N+ +Q  L C    + + +I ++KWGK++      +  K  ++ W+   Y LLPE  I      +N I S +       + +G Y C  +  TG   +K FN+   +    VE + +   F LYIL+P ++I   +C+ I
Sbjct:   16 ASINKLFFIGSNMEIICPLDATFYQWKKYHNNKVTNIF-QDDKRKLNVSLKLEESPTIYECGATSGFGQRSVNITVFIIDQNSKLAQELCYVVPFDPASRVKHQVQYPCFVREQKEATFRMAKGLSVEFDCESSGSNVTYAWLFASSANNR---KTILTNNKSSTLKLDVNDKSAGNYFCEVRTKAGAKLERVFELLVISEENTRKNFAISIENTETINITMKNLKKQ-QLNCRTNEQIFEKIQTVKWGKKL-DLAMKNFDKSQMIPWEGNLYKLLPENQIVTPPDPENRIVSSYYFKDVSLEMAGEYMCAIITNTGTIKYKTFNVYVINNS--VEEEIRQSLFFLYILIPSLII--AICSFI 368          
BLAST of Nou-darake-like-2 vs. Planmine SMEST
Match: SMESG000046208.1 (SMESG000046208.1)

HSP 1 Score: 108.997 bits (271), Expect = 3.907e-25
Identity = 100/363 (27.55%), Postives = 163/363 (44.90%), Query Frame = 1
Query:  175 SGASKLGYINSKLIVECPAKAQFYLWKFYQMQSDPQVLLQQEGKLLTIDPATVDKSGVYECKSXXXXXXXXXXXXXKIIDSQSEIVTKSCSNSVSPPIRDVSKGI---CFFNEEKRK-FQPKIGDHVTLDCTAVGESLKYYWTFI--GNNRMKNQIQAERNISKIIIKSVIPENEGVYKCEVGNIYGEKISRTFTV-ALTETAPDANMEIIGKKQDDL---VTNIGQQVLLRCEVKSK-YHRIHSIKWGKRIKSTGPDSLVKPNIVSWDQFTYNLLPETNIKKNFIMQNHIESFFTLAIRDNDQSGIYTCLAMDATGGTAHKIFNISTSSEDSFVEVQTKSYFFLLYILLPVVLIFAIVCAII 1230
            +  +KL +I S + + CP  A FY WK Y       +  Q + + L +     +   +YEC +T+GF     N+TV IID  S++  + C      P   V   +   CF  E+K   F+   G  V  DC + G ++ Y W F    NNR   +     N S  +   V  ++ G Y CEV    G K+ R F +  ++E     N  I  +  + +   + N+ +Q  L C    + + +I ++KWGK++      +  K  ++ W+   Y LLPE  I      +N I S +       + +G Y C  +  TG   +K FN+   +    VE + +   F LYIL+P ++I   +C+ I
Sbjct:   20 ASINKLFFIGSNMEIICPLDATFYQWKKYHNNKVTNIF-QDDKRKLNVSLKLEESPTIYECGATSGFGQRSVNITVFIIDQNSKLAQELCYVVPFDPASRVKHQVQYPCFVREQKEATFRMAKGLSVEFDCESSGSNVTYAWLFASSANNR---KTILTNNKSSTLKLDVNDKSAGNYFCEVRTKAGAKLERVFELLVISEENTRKNFAISIENTETINITMKNLKKQ-QLNCRTNEQIFEKIQTVKWGKKL-DLAMKNFDKSQMIPWEGNLYKLLPENQIVTPPDPENRIVSSYYFKDVSLEMAGEYMCAIITNTGTIKYKTFNVYVINNS--VEEEIRQSLFFLYILIPSLII--AICSFI 372          
BLAST of Nou-darake-like-2 vs. Planmine SMEST
Match: SMESG000046244.1 (SMESG000046244.1)

HSP 1 Score: 106.301 bits (264), Expect = 2.466e-24
Identity = 99/360 (27.50%), Postives = 160/360 (44.44%), Query Frame = 1
Query:  184 SKLGYINSKLIVECPAKAQFYLWKFYQMQSDPQVLLQQEGKLLTIDPATVDKSGVYECKSXXXXXXXXXXXXXKIIDSQSEIVTKSCSNSVSPPIRDVSKGI---CFFNEEKRK-FQPKIGDHVTLDCTAVGESLKYYWTFI--GNNRMKNQIQAERNISKIIIKSVIPENEGVYKCEVGNIYGEKISRTFTV-ALTETAPDANMEIIGKKQDDL---VTNIGQQVLLRCEVKSK-YHRIHSIKWGKRIKSTGPDSLVKPNIVSWDQFTYNLLPETNIKKNFIMQNHIESFFTLAIRDNDQSGIYTCLAMDATGGTAHKIFNISTSSEDSFVEVQTKSYFFLLYILLPVVLIFAIVCAII 1230
            +KL +I S + + CP  A FY WK Y       +  Q + + L +     +   +YEC +T+GF     N+TV IID  S++  + C      P   V   +   CF  E+K   F+   G  V  DC + G ++ Y W F    NNR   +     N S  +   V  ++ G Y CEV    G K+ R F +  ++E     N  I  +  + +   + N+ +Q  L C    + + +I ++KWGK++      +  K   + W+   Y LLPE  I       N I S +       + +G Y C  +  +G   +K FN+   +    VE + +   F LYIL+P ++I   +C+ I
Sbjct:   14 NKLFFIGSNMEIICPLDASFYQWKKYHNNKVTNIF-QDDKRKLNVSLKLEESPTIYECGATSGFDQRSVNITVFIIDQNSKLAQELCYVVPFDPASRVKHQVQYPCFVREQKEATFRMAKGLSVEFDCESSGSNVTYAWLFASSANNR---KTILTNNKSSTLKLDVNDKSAGNYFCEVRTKAGAKLERVFELLVISEENTHNNFAISIENTETINITMKNLKKQ-QLNCRTNEQIFEKIQTVKWGKKL-DLAMKNFDKSQTIPWEGNLYKLLPENQIVTPTDPGNRIVSSYYFKDVSLEMAGEYMCAIITNSGTIKYKTFNVYVINNS--VEEEIRQSLFFLYILIPSLII--AICSFI 363          
BLAST of Nou-darake-like-2 vs. Planmine SMEST
Match: SMESG000046244.1 (SMESG000046244.1)

HSP 1 Score: 106.301 bits (264), Expect = 2.589e-24
Identity = 99/363 (27.27%), Postives = 161/363 (44.35%), Query Frame = 1
Query:  175 SGASKLGYINSKLIVECPAKAQFYLWKFYQMQSDPQVLLQQEGKLLTIDPATVDKSGVYECKSXXXXXXXXXXXXXKIIDSQSEIVTKSCSNSVSPPIRDVSKGI---CFFNEEKRK-FQPKIGDHVTLDCTAVGESLKYYWTFI--GNNRMKNQIQAERNISKIIIKSVIPENEGVYKCEVGNIYGEKISRTFTV-ALTETAPDANMEIIGKKQDDL---VTNIGQQVLLRCEVKSK-YHRIHSIKWGKRIKSTGPDSLVKPNIVSWDQFTYNLLPETNIKKNFIMQNHIESFFTLAIRDNDQSGIYTCLAMDATGGTAHKIFNISTSSEDSFVEVQTKSYFFLLYILLPVVLIFAIVCAII 1230
            +  +KL +I S + + CP  A FY WK Y       +  Q + + L +     +   +YEC +T+GF     N+TV IID  S++  + C      P   V   +   CF  E+K   F+   G  V  DC + G ++ Y W F    NNR   +     N S  +   V  ++ G Y CEV    G K+ R F +  ++E     N  I  +  + +   + N+ +Q  L C    + + +I ++KWGK++      +  K   + W+   Y LLPE  I       N I S +       + +G Y C  +  +G   +K FN+   +    VE + +   F LYIL+P ++I   +C+ I
Sbjct:    6 ASINKLFFIGSNMEIICPLDASFYQWKKYHNNKVTNIF-QDDKRKLNVSLKLEESPTIYECGATSGFDQRSVNITVFIIDQNSKLAQELCYVVPFDPASRVKHQVQYPCFVREQKEATFRMAKGLSVEFDCESSGSNVTYAWLFASSANNR---KTILTNNKSSTLKLDVNDKSAGNYFCEVRTKAGAKLERVFELLVISEENTHNNFAISIENTETINITMKNLKKQ-QLNCRTNEQIFEKIQTVKWGKKL-DLAMKNFDKSQTIPWEGNLYKLLPENQIVTPTDPGNRIVSSYYFKDVSLEMAGEYMCAIITNSGTIKYKTFNVYVINNS--VEEEIRQSLFFLYILIPSLII--AICSFI 358          
The following BLAST results are available for this feature:
BLAST of Nou-darake-like-2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FGFR35.134e-924.03fibroblast growth factor receptor 3 [Source:HGNC S... [more]
FGFR36.928e-924.03fibroblast growth factor receptor 3 [Source:HGNC S... [more]
FGFR21.647e-722.61fibroblast growth factor receptor 2 [Source:HGNC S... [more]
FGFR22.008e-722.61fibroblast growth factor receptor 2 [Source:HGNC S... [more]
FGFR22.856e-722.70fibroblast growth factor receptor 2 [Source:HGNC S... [more]
back to top
BLAST of Nou-darake-like-2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Nou-darake-like-2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Nou-darake-like-2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fgfr1b2.979e-924.60fibroblast growth factor receptor 1b [Source:ZFIN;... [more]
fgfr34.477e-823.91fibroblast growth factor receptor 3 [Source:NCBI g... [more]
fgfr35.092e-823.91fibroblast growth factor receptor 3 [Source:NCBI g... [more]
fgfr46.569e-823.62fibroblast growth factor receptor 4 [Source:NCBI g... [more]
fgfr46.859e-823.62fibroblast growth factor receptor 4 [Source:NCBI g... [more]
back to top
BLAST of Nou-darake-like-2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Nou-darake-like-2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Fgfr34.866e-924.12fibroblast growth factor receptor 3 [Source:MGI Sy... [more]
Fgfr34.866e-924.12fibroblast growth factor receptor 3 [Source:MGI Sy... [more]
Fgfr34.953e-924.12fibroblast growth factor receptor 3 [Source:MGI Sy... [more]
Fgfr36.185e-924.12fibroblast growth factor receptor 3 [Source:MGI Sy... [more]
Fgfr36.185e-924.12fibroblast growth factor receptor 3 [Source:MGI Sy... [more]
back to top
BLAST of Nou-darake-like-2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q61851|FGFR3_MOUSE3.071e-824.12Fibroblast growth factor receptor 3 OS=Mus musculu... [more]
sp|P22607|FGFR3_HUMAN3.327e-824.03Fibroblast growth factor receptor 3 OS=Homo sapien... [more]
sp|Q9I8X3|FGFR3_DANRE1.900e-723.91Fibroblast growth factor receptor 3 OS=Danio rerio... [more]
sp|P21802|FGFR2_HUMAN9.645e-722.61Fibroblast growth factor receptor 2 OS=Homo sapien... [more]
sp|Q90413|FGFR4_DANRE1.273e-623.25Fibroblast growth factor receptor 4 OS=Danio rerio... [more]
back to top
BLAST of Nou-darake-like-2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A068Q6P30.000e+066.74Nou-darake like-2 protein OS=Dugesia japonica OX=6... [more]
A0A165FVL10.000e+098.62Nou-darake-like-2 (Fragment) OS=Schmidtea mediterr... [more]
T1DBL79.022e-12145.67NDK-6 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1[more]
A0A0B6VQJ83.282e-2327.75Uncharacterized protein OS=Dugesia japonica OX=616... [more]
D4P9399.557e-2127.50Smed-NDK-3 (Fragment) OS=Schmidtea mediterranea OX... [more]
back to top
BLAST of Nou-darake-like-2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
fgfr32.444e-824.28fibroblast growth factor receptor 3 [Source:NCBI g... [more]
fgfr1a1.452e-724.40fibroblast growth factor receptor 1a [Source:NCBI ... [more]
fgfr34.026e-725.00fibroblast growth factor receptor 3 [Source:NCBI g... [more]
fgfr49.067e-723.08fibroblast growth factor receptor 4 [Source:NCBI g... [more]
back to top
BLAST of Nou-darake-like-2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000006750.18.020e-823.98pep scaffold:Pmarinus_7.0:GL477426:19036:34193:1 g... [more]
back to top
BLAST of Nou-darake-like-2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Nou-darake-like-2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Nou-darake-like-2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fgfr46.881e-1024.54fibroblast growth factor receptor 4 [Source:NCBI g... [more]
fgfr32.444e-824.54fibroblast growth factor receptor 3 [Source:NCBI g... [more]
fgfr32.675e-823.16fibroblast growth factor receptor 3 [Source:NCBI g... [more]
fgfr33.150e-824.54fibroblast growth factor receptor 3 [Source:NCBI g... [more]
ENSORLT00000000391.23.061e-623.92fibroblast growth factor receptor 1-A [Source:NCBI... [more]
back to top
BLAST of Nou-darake-like-2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000027359.10.000e+099.79SMESG000027359.1[more]
SMESG000046208.13.292e-2527.55SMESG000046208.1[more]
SMESG000046208.13.907e-2527.55SMESG000046208.1[more]
SMESG000046244.12.466e-2427.50SMESG000046244.1[more]
SMESG000046244.12.589e-2427.27SMESG000046244.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028104 ID=SMED30028104|Name=Nou-darake-like-2|organism=Schmidtea mediterranea sexual|type=transcript|length=1841bp
ACTTATTGTTTTAATTGTGCTGGTGAATATTGAATAATAATTCAAAATTT
CAAATAGTAATTTAAGAAATTCATTAAAAATTCAATGAAAAATCTTATTT
TGGAACTTATTATCATAACCATTATTTCGGGATTTTCACAGCCAATTACT
GTAAAAAATCTCAATTACATCTATAGTGGAGCTAGTAAATTGGGATATAT
CAATTCCAAGCTAATAGTTGAATGTCCAGCAAAAGCTCAATTTTATCTTT
GGAAATTTTATCAGATGCAGTCTGACCCGCAGGTTTTATTGCAACAGGAA
GGAAAGTTACTGACAATTGATCCAGCAACCGTGGACAAATCCGGAGTGTA
CGAATGCAAAAGCACCACCGGATTTACAAATACGGACACGAATGTTACTG
TGAAAATAATTGATTCACAATCGGAAATAGTTACAAAATCATGTTCGAAT
TCAGTGTCGCCACCGATCAGAGATGTAAGCAAAGGGATATGTTTCTTCAA
TGAAGAAAAGAGAAAGTTTCAGCCAAAAATCGGTGACCATGTCACATTGG
ACTGTACAGCCGTTGGGGAGAGCTTGAAGTATTATTGGACGTTTATTGGA
AATAACCGAATGAAAAATCAAATACAGGCGGAACGGAATATTTCCAAAAT
AATAATTAAGTCCGTAATCCCAGAAAATGAAGGCGTATACAAATGTGAGG
TGGGAAACATTTACGGCGAGAAAATATCGAGAACCTTTACCGTGGCCTTA
ACCGAAACGGCACCCGACGCGAACATGGAAATTATTGGGAAAAAACAAGA
CGATCTCGTTACAAATATTGGACAACAAGTTCTTCTTAGATGTGAAGTTA
AAAGCAAATATCACAGAATTCATTCTATAAAGTGGGGTAAAAGAATCAAA
AGTACAGGACCAGATTCTTTGGTAAAGCCAAACATTGTTTCGTGGGATCA
GTTCACTTACAATTTGCTCCCAGAAACCAACATCAAAAAAAATTTCATCA
TGCAAAATCACATTGAAAGCTTTTTTACTCTAGCGATACGCGACAATGAC
CAGTCCGGCATCTACACATGTCTTGCTATGGACGCAACTGGTGGAACAGC
TCACAAAATATTCAACATTTCAACTTCAAGTGAAGATTCATTTGTAGAAG
TTCAAACAAAAAGTTACTTCTTTCTTTTATACATTCTTCTTCCAGTTGTT
CTAATCTTTGCAATCGTTTGTGCAATTATTTACTGTTCTGTAAAGTCCAG
CTCAAAAAACACCCATAATTCAGTTCCGTTAAAGAAATTTAACACCACGA
ACACAAATAATACTAATAAAGAACCGGTTTCAAACTATTATTATCCAGTC
AGCAACAACCGGCCTCCTCTTCCACAACCCAACGAGTCTCAGATCTCGCT
TGCTTCTCCGAACACTCTTACATCCTATAGTAGTTACGGGAACTATCATA
TGCCGTCGACAAATCAGCCATCCTGTTGCAGTGGCAATGGAGTATGAATC
GGGAACTCAACAAAAATACTTTGCAATGATCTCTCAATATCAATTTAAAC
AAAATATGAATTCATTTTTATTAGATTATCTGAAATAGAAAATTTTCTTT
TTAAAAAAAGTTTAATTTTTTGCAGTTTAGACACAAAATATTATTTTCTA
CTCAAAACTGGCTTGGTTCAACAGGGTTGCATACTTTCAGACTGAACATC
TTATTGAAACTGGAGCTTTGTAAAGATGTGTAATTTTGTATTAATTATAC
TATTCTTCATATGTATTTATGTTGCTCATTTGAAATTATTTATCATTTGT
TTGTTTGTATCCCCAAAAATTAATTGATTATTCGTTTTTGA
back to top

protein sequence of SMED30028104-orf-1

>SMED30028104-orf-1 ID=SMED30028104-orf-1|Name=SMED30028104-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=471bp
MKNLILELIIITIISGFSQPITVKNLNYIYSGASKLGYINSKLIVECPAK
AQFYLWKFYQMQSDPQVLLQQEGKLLTIDPATVDKSGVYECKSTTGFTNT
DTNVTVKIIDSQSEIVTKSCSNSVSPPIRDVSKGICFFNEEKRKFQPKIG
DHVTLDCTAVGESLKYYWTFIGNNRMKNQIQAERNISKIIIKSVIPENEG
VYKCEVGNIYGEKISRTFTVALTETAPDANMEIIGKKQDDLVTNIGQQVL
LRCEVKSKYHRIHSIKWGKRIKSTGPDSLVKPNIVSWDQFTYNLLPETNI
KKNFIMQNHIESFFTLAIRDNDQSGIYTCLAMDATGGTAHKIFNISTSSE
DSFVEVQTKSYFFLLYILLPVVLIFAIVCAIIYCSVKSSSKNTHNSVPLK
KFNTTNTNNTNKEPVSNYYYPVSNNRPPLPQPNESQISLASPNTLTSYSS
YGNYHMPSTNQPSCCSGNGV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000140anterior region of the whole animal
PLANA:0000418head
PLANA:0000419prepharyngeal region
PLANA:0000421tail
Vocabulary: INTERPRO
TermDefinition
IPR003598Ig_sub2
IPR036179Ig-like_dom_sf
IPR003599Ig_sub
IPR013783Ig-like_fold
IPR013098Ig_I-set
IPR007110Ig-like_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0000166nucleotide binding
GO:0004672protein kinase activity
GO:0004713protein tyrosine kinase activity
GO:0004714transmembrane receptor protein tyrosine kinase activity
GO:0005007fibroblast growth factor-activated receptor activity
GO:0005524ATP binding
GO:0016301kinase activity
GO:0016740transferase activity
Vocabulary: biological process
TermDefinition
GO:0001501skeletal system development
GO:0006468protein phosphorylation
GO:0008284positive regulation of cell proliferation
GO:0008543fibroblast growth factor receptor signaling pathway
GO:0016310phosphorylation
GO:0018108peptidyl-tyrosine phosphorylation
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003598Immunoglobulin subtype 2SMARTSM00408igc2_5coord: 38..98
e-value: 3.4
score: 2.0
coord: 148..211
e-value: 0.048
score: 19.8
coord: 244..336
e-value: 2.2
score: 3.9
IPR003599Immunoglobulin subtypeSMARTSM00409IG_3ccoord: 32..107
e-value: 0.057
score: 22.5
coord: 142..223
e-value: 1.4E-4
score: 31.2
coord: 238..357
e-value: 3.4
score: 15.5
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 37..115
e-value: 1.6E-5
score: 26.9
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 232..351
e-value: 3.8E-5
score: 25.7
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 142..227
e-value: 1.1E-10
score: 43.4
IPR007110Immunoglobulin-like domainPFAMPF13895Ig_2coord: 149..220
e-value: 8.7E-7
score: 29.2
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 227..346
score: 8.484
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 126..221
score: 10.608
NoneNo IPR availablePANTHERPTHR19890FIBROBLAST GROWTH FACTOR RECEPTORcoord: 64..415
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..20
score: 0.572
NoneNo IPR availableTMHMMTMhelixcoord: 362..384
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 238..338
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 148..223