Cell division cycle protein 123-like protein

Overview
NameCell division cycle protein 123-like protein
Smed IDSMED30028090
Length (bp)1048
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Cell division cycle protein 123-like protein (SMED30028090) t-SNE clustered cells

Violin plots show distribution of expression levels for Cell division cycle protein 123-like protein (SMED30028090) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Cell division cycle protein 123-like protein (SMED30028090) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Cell division cycle protein 123-like protein (SMED30028090) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028090

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30028090h1SMcG0020070 SmedASXL_011550SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30028090h1SMcG0020070 SmedASXL_011550SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Cell division cycle protein 123-like protein vs. Ensembl Human
Match: CDC123 (cell division cycle 123 [Source:HGNC Symbol;Acc:HGNC:16827])

HSP 1 Score: 144.821 bits (364), Expect = 9.283e-40
Identity = 112/331 (33.84%), Postives = 154/331 (46.53%), Query Frame = 1
Query:   13 MKVADINKCGLPNWYSKFAKVTIPCSLIELDDEFIDYLKRDKIILPKGWLVYRYVFLYKIFTINPKRDHVNDSKEI--------------EHENILKQVKNAIKRFDGEVFLKLNWSAPRDAIYMICNGATLKCTHESDIIYLLKGSMFITHDLISPYRSCTDFIDGKKNP--RLYLALKKYIEINPAFEFRCFVKNDKLIAICQRYGDLFDEEVKKRFQKYVERIKMFYLEEIRSLFELNEYVFDVYV-TDVKVLLIDFNPFSPDVTESALFDWQELIN----------VDLQSDLLPLTMCVEHEHGVCRSSIEQYALPMEVETVLRGQ 924
            MK   +  C    WY  F  VTI   ++ L     DYL  D  ++  G               + + D  ++++EI              E      +V+ AI    G VF KLNWSAPRDA Y I   ++LKC   SDI  L K S FIT D   P+  CTD      +P     L L+K+ E+ P  EFRCFVK +KLI I QR    + + + K+ ++    I+ F+ + I+  F   ++VFD+Y  +  KV LIDFNPF  +VT+S LF W+ELI+          VD Q    P   C   E  V  S    Y LP +   +  G+
Sbjct:    1 MKKEHVLHCQFSAWYPFFRGVTIKSVILPLPQNVKDYLLDDGTLVVSG---------RDDPPTHSQPDSDDEAEEIQWSDDENTATLTAPEFPEFATKVQEAINSLGGSVFPKLNWSAPRDA-YWIAMNSSLKCKTLSDIFLLFKSSDFITRDFTQPFIHCTD---DSPDPCIEYELVLRKWCELIPGAEFRCFVKENKLIGISQRDYTQYYDHISKQKEEIRRCIQDFFKKHIQYKFLDEDFVFDIYRDSRGKVWLIDFNPFG-EVTDSLLFTWEELISENNLNGDFSEVDAQEQDSPAFRCTNSEVTVQPSPYLSYRLPKDFVDLSTGE 317          
BLAST of Cell division cycle protein 123-like protein vs. Ensembl Human
Match: CDC123 (cell division cycle 123 [Source:HGNC Symbol;Acc:HGNC:16827])

HSP 1 Score: 117.472 bits (293), Expect = 5.915e-30
Identity = 104/331 (31.42%), Postives = 134/331 (40.48%), Query Frame = 1
Query:   13 MKVADINKCGLPNWYSKFAKVTIPCSLIELDDEFIDYLKRDKIILPKGWLVYRYVFLYKIFTINPKRDHVNDSKEI--------------EHENILKQVKNAIKRFDGEVFLKLNWSAPRDAIYMICNGATLKCTHESDIIYLLKGSMFITHDLISPYRSCTDFIDGKKNP--RLYLALKKYIEINPAFEFRCFVKNDKLIAICQRYGDLFDEEVKKRFQKYVERIKMFYLEEIRSLFELNEYVFDVYV-TDVKVLLIDFNPFSPDVTESALFDWQELIN----------VDLQSDLLPLTMCVEHEHGVCRSSIEQYALPMEVETVLRGQ 924
            MK   +  C    WY  F  VTI   ++ L     DYL  D  ++  G               + + D  ++++EI              E      +V+ AI    G VF KLNWSAPRDA Y I   ++LKC   SDI  L K S FIT D   P+  CT   D   +P     L L+K+ E+ P  EFRCFVK +KLI                                          VFD+Y  +  KV LIDFNPF  +VT+S LF W+ELI+          VD Q    P   C   E  V  S    Y LP +   +  G+
Sbjct:    1 MKKEHVLHCQFSAWYPFFRGVTIKSVILPLPQNVKDYLLDDGTLVVSG---------RDDPPTHSQPDSDDEAEEIQWSDDENTATLTAPEFPEFATKVQEAINSLGGSVFPKLNWSAPRDA-YWIAMNSSLKCKTLSDIFLLFKSSDFITRDFTQPFIHCT---DDSPDPCIEYELVLRKWCELIPGAEFRCFVKENKLIV-----------------------------------------VFDIYRDSRGKVWLIDFNPFG-EVTDSLLFTWEELISENNLNGDFSEVDAQEQDSPAFRCTNSEVTVQPSPYLSYRLPKDFVDLSTGE 276          
BLAST of Cell division cycle protein 123-like protein vs. Ensembl Human
Match: CDC123 (cell division cycle 123 [Source:HGNC Symbol;Acc:HGNC:16827])

HSP 1 Score: 75.0998 bits (183), Expect = 7.586e-16
Identity = 45/104 (43.27%), Postives = 67/104 (64.42%), Query Frame = 1
Query:  493 LALKKYIEINPAFEFRCFVKNDKLIAICQRYGDLFDEEVKKRFQKYVERIKMFYLEEIRSLFELNEYVFDVYV-TDVKVLLIDFNPFSPDVTESALFDWQELIN 801
            L L+K+ E+ P  EFRCFVK +KLI I QR    + + + K+ ++    I+ F+ + I+  F   ++VFD+Y  +  KV LIDFNPF  +VT+S LF W+ELI+
Sbjct:   18 LVLRKWCELIPGAEFRCFVKENKLIGISQRDYTQYYDHISKQKEEIRRCIQDFFKKHIQYKFLDEDFVFDIYRDSRGKVWLIDFNPFG-EVTDSLLFTWEELIS 120          
BLAST of Cell division cycle protein 123-like protein vs. Ensembl Human
Match: CDC123 (cell division cycle 123 [Source:HGNC Symbol;Acc:HGNC:16827])

HSP 1 Score: 74.3294 bits (181), Expect = 2.005e-15
Identity = 54/163 (33.13%), Postives = 70/163 (42.94%), Query Frame = 1
Query:   13 MKVADINKCGLPNWYSKFAKVTIPCSLIELDDEFIDYLKRDKIILPKGWLVYRYVFLYKIFTINPKRDHVNDSKEI--------------EHENILKQVKNAIKRFDGEVFLKLNWSAPRDAIYMICNGATLKCTHESDIIYLLKGSMFITHDLISPYRSCTD 459
            MK   +  C    WY  F  VTI   ++ L     DYL  D  ++  G               + + D  ++++EI              E      +V+ AI    G VF KLNWSAPRDA Y I   ++LKC   SDI  L K S FIT D   P+  CTD
Sbjct:    1 MKKEHVLHCQFSAWYPFFRGVTIKSVILPLPQNVKDYLLDDGTLVVSG---------RDDPPTHSQPDSDDEAEEIQWSDDENTATLTAPEFPEFATKVQEAINSLGGSVFPKLNWSAPRDA-YWIAMNSSLKCKTLSDIFLLFKSSDFITRDFTQPFIHCTD 153          
BLAST of Cell division cycle protein 123-like protein vs. Ensembl Human
Match: CDC123 (cell division cycle 123 [Source:HGNC Symbol;Acc:HGNC:16827])

HSP 1 Score: 72.7886 bits (177), Expect = 1.208e-14
Identity = 66/205 (32.20%), Postives = 86/205 (41.95%), Query Frame = 1
Query:   13 MKVADINKCGLPNWYSKFAKVTIPCSLIELDDEFIDYLKRDKIILPKGWLVYRYVFLYKIFTINPKRDHVNDSKEIEHENILKQVKNAIKRFDGEVFLKLNWSAPRDAIYMICNGATLKCTHESDIIYLLKGSMFITHDLISPYRSCTDFIDGKKNP--RLYLALKKYIEINPAFEFRCFVKNDKLIAICQR-YGDLFDEEVKKR 618
            MK   +  C    WY  F  VTI   ++ L     DYL  D  ++  G               +P      DS +   E         I+  D E     N +   DA Y I   ++LKC   SDI  L K S FIT D   P+  CTD      +P     L L+K+ E+ P  EFRCFVK +KLI I QR Y   +D   K++
Sbjct:    1 MKKEHVLHCQFSAWYPFFRGVTIKSVILPLPQNVKDYLLDDGTLVVSG-------------RDDPPTHSQPDSDDEAEE---------IQWSDDE-----NTATLTDA-YWIAMNSSLKCKTLSDIFLLFKSSDFITRDFTQPFIHCTD---DSPDPCIEYELVLRKWCELIPGAEFRCFVKENKLIGISQRDYTQYYDHISKQK 174          
BLAST of Cell division cycle protein 123-like protein vs. Ensembl Zebrafish
Match: cdc123 (cell division cycle 123 homolog (S. cerevisiae) [Source:NCBI gene;Acc:393694])

HSP 1 Score: 137.502 bits (345), Expect = 4.569e-37
Identity = 98/286 (34.27%), Postives = 139/286 (48.60%), Query Frame = 1
Query:   13 MKVADINKCGLPNWYSKFAKVTIPCSLIELDDEFIDYLKRDKIILPKGWLVYRYVFLYKIFTINPKRDHVNDSKEIEHE--------------------NILKQVKNAIKRFDGEVFLKLNWSAPRDAIYMICNGATLKCTHESDIIYLLKGSMFITHDLISPYRSCTDFIDGKKNPRLY--LALKKYIEINPAFEFRCFVKNDKLIAICQRYGDLFDEEVKKRFQKYVERIKMFYLEEIRSLFELNEYVFDVYV-TDVKVLLIDFNPFSPDVTESALFDWQELIN 801
            MK   +  C    WY  F K TI   ++ +    IDYL  D  ++  G               N  +   N+S   E +                    N+  +V+ AI    G +F KLNWSAPRDA ++  N ++L+C   S+I  L K S FITHDL  P+  C+D      +P +   L L+K+ E+ P  EFRCFVK +KLIAICQR      + + K+       I  F+ + I+  F   ++V DVY  +  +V LIDFNPF  +VT+S LF W+EL +
Sbjct:    1 MKKEQVVNCQFSVWYPLFKKHTIKSLILPIPQNVIDYLLDDGTLVVSG------------SENNNSQTQANNSDSDEEDIQWTDDETTTTVTAPEFPEFNV--KVQEAINVLGGCIFPKLNWSAPRDANWIALN-SSLQCQSLSEIFLLFKSSDFITHDLTQPFLHCSD---DSPDPTINYELVLRKWSELIPGGEFRCFVKENKLIAICQRDYTQHYQHIGKQEASISTSILQFFRDNIQYQFPDEDFVLDVYRDSSGRVWLIDFNPFG-EVTDSLLFTWEELTS 267          
BLAST of Cell division cycle protein 123-like protein vs. Ensembl Zebrafish
Match: cdc123 (cell division cycle 123 homolog (S. cerevisiae) [Source:NCBI gene;Acc:393694])

HSP 1 Score: 137.117 bits (344), Expect = 6.983e-37
Identity = 98/286 (34.27%), Postives = 139/286 (48.60%), Query Frame = 1
Query:   13 MKVADINKCGLPNWYSKFAKVTIPCSLIELDDEFIDYLKRDKIILPKGWLVYRYVFLYKIFTINPKRDHVNDSKEIEHE--------------------NILKQVKNAIKRFDGEVFLKLNWSAPRDAIYMICNGATLKCTHESDIIYLLKGSMFITHDLISPYRSCTDFIDGKKNPRLY--LALKKYIEINPAFEFRCFVKNDKLIAICQRYGDLFDEEVKKRFQKYVERIKMFYLEEIRSLFELNEYVFDVYV-TDVKVLLIDFNPFSPDVTESALFDWQELIN 801
            MK   +  C    WY  F K TI   ++ +    IDYL  D  ++  G               N  +   N+S   E +                    N+  +V+ AI    G +F KLNWSAPRDA ++  N ++L+C   S+I  L K S FITHDL  P+  C+D      +P +   L L+K+ E+ P  EFRCFVK +KLIAICQR      + + K+       I  F+ + I+  F   ++V DVY  +  +V LIDFNPF  +VT+S LF W+EL +
Sbjct:    1 MKKEQVVNCQFSVWYPLFKKHTIKSLILPIPQNVIDYLLDDGTLVVSG------------SENNNSQTQANNSDSDEEDIQWTDDETTTTVTAPEFPEFNV--KVQEAINVLGGCIFPKLNWSAPRDANWIALN-SSLQCQSLSEIFLLFKSSDFITHDLTQPFLHCSD---DSPDPTINYELVLRKWSELIPGGEFRCFVKENKLIAICQRDYTQHYQHIGKQEASISTSILQFFRDNIQYQFPDEDFVLDVYRDSSGRVWLIDFNPFG-EVTDSLLFTWEELTS 267          
BLAST of Cell division cycle protein 123-like protein vs. Ensembl Xenopus
Match: cdc123 (cell division cycle 123 [Source:NCBI gene;Acc:549954])

HSP 1 Score: 149.443 bits (376), Expect = 1.904e-41
Identity = 109/314 (34.71%), Postives = 157/314 (50.00%), Query Frame = 1
Query:   13 MKVADINKCGLPNWYSKFAKVTIPCSLIELDDEFIDYLKRDKIILPKGWLVYRYVFLYKIFTINPK---RDHVNDSKEIEHENILKQVKNAIKRFDGEVFLKLNWSAPRDAIYMICNGATLKCTHESDIIYLLKGSMFITHDLISPYRSCTDFIDGKKNPRLYLALKKYIEINPAFEFRCFVKNDKLIAICQRYGDLFDEEVKKRFQKYVERIKMFYLEEIRSLFELNEYVFDVYV-TDVKVLLIDFNPFSPDVTESALFDWQE------LINVDLQSDLLPLTMCVEHEHGVCRSSIEQYALPMEVETVLRGQ 924
            MK   +  C    WY +F K++I   +I L +   DYL  D  ++  G   Y+Y+    + T+  K      V  + E    +I  +V+ AI    G VF KLNWS+PRDA Y I   ++LKC   SDI  L K S F+THD   P+  C D      N +  L L+K+ E+ P  EFRCFVK + LI I QR    + + + K+ ++  + I+ F+ E I+  F   ++VFDVY  +  K+ LIDFNPF  +VT+S LF W E      L +V+ +    P       E  V  S    Y LP +   +  G+
Sbjct:    1 MKKEQVLNCQFSQWYPRFKKLSIRSVVIPLPENVKDYLLDDGTLVVSG--RYQYILHVALLTLLFKCIIPFFVFQAPEFPEFSI--KVQEAINSLGGSVFPKLNWSSPRDA-YWIALNSSLKCQTLSDIFLLFKSSDFVTHDFTQPFIYCAD-DSPDPNIKYELVLRKWCELIPGAEFRCFVKENNLIGISQRDYTQYYDHISKQKEEIRKSIQYFFQEHIQYNFPDEDFVFDVYKDSQGKIWLIDFNPFG-EVTDSLLFTWDELRRSWNLSDVENEEQDCPTFRYTNSEVTVQPSPFLSYRLPKDFVDLSTGE 307          
BLAST of Cell division cycle protein 123-like protein vs. Ensembl Xenopus
Match: cdc123 (cell division cycle 123 [Source:NCBI gene;Acc:549954])

HSP 1 Score: 148.673 bits (374), Expect = 2.693e-41
Identity = 108/321 (33.64%), Postives = 155/321 (48.29%), Query Frame = 1
Query:   13 MKVADINKCGLPNWYSKFAKVTIPCSLIELDDEFIDYLKRDKIILPKGWLVYRY---------VFLYKIFTINPKRDHVNDS-KEIEHENILKQVKNAIKRFDGEVFLKLNWSAPRDAIYMICNGATLKCTHESDIIYLLKGSMFITHDLISPYRSCTDFIDGKKNPRLYLALKKYIEINPAFEFRCFVKNDKLIAICQRYGDLFDEEVKKRFQKYVERIKMFYLEEIRSLFELNEYVFDVYV-TDVKVLLIDFNPFSPDVTESALFDWQE------LINVDLQSDLLPLTMCVEHEHGVCRSSIEQYALPMEVETVLRGQ 924
            MK   +  C    WY +F K++I   +I L +   DYL  D  ++   +   R+         + L  +FT     D    + K  E      +V+ AI    G VF KLNWS+PRDA Y I   ++LKC   SDI  L K S F+THD   P+  C D      N +  L L+K+ E+ P  EFRCFVK + LI I QR    + + + K+ ++  + I+ F+ E I+  F   ++VFDVY  +  K+ LIDFNPF  +VT+S LF W E      L +V+ +    P       E  V  S    Y LP +   +  G+
Sbjct:    1 MKKEQVLNCQFSQWYPRFKKLSIRSVVIPLPENVKDYLLDDGTLVLWNYTNVRFCLFFVFVALIILIFVFTYQWSDDENTATLKAPEFPEFSIKVQEAINSLGGSVFPKLNWSSPRDA-YWIALNSSLKCQTLSDIFLLFKSSDFVTHDFTQPFIYCAD-DSPDPNIKYELVLRKWCELIPGAEFRCFVKENNLIGISQRDYTQYYDHISKQKEEIRKSIQYFFQEHIQYNFPDEDFVFDVYKDSQGKIWLIDFNPFG-EVTDSLLFTWDELRRSWNLSDVENEEQDCPTFRYTNSEVTVQPSPFLSYRLPKDFVDLSTGE 318          
BLAST of Cell division cycle protein 123-like protein vs. Ensembl Xenopus
Match: cdc123 (cell division cycle 123 [Source:NCBI gene;Acc:549954])

HSP 1 Score: 148.673 bits (374), Expect = 3.396e-41
Identity = 108/321 (33.64%), Postives = 155/321 (48.29%), Query Frame = 1
Query:   13 MKVADINKCGLPNWYSKFAKVTIPCSLIELDDEFIDYLKRDKIILPKGWLVYRY---------VFLYKIFTINPKRDHVNDS-KEIEHENILKQVKNAIKRFDGEVFLKLNWSAPRDAIYMICNGATLKCTHESDIIYLLKGSMFITHDLISPYRSCTDFIDGKKNPRLYLALKKYIEINPAFEFRCFVKNDKLIAICQRYGDLFDEEVKKRFQKYVERIKMFYLEEIRSLFELNEYVFDVYV-TDVKVLLIDFNPFSPDVTESALFDWQE------LINVDLQSDLLPLTMCVEHEHGVCRSSIEQYALPMEVETVLRGQ 924
            MK   +  C    WY +F K++I   +I L +   DYL  D  ++   +   R+         + L  +FT     D    + K  E      +V+ AI    G VF KLNWS+PRDA Y I   ++LKC   SDI  L K S F+THD   P+  C D      N +  L L+K+ E+ P  EFRCFVK + LI I QR    + + + K+ ++  + I+ F+ E I+  F   ++VFDVY  +  K+ LIDFNPF  +VT+S LF W E      L +V+ +    P       E  V  S    Y LP +   +  G+
Sbjct:    1 MKKEQVLNCQFSQWYPRFKKLSIRSVVIPLPENVKDYLLDDGTLVLWNYTNVRFCLFFVFVALIILIFVFTYQWSDDENTATLKAPEFPEFSIKVQEAINSLGGSVFPKLNWSSPRDA-YWIALNSSLKCQTLSDIFLLFKSSDFVTHDFTQPFIYCAD-DSPDPNIKYELVLRKWCELIPGAEFRCFVKENNLIGISQRDYTQYYDHISKQKEEIRKSIQYFFQEHIQYNFPDEDFVFDVYKDSQGKIWLIDFNPFG-EVTDSLLFTWDELRRSWNLSDVENEEQDCPTFRYTNSEVTVQPSPFLSYRLPKDFVDLSTGE 318          
BLAST of Cell division cycle protein 123-like protein vs. Ensembl Xenopus
Match: cdc123 (cell division cycle 123 [Source:NCBI gene;Acc:549954])

HSP 1 Score: 144.05 bits (362), Expect = 9.508e-40
Identity = 105/318 (33.02%), Postives = 153/318 (48.11%), Query Frame = 1
Query:   13 MKVADINKCGLPNWYSKFAKVTIPCSLIELDDEFIDYLKRDKIILPKGWLVYRYVFLYKIFTINPKRDHVNDSKEIEHENILKQ-------VKNAIKRFDGEVFLKLNWSAPRDAIYMICNGATLKCTHESDIIYLLKGSMFITHDLISPYRSCTDFIDGKKNPRLYLALKKYIEINPAFEFRCFVKNDKLIAICQRYGDLFDEEVKKRFQKYVERIKMFYLEEIRSLFELNEYVFDVYV-TDVKVLLIDFNPFSPDVTESALFDWQE------LINVDLQSDLLPLTMCVEHEHGVCRSSIEQYALPMEVETVLRGQ 924
            MK   +  C    WY +F K++I   +I L +   DYL  D  ++  G          +  +    +  +N + E E +    +       V+ AI    G VF KLNWS+PRDA Y I   ++LKC   SDI  L K S F+THD   P+  C D      N +  L L+K+ E+ P  EFRCFVK + LI I QR    + + + K+ ++  + I+ F+ E I+  F   ++VFDVY  +  K+ LIDFNPF  +VT+S LF W E      L +V+ +    P       E  V  S    Y LP +   +  G+
Sbjct:    1 MKKEQVLNCQFSQWYPRFKKLSIRSVVIPLPENVKDYLLDDGTLVVSG----------REESPGCSQRDLNSTAEDEVQVTAPEFPEFSIKVQEAINSLGGSVFPKLNWSSPRDA-YWIALNSSLKCQTLSDIFLLFKSSDFVTHDFTQPFIYCAD-DSPDPNIKYELVLRKWCELIPGAEFRCFVKENNLIGISQRDYTQYYDHISKQKEEIRKSIQYFFQEHIQYNFPDEDFVFDVYKDSQGKIWLIDFNPFG-EVTDSLLFTWDELRRSWNLSDVENEEQDCPTFRYTNSEVTVQPSPFLSYRLPKDFVDLSTGE 305          
BLAST of Cell division cycle protein 123-like protein vs. Ensembl Xenopus
Match: cdc123 (cell division cycle 123 [Source:NCBI gene;Acc:549954])

HSP 1 Score: 143.28 bits (360), Expect = 2.982e-39
Identity = 104/317 (32.81%), Postives = 151/317 (47.63%), Query Frame = 1
Query:   13 MKVADINKCGLPNWYSKFAKVTIPCSLIELDDEFIDYLKRDKIILPKGWLVYRYVFLYKIFTINPKRDHVNDS------KEIEHENILKQVKNAIKRFDGEVFLKLNWSAPRDAIYMICNGATLKCTHESDIIYLLKGSMFITHDLISPYRSCTDFIDGKKNPRLYLALKKYIEINPAFEFRCFVKNDKLIAICQRYGDLFDEEVKKRFQKYVERIKMFYLEEIRSLFELNEYVFDVYV-TDVKVLLIDFNPFSPDVTESALFDWQE------LINVDLQSDLLPLTMCVEHEHGVCRSSIEQYALPMEVETVLRGQ 924
            MK   +  C    WY +F K++I   +I L +   DYL  D  ++  G           + +        +D       K  E      +V+ AI    G VF KLNWS+PRDA ++  N ++LKC   SDI  L K S F+THD   P+  C D      N +  L L+K+ E+ P  EFRCFVK + LI I QR    + + + K+ ++  + I+ F+ E I+  F   ++VFDVY  +  K+ LIDFNPF  +VT+S LF W E      L +V+ +    P       E  V  S    Y LP +   +  G+
Sbjct:    1 MKKEQVLNCQFSQWYPRFKKLSIRSVVIPLPENVKDYLLDDGTLVVSGREESPGCSQRDLNSTAEDEVQWSDDENTATLKAPEFPEFSIKVQEAINSLGGSVFPKLNWSSPRDAYWIALN-SSLKCQTLSDIFLLFKSSDFVTHDFTQPFIYCAD-DSPDPNIKYELVLRKWCELIPGAEFRCFVKENNLIGISQRDYTQYYDHISKQKEEIRKSIQYFFQEHIQYNFPDEDFVFDVYKDSQGKIWLIDFNPFG-EVTDSLLFTWDELRRSWNLSDVENEEQDCPTFRYTNSEVTVQPSPFLSYRLPKDFVDLSTGE 314          
BLAST of Cell division cycle protein 123-like protein vs. Ensembl Mouse
Match: Cdc123 (cell division cycle 123 [Source:MGI Symbol;Acc:MGI:2138811])

HSP 1 Score: 146.747 bits (369), Expect = 9.468e-41
Identity = 110/331 (33.23%), Postives = 153/331 (46.22%), Query Frame = 1
Query:   13 MKVADINKCGLPNWYSKFAKVTIPCSLIELDDEFIDYLKRDKIILPKGWLVYRYVFLYKIFTINPKRDHVNDSKEI--------------EHENILKQVKNAIKRFDGEVFLKLNWSAPRDAIYMICNGATLKCTHESDIIYLLKGSMFITHDLISPYRSCTDFIDGKKNP--RLYLALKKYIEINPAFEFRCFVKNDKLIAICQRYGDLFDEEVKKRFQKYVERIKMFYLEEIRSLFELNEYVFDVYV-TDVKVLLIDFNPFSPDVTESALFDWQELIN----------VDLQSDLLPLTMCVEHEHGVCRSSIEQYALPMEVETVLRGQ 924
            MK   ++ C    WY  F  +TI   ++ L     DYL  D  ++  G          +      + D  N+++E               E      QV+ AI    G VF KLNWSAPRDA Y I   ++LKC   SDI  L K S FITHD   P+  CTD      +P     L L+K+ E+ P  EFRCFVK +KLI I QR    + + + K+ ++    I+ F+ E ++  F   ++VFD+Y  +  KV LIDFNPF  +VT+S LF W+EL +           D Q    P   C   E  V  S    + LP +   +  G+
Sbjct:    1 MKKEHVSHCQFSAWYPLFRSLTIKSVILPLPQNVKDYLLDDGTLVVSG---------REDPPTCSQSDSGNEAEETQWSDDESTATLTAPEFPEFNTQVQEAINSLGGSVFPKLNWSAPRDA-YWIAMNSSLKCKTLSDIFLLFKSSDFITHDFTQPFIHCTD---DSPDPCIEYELVLRKWCELIPGAEFRCFVKENKLIGISQRDYTQYYDHISKQKEEICRCIQDFFKEHLQYKFLDEDFVFDIYRDSRGKVWLIDFNPFG-EVTDSLLFTWEELTSENNLRGEVTEGDAQEQDSPAFRCTNSEVTVQPSPYLSFGLPKDFVDLSTGE 317          
BLAST of Cell division cycle protein 123-like protein vs. Ensembl Mouse
Match: Cdc123 (cell division cycle 123 [Source:MGI Symbol;Acc:MGI:2138811])

HSP 1 Score: 73.1738 bits (178), Expect = 2.418e-15
Identity = 37/66 (56.06%), Postives = 41/66 (62.12%), Query Frame = 1
Query:  262 QVKNAIKRFDGEVFLKLNWSAPRDAIYMICNGATLKCTHESDIIYLLKGSMFITHDLISPYRSCTD 459
            QV+ AI    G VF KLNWSAPRDA Y I   ++LKC   SDI  L K S FITHD   P+  CTD
Sbjct:   29 QVQEAINSLGGSVFPKLNWSAPRDA-YWIAMNSSLKCKTLSDIFLLFKSSDFITHDFTQPFIHCTD 93          
BLAST of Cell division cycle protein 123-like protein vs. UniProt/SwissProt
Match: sp|A6SDA8|CD123_BOTFB (Cell division cycle protein 123 OS=Botryotinia fuckeliana (strain B05.10) OX=332648 GN=cdc123 PE=3 SV=1)

HSP 1 Score: 153.68 bits (387), Expect = 7.447e-42
Identity = 94/272 (34.56%), Postives = 145/272 (53.31%), Query Frame = 1
Query:   28 INKCGLPNWYSKFAKVTIPCSLIELDDEFIDYLKRDKIILPKGWLVYRYVFLYKIFTINPKRDHVNDSKEIEHE---NILKQVKNAIKRFDGEVFLKLNWSAPRDAIYMICNGATLKCTHESDIIYLLKGSMFITHDLISPYRSCT-DFIDGKKNPRLYLALKKYIEINPAFEFRCFVKNDKLIAICQRYGDLFDEEVKKRFQKYVERIKMFYLEEIRSLFELNEYVFDVYVTDV--KVLLIDFNPFSPDVTESALFDWQELINVDLQSDLL 825
            I  C   NW++K+   T+   +I L  EF+ YL+ D I+LP     +     Y   + +   D   D+     E    I KQ++  I   DG V  KLNWSAP+DA ++     +++C   +DI  LLK S FITHDL   +  C  D    K++ +  L L+K+ ++NP+ EFRCFV++ ++I ICQR  + F E +        E I+ ++ + ++  F    + FDVY+ D   KV L+D NP++P  T+  LF W EL+ + + S LL
Sbjct:   30 ILNCSYDNWHAKYRSSTLKSRIIPLTSEFLSYLREDGIVLPSEIATFPPPETYNNNSTSDGWDEDTDTGPDPSEKFSEIHKQIQETIAELDGSVVPKLNWSAPKDATWISLKQNSMECNTPNDIYLLLKSSDFITHDLEHAFDGCAEDPSITKESTQYVLVLRKWFKVNPSCEFRCFVRDRRIIGICQRDLNYF-EFLFPLIPTLREVIQEYFDKTLKDTFPDRNFSFDVYLPDPFDKVRLVDINPWAP-RTDPLLFSWLELLTLSVPSPLL 299          
BLAST of Cell division cycle protein 123-like protein vs. UniProt/SwissProt
Match: sp|A1CMB9|CD123_ASPCL (Cell division cycle protein 123 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) OX=344612 GN=cdc123 PE=3 SV=1)

HSP 1 Score: 152.91 bits (385), Expect = 1.918e-41
Identity = 92/265 (34.72%), Postives = 142/265 (53.58%), Query Frame = 1
Query:   37 CGLPNWYSKFAKVTIPCSLIELDDEFIDYLKRDKIILPKGWLVYRYVFLYKIFTINPKRDHVNDSKEIEHENILKQVKNAIKRFDGEVFLKLNWSAPRDAIYMICNGATLKCTHESDIIYLLKGSMFITHDLISPYRSC-------TDFIDGKKNPRLYLALKKYIEINPAFEFRCFVKNDKLIAICQRYGDLFDEEVKKRFQKYVERIKMFYLEEIRSLFELNEYVFDVYVTDV--KVLLIDFNPFSPDVTESALFDWQELINV 804
            C   +W  ++  +T    LI L D F+ YL+ D I+LP      +       F+ +   +  + S  +E ++I  Q+K+ I  F G+V  KLNWSAP+DA++M      L+C   +DI  LLK S F+THDL  P+  C       T+  D +     +L L+KY+  NPA EFRCFV+N  L+ +CQR  + FD     R      RI+ F+ E ++  F    +VFD+Y+     +V L+D NP++P  T+  LF W E++++
Sbjct:   35 CSYHHWQPRYRTITPKSRLIPLTDPFVSYLRADGIVLPPENTSPQDEDDLDTFSDDGADEEPDPS--VEWQDIHSQIKSTISEFGGKVTPKLNWSAPKDAVWMSATN-DLQCRTPNDIYLLLKSSDFVTHDLEHPFDDCVPDTTETTESSDAQPEIPYHLVLRKYVNFNPALEFRCFVRNRVLLCMCQRDQNHFDFLFGLR-DTLRSRIQAFFDEHLKDSFPDPNFVFDMYIPAPYQRVWLVDINPWAP-RTDPLLFSWLEILHM 294          
BLAST of Cell division cycle protein 123-like protein vs. UniProt/SwissProt
Match: sp|Q2PG37|CD123_MACFA (Cell division cycle protein 123 homolog OS=Macaca fascicularis OX=9541 GN=CDC123 PE=2 SV=1)

HSP 1 Score: 147.517 bits (371), Expect = 4.540e-40
Identity = 113/331 (34.14%), Postives = 154/331 (46.53%), Query Frame = 1
Query:   13 MKVADINKCGLPNWYSKFAKVTIPCSLIELDDEFIDYLKRDKIILPKGWLVYRYVFLYKIFTINPKRDHVNDSKEI--------------EHENILKQVKNAIKRFDGEVFLKLNWSAPRDAIYMICNGATLKCTHESDIIYLLKGSMFITHDLISPYRSCTDFIDGKKNP--RLYLALKKYIEINPAFEFRCFVKNDKLIAICQRYGDLFDEEVKKRFQKYVERIKMFYLEEIRSLFELNEYVFDVYV-TDVKVLLIDFNPFSPDVTESALFDWQELIN----------VDLQSDLLPLTMCVEHEHGVCRSSIEQYALPMEVETVLRGQ 924
            MK   +  C    WY  F  VTI   ++ L     DYL  D  ++  G               + + D  ++++EI              E      QV+ AI    G VF KLNWSAPRDA Y I   ++LKC   SDI  L K S FIT D   P+  CTD      +P     L L+K+ E+ P  EFRCFVK +KLI I QR    + + + K+ ++    I+ F+ + I+  F   ++VFD+Y  +  KV LIDFNPF  +VT+S LF W+ELI+          VD Q    P   C   E  V  S    Y LP +   +  G+
Sbjct:    1 MKKEHVLHCQFSAWYPLFRGVTIKSVILPLPQNVKDYLLDDGTLVVSG---------RDDPPTHSQPDSDDEAEEIQWSDDENTATLTAPEFPEFATQVQEAINSLGGSVFPKLNWSAPRDA-YWIAMNSSLKCKTLSDIFLLFKSSDFITRDFTQPFIHCTD---DSPDPCIEYELVLRKWCELIPGAEFRCFVKENKLIGISQRDYTQYYDHISKQKEEICRCIQDFFKKHIQYKFLDEDFVFDIYRDSRGKVWLIDFNPFG-EVTDSLLFTWEELISENNLNGDFSEVDAQEQDSPAFRCTNSEVTVQPSPYLSYRLPKDFVDLSTGE 317          
BLAST of Cell division cycle protein 123-like protein vs. UniProt/SwissProt
Match: sp|Q8CII2|CD123_MOUSE (Cell division cycle protein 123 homolog OS=Mus musculus OX=10090 GN=Cdc123 PE=1 SV=2)

HSP 1 Score: 146.747 bits (369), Expect = 6.623e-40
Identity = 110/331 (33.23%), Postives = 153/331 (46.22%), Query Frame = 1
Query:   13 MKVADINKCGLPNWYSKFAKVTIPCSLIELDDEFIDYLKRDKIILPKGWLVYRYVFLYKIFTINPKRDHVNDSKEI--------------EHENILKQVKNAIKRFDGEVFLKLNWSAPRDAIYMICNGATLKCTHESDIIYLLKGSMFITHDLISPYRSCTDFIDGKKNP--RLYLALKKYIEINPAFEFRCFVKNDKLIAICQRYGDLFDEEVKKRFQKYVERIKMFYLEEIRSLFELNEYVFDVYV-TDVKVLLIDFNPFSPDVTESALFDWQELIN----------VDLQSDLLPLTMCVEHEHGVCRSSIEQYALPMEVETVLRGQ 924
            MK   ++ C    WY  F  +TI   ++ L     DYL  D  ++  G          +      + D  N+++E               E      QV+ AI    G VF KLNWSAPRDA Y I   ++LKC   SDI  L K S FITHD   P+  CTD      +P     L L+K+ E+ P  EFRCFVK +KLI I QR    + + + K+ ++    I+ F+ E ++  F   ++VFD+Y  +  KV LIDFNPF  +VT+S LF W+EL +           D Q    P   C   E  V  S    + LP +   +  G+
Sbjct:    1 MKKEHVSHCQFSAWYPLFRSLTIKSVILPLPQNVKDYLLDDGTLVVSG---------REDPPTCSQSDSGNEAEETQWSDDESTATLTAPEFPEFNTQVQEAINSLGGSVFPKLNWSAPRDA-YWIAMNSSLKCKTLSDIFLLFKSSDFITHDFTQPFIHCTD---DSPDPCIEYELVLRKWCELIPGAEFRCFVKENKLIGISQRDYTQYYDHISKQKEEICRCIQDFFKEHLQYKFLDEDFVFDIYRDSRGKVWLIDFNPFG-EVTDSLLFTWEELTSENNLRGEVTEGDAQEQDSPAFRCTNSEVTVQPSPYLSFGLPKDFVDLSTGE 317          
BLAST of Cell division cycle protein 123-like protein vs. UniProt/SwissProt
Match: sp|Q4WDA4|CD123_ASPFU (Cell division cycle protein 123 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=cdc123 PE=3 SV=1)

HSP 1 Score: 148.288 bits (373), Expect = 9.957e-40
Identity = 93/265 (35.09%), Postives = 137/265 (51.70%), Query Frame = 1
Query:   37 CGLPNWYSKFAKVTIPCSLIELDDEFIDYLKRDKIILPKGWLVYRYVFLYKIFTINPKRDHVNDSKEIEHENILKQVKNAIKRFDGEVFLKLNWSAPRDAIYMICNGATLKCTHESDIIYLLKGSMFITHDLISPYRSC-TDFIDGKKNPRL------YLALKKYIEINPAFEFRCFVKNDKLIAICQRYGDLFDEEVKKRFQKYVERIKMFYLEEIRSLFELNEYVFDVYVTDV--KVLLIDFNPFSPDVTESALFDWQELINV 804
            C    W  ++  +T     I L   F+ YL+ + I+LP       +         +   D  +D   +E + I  Q+K+ I  F G+V  KLNWSAP+DA++M      L+C   +DI  LLK S FITHDL  P+  C  D  D  + P        YL L+KY+  NP+ EFRCFV+N  L+ +CQR  + FD     R      RI+ F+ E+++  F    +VFDVY+ +   +V LID NP++ D T+  LF W E++ +
Sbjct:   35 CSYHQWQPRYRTLTPKSRAIPLTPSFVSYLRANGIVLPPE-TTRPHGDDDIDTFSDDGADEESDPS-VEWQEIHSQIKSTISEFGGKVTPKLNWSAPKDAVWMSATN-DLQCRTPNDIYLLLKSSDFITHDLEHPFDGCVPDPDDSSEAPATQPDIPYYLVLRKYVNFNPSLEFRCFVRNRVLLCMCQRDQNHFDFLFSLR-DTLRSRIQAFFDEKLKDTFPDPNFVFDVYIPEPHQRVWLIDINPWA-DRTDPLLFSWLEILQM 294          
BLAST of Cell division cycle protein 123-like protein vs. TrEMBL
Match: A0A2L2YFC9 (Cell division cycle protein 123-like protein OS=Parasteatoda tepidariorum OX=114398 PE=2 SV=1)

HSP 1 Score: 192.2 bits (487), Expect = 1.348e-54
Identity = 124/321 (38.63%), Postives = 178/321 (55.45%), Query Frame = 1
Query:   13 MKVADINKCGLPNWYSKFAKVTIPCSLIELDDEFIDYLKRDKIILPKGWLVYRYVFLYKIFTINPKRDHVNDSKEIEHE-----NILKQVKNAIKRFDGEVFLKLNWSAPRDAIYMICNGATLKCTHESDIIYLLKGSMFITHDLISPYRSCTDFIDGK-------KNPRLYLALKKYIEINPAFEFRCFVKNDKLIAICQRYGDLFDEEVKKRFQKYVERIKMFYLEEIRSLFELNEYVFDVY-VTDVKVLLIDFNPFSPDVTESALFDWQELINVDLQS----DLLPLTMCVEHEHGVCRSSIEQYALPMEVETVLRGQ 924
            MK+ ++ +C   NWY+ F  V++   ++ L D+FI Y+  D IILPK   V   V        + +     D+ E E E        + ++NAI+   G+VF KLNWS+P+DA +M  N +   CT  SDI  LLK S FI HD+  PY  C DFI  +       KN  L+L L+K+I+I+ + EFRCFVK +KLI +CQR    F E +     + +E +  F+ E+++  F L  Y++DVY     KV+LIDFNPF   VT+S LF W+EL N DL S    D  P   CVE  +GV   ++  YA+P ++  +  G+
Sbjct:    1 MKIEEVEQCSFQNWYNNFKNVSVKSIILPLPDDFIKYILADGIILPKSTNVSHVVSTNDSDLSDEEETWEEDTDEAEPEAPYFPEFDQSIENAIESLGGKVFPKLNWSSPKDASWMGFNYSCC-CTSISDIYLLLKSSNFIIHDITQPYNLCDDFIQDQSLSEIEQKNIPLFLVLRKWIDIDTSGEFRCFVKENKLIGVCQREHSAFFEHISLHKAEILEDLVTFFTEKVQFKFPLPYYIYDVYRKKKGKVILIDFNPFG-KVTDSLLFTWEEL-NSDLTSVDENDEYPEFRCVEDNYGVQPRTLSSYAVPTDIIDISTGE 318          
BLAST of Cell division cycle protein 123-like protein vs. TrEMBL
Match: A0A2L2YHJ4 (Cell division cycle protein 123-like protein OS=Parasteatoda tepidariorum OX=114398 PE=2 SV=1)

HSP 1 Score: 191.815 bits (486), Expect = 1.550e-54
Identity = 124/321 (38.63%), Postives = 178/321 (55.45%), Query Frame = 1
Query:   13 MKVADINKCGLPNWYSKFAKVTIPCSLIELDDEFIDYLKRDKIILPKGWLVYRYVFLYKIFTINPKRDHVNDSKEIEHE-----NILKQVKNAIKRFDGEVFLKLNWSAPRDAIYMICNGATLKCTHESDIIYLLKGSMFITHDLISPYRSCTDFIDGK-------KNPRLYLALKKYIEINPAFEFRCFVKNDKLIAICQRYGDLFDEEVKKRFQKYVERIKMFYLEEIRSLFELNEYVFDVY-VTDVKVLLIDFNPFSPDVTESALFDWQELINVDLQS----DLLPLTMCVEHEHGVCRSSIEQYALPMEVETVLRGQ 924
            MK+ ++ +C   NWY+ F  V++   ++ L D+FI Y+  D IILPK   V   V        + +     D+ E E E        + ++NAI+   G+VF KLNWS+P+DA +M  N +   CT  SDI  LLK S FI HD+  PY  C DFI  +       KN  L+L L+K+I+I+ + EFRCFVK +KLI +CQR    F E +     + +E +  F+ E+++  F L  Y++DVY     KV+LIDFNPF   VT+S LF W+EL N DL S    D  P   CVE  +GV   ++  YA+P ++  +  G+
Sbjct:    1 MKIEEVEQCSFQNWYNNFKNVSVKSIILPLPDDFIKYILADGIILPKSTNVSHVVSTNDSDLSDEEETWEEDTDEAEPEAPYFPEFDQSIENAIESLGGKVFPKLNWSSPKDASWMGFNYSCC-CTSISDIYLLLKSSNFIIHDITQPYNLCDDFIQDQSLSEIEQKNIPLFLVLRKWIDIDTSGEFRCFVKENKLIGVCQREHSAFFEHISLHKAEILEDLVTFFTEKVQFKFPLPYYIYDVYRKKKGKVILIDFNPFG-KVTDSLLFTWEEL-NSDLTSVDENDEYPEFRCVEDNYGVQPRTLSSYAVPTDIIDISTGE 318          
BLAST of Cell division cycle protein 123-like protein vs. TrEMBL
Match: A0A224YVJ6 (Cell division cycle protein 123-like protein OS=Rhipicephalus zambeziensis OX=60191 PE=4 SV=1)

HSP 1 Score: 187.193 bits (474), Expect = 6.921e-53
Identity = 124/317 (39.12%), Postives = 171/317 (53.94%), Query Frame = 1
Query:   13 MKVADINKCGLPNWYSKFAKVTIPCSLIELDDEFIDYLKRDKIILP-KGWLVYRYVFLYKIFTINPKRDHVN------DSKEIEH-ENILKQVKNAIKRFDGEVFLKLNWSAPRDAIYMICNGATLKCTHESDIIYLLKGSMFITHDLISPYRSCTDFIDGKKNPRLY---LALKKYIEINPAFEFRCFVKNDKLIAICQRYGDLFDEEVKKRFQKYVERIKMFYLEEIRSLFELNEYVFDVYVTDVKVL-LIDFNPFSPDVTESALFDWQELINVDL-QSDLLPLTMCVEHEHGVCRSSIEQYALPMEVETVLRGQ 924
            MKV D+  C   +WYS F   TI    I L  EF+ YL  D ++LP K     +Y             D V+      DS EI     + + V  AIKR  G+VF KLNWS+P+DA ++  N + L CT  +DI  LLK S FITHDL  P+++CTD+  G     L+   L L+K++EI+P+ EFRCFVK+  LI I QR    +   ++++    V+ I  F+ E I+S F    YVFDVY     ++ L+DFNPF    T+S LFDW+EL N  + Q+  LP    ++   GV  S    YALP +V  +  G+
Sbjct:    1 MKVEDVLSCNFSSWYSVFKNATISSVCIPLTSEFVKYLLTDGVVLPGKAPSSQKY--------DTDSDDEVDWSEADADSTEIPSFPELEEAVSTAIKRLGGKVFPKLNWSSPKDATWIATNNSPL-CTCFADICLLLKSSDFITHDLTQPFKACTDWNKGTDTENLFQYELILRKWVEIDPSTEFRCFVKDSVLIGISQRDYTHYYYHIEEQEANIVQDIMSFFHERIKSKFASASYVFDVYRKRKDLVKLLDFNPFGAH-TDSLLFDWEELENYKIDQAAGLPTFRYMKENRGVQPSPYRHYALPRDVVDLCAGE 307          
BLAST of Cell division cycle protein 123-like protein vs. TrEMBL
Match: A0A131XK03 (Uncharacterized protein OS=Hyalomma excavatum OX=257692 PE=2 SV=1)

HSP 1 Score: 186.808 bits (473), Expect = 1.028e-52
Identity = 123/317 (38.80%), Postives = 170/317 (53.63%), Query Frame = 1
Query:   13 MKVADINKCGLPNWYSKFAKVTIPCSLIELDDEFIDYLKRDKIILP-KGWLVYRYVFLYKIFTINPKRDHVN------DSKEIEH-ENILKQVKNAIKRFDGEVFLKLNWSAPRDAIYMICNGATLKCTHESDIIYLLKGSMFITHDLISPYRSCTDFIDGKKNPRLY---LALKKYIEINPAFEFRCFVKNDKLIAICQRYGDLFDEEVKKRFQKYVERIKMFYLEEIRSLFELNEYVFDVYVTDVKVL-LIDFNPFSPDVTESALFDWQELINVDL-QSDLLPLTMCVEHEHGVCRSSIEQYALPMEVETVLRGQ 924
            MKV D+  C   +WY  F   TI    I L  EF+ YL  D ++LP K  L  +Y             D V+      +S EI     + + V  AIKR  G VF KLNWS+P+DA ++  N + L CT  +DI  LLK S F+THDL  P+++CTD+  G     L+   L L+K++EI+P+ EFRCFVK+  LI I QR    +   ++++    V+ I  F+ E I+S F    YVFDVY     V+ L+DFNPF    T+S LFDW+EL N    Q+  LP+   ++   GV  S    YALP +V  +  G+
Sbjct:    1 MKVQDVLSCNFSSWYGVFKNATITSVCIPLTSEFVQYLLSDGVVLPGKAPLSQKY--------DTDSEDEVDWSEADAESTEIPSFPELEEAVSAAIKRLGGRVFPKLNWSSPKDATWIATNNSPL-CTCFADICLLLKSSDFVTHDLTQPFKACTDWNKGTDTDNLFRYELVLRKWVEIDPSTEFRCFVKDYALIGISQRDYTHYYYHIEEQEANIVQDIVSFFRERIKSKFASASYVFDVYRKRKDVVKLLDFNPFGTH-TDSLLFDWEELENFKTDQAAGLPVFRYMKENRGVQPSPYRHYALPRDVVDLCAGE 307          
BLAST of Cell division cycle protein 123-like protein vs. TrEMBL
Match: L7M5H8 (Uncharacterized protein OS=Rhipicephalus pulchellus OX=72859 PE=2 SV=1)

HSP 1 Score: 185.652 bits (470), Expect = 2.804e-52
Identity = 122/317 (38.49%), Postives = 172/317 (54.26%), Query Frame = 1
Query:   13 MKVADINKCGLPNWYSKFAKVTIPCSLIELDDEFIDYLKRDKIILP-KGWLVYRYVFLYKIFTINPKRDHVN------DSKEIEH-ENILKQVKNAIKRFDGEVFLKLNWSAPRDAIYMICNGATLKCTHESDIIYLLKGSMFITHDLISPYRSCTDFIDGKKNPRLY---LALKKYIEINPAFEFRCFVKNDKLIAICQRYGDLFDEEVKKRFQKYVERIKMFYLEEIRSLFELNEYVFDVYVTDVKVL-LIDFNPFSPDVTESALFDWQELINVDL-QSDLLPLTMCVEHEHGVCRSSIEQYALPMEVETVLRGQ 924
            MKV D+  C   +WY  F   TI    I L  EF+ YL  D ++LP K  L  +Y             D V+      DS EI     + + V  AIKR  G+VF KLNWS+P+DA ++  N + L CT  +DI  LLK S F+THDL  P+++CTD+  G     L+   L L+K++EI+P+ EFRCFVK+  LI I QR    +   ++++    V+ I  F+ E I+S F    YVFDVY     ++ L+DFNPF    T+S LFDW+EL N  + ++  LP+   ++   GV  S    YALP +V  +  G+
Sbjct:    1 MKVEDVLNCNFSSWYGVFKNATITSVCIPLTSEFVKYLLSDGVVLPGKAPLSQKYE--------TDSDDEVDWSEADADSTEIPSFPELEEAVSTAIKRLGGKVFPKLNWSSPKDATWIAANNSPL-CTCFADICLLLKSSDFVTHDLTQPFKACTDWNKGTDTENLFQYELVLRKWVEIDPSTEFRCFVKDCVLIGISQRDYTHYYYHIEEQEANIVQDIMSFFHERIKSKFASASYVFDVYRKRKDLVKLLDFNPFGAH-TDSLLFDWEELENYKIDRAPGLPIFRYMKENRGVQPSPYRHYALPRDVVDLCAGE 307          
BLAST of Cell division cycle protein 123-like protein vs. Ensembl Cavefish
Match: cdc123 (cell division cycle 123 homolog (S. cerevisiae) [Source:NCBI gene;Acc:393694])

HSP 1 Score: 119.013 bits (297), Expect = 7.867e-31
Identity = 90/270 (33.33%), Postives = 118/270 (43.70%), Query Frame = 1
Query:   13 MKVADINKCGLPNWYSKFAKVTIPCSLIELDDEFIDYLKRDKII-----LPKGWLVYRYVFLYKIFTINPKRDHVNDSKEIEHENILKQVKNAIKRFDGEVFLKLNWSAPRDAIYMICNGATLKCTHESDIIYLLKGSMFITHDLISPYRSCTDFIDGKKNPRLY--LALKKYIEINPAFEFRCFVKNDKLIAICQRYGDLFDEEVKKRFQKYVERIKMFYLEEIRSLFELNEYVFDVYVTDVKVLLIDFNPFSPDVTESALFDWQELIN 801
            MK   +  C    WY  F K TI   ++ L    IDYL  D  +     +P   LV     L+  F+  P           E      +V+ AI    G VF KLNWSAPRDA ++  N ++L+C   SDI  L K S FITHDL  P+  C+   D   +P +   L L+K+ E+ P  EFRCFVK +KLI +   Y D                                           +V LIDFNPF  +VT+S LF W+EL +
Sbjct:    1 MKKEQVVNCQFSVWYPLFKKHTIKSLILPLPQNVIDYLLDDGTLVVSGGIPNTVLVLTVRVLFFPFSQAP-----------EFPEFTSKVQEAINALGGCVFPKLNWSAPRDANWIALN-SSLQCQSLSDIFLLFKSSDFITHDLTQPFLQCS---DDSPDPAINYELVLRKWSELIPGGEFRCFVKENKLIVVLDVYRDCMG----------------------------------------RVWLIDFNPFG-EVTDSLLFSWEELTS 214          
BLAST of Cell division cycle protein 123-like protein vs. Ensembl Cavefish
Match: cdc123 (cell division cycle 123 homolog (S. cerevisiae) [Source:NCBI gene;Acc:393694])

HSP 1 Score: 111.694 bits (278), Expect = 7.478e-28
Identity = 83/269 (30.86%), Postives = 116/269 (43.12%), Query Frame = 1
Query:   13 MKVADINKCGLPNWYSKFAKVTIPCSLIELDDEFIDYLKRDKIILPKGWLVYRYVFLYKIFTINPKRDHV----NDSKEIEHENILKQVKNAIKRFDGEVFLKLNWSAPRDAIYMICNGATLKCTHESDIIYLLKGSMFITHDLISPYRSCTDFIDGKKNPRLY--LALKKYIEINPAFEFRCFVKNDKLIAICQRYGDLFDEEVKKRFQKYVERIKMFYLEEIRSLFELNEYVFDVYVTDVKVLLIDFNPFSPDVTESALFDWQELIN 801
            MK   +  C    WY  F K TI   ++ L    IDYL  D  ++  G             + + + + +    +     E      +V+ AI    G VF KLNWSAPRDA ++  N ++L+C   SDI  L K S FITHDL  P+  C+D      +P +   L L+K+ E+ P  EFRCFVK +KLI I QR        + K+       I  F+ + I+  F                         PD   S LF W+EL +
Sbjct:    1 MKKEQVVNCQFSVWYPLFKKHTIKSLILPLPQNVIDYLLDDGTLVVSGGCENNNQCSQNNNSDSEEEEDIQVIQDSGLAPEFPEFTSKVQEAINALGGCVFPKLNWSAPRDANWIALN-SSLQCQSLSDIFLLFKSSDFITHDLTQPFLQCSD---DSPDPAINYELVLRKWSELIPGGEFRCFVKENKLIGISQRDYTQHYHHISKQEANISSSILQFFRDHIQHQF-------------------------PDEDYSLLFSWEELTS 240          
BLAST of Cell division cycle protein 123-like protein vs. Ensembl Yeast
Match: CDC123 (Assembly factor for the eIF2 translation initiation factor complex; regulates translational initiation; conserved residues of this ATP-Grasp protein that bind to ATP-Mg2+ in the pombe ortholog are required for complex assembly in budding yeast; interaction with eIF2 subunit Gcd11p facilitates complex assembly and activity; required for the START transition and timely progression through G2; regulated by nutrient availability; human ortholog complements the yeast mutant [Source:SGD;Acc:S000004205])

HSP 1 Score: 110.538 bits (275), Expect = 5.057e-28
Identity = 86/285 (30.18%), Postives = 142/285 (49.82%), Query Frame = 1
Query:   22 ADINKCGLPNWYSKFAKVTIPCSLI--ELDDEFIDYLKRDKIILPKGWLVYRYVFLYKIFTINPKRDHVNDSKEIEHE------------------NILKQVKNAIKRFDGEVFLKLNWSAPRDAIYMICNGATLKCTHESDIIYLLKGSMFITHDLISPYRSCTDFIDGKKNPRLYLALKKYIEINPAFEFRCFVKNDKLIAICQRYGDLFD--EEVKKRFQKYVERIKMFYLEEIRSLFELNEYVFDVYVTDV--KVLLIDFNPFSPDVTESALFDWQELINV 804
            A +  C    W S + K  +P S++   L  +FI YL++D I LP+     R V+  +I      R+  ND  + E +                   + +++K+A+    G V  KLNWSAPRDA +++ N  T+KC   +++  LL  S +I HDL   ++ C D  D  K  +  L L+++ ++NPA EFR FVKN  ++   QR  + +D  +E+   F+  ++ I     + +   F    +V DVY+     K+ ++D NPF+   T+S LF W E+  +
Sbjct:   17 AQVEHCSYSFWSSLYPKY-VPKSIVLKSLPKKFIQYLEQDGIKLPQE-ENSRSVYTEEII-----RNEDNDYSDWEDDEDTATEFVQEVEPLIDFPELHQKLKDALNEL-GAVAPKLNWSAPRDATWILPNN-TMKCNEVNELYLLLNASNYIMHDLQRAFKGCVDG-DDIKGLKFDLVLRQWCDMNPALEFRVFVKNAHIVGATQRDLNYYDYLDELSDTFKDLIDEI---VHDVVLPKFPDKSFVLDVYIPRPFNKIFIVDINPFARK-TDSLLFSWNEIAAI 287          
BLAST of Cell division cycle protein 123-like protein vs. Ensembl Nematostella
Match: CDC123 (Cell division cycle protein 123 homolog [Source:UniProtKB/Swiss-Prot;Acc:A7RFT2])

HSP 1 Score: 141.354 bits (355), Expect = 2.722e-39
Identity = 103/287 (35.89%), Postives = 140/287 (48.78%), Query Frame = 1
Query:   13 MKVADINKCGLPNWYSKFAKVTIPCSLIELDDEFIDYLKRDKIILPKGWLVYRYVFLYKIFTINPKRDHVNDSKE---------------IEHENILKQVKNAIKRFDGEVFLKLNWSAPRDAIYMICNGATLKCTHESDIIYLLKGSMFITHDLISPYRSCTDFIDGKKNPRLYLALKKYIEINPAFEFRCFVKNDKLIAICQRYGDLFDEEVKKRFQKYVERIKMFYLEEIRSLFELNEYVFDVY-VTDVKVLLIDFNPFSPDVTESALFDWQELINVDLQSDLL 825
            MK   +  C   +WY +F  VTI   +I L  EF+DYLK D ++LP            K  ++    D  +DS+E                E  +I  ++K AI+   GEVF KLNWSAPRDA + I +  TL+C    DI  LLK S  I   L   +  C D    + +    L L+K+  I PA EFRCFV+N++L+AI QR    +   + +   +    I  FY  +I   F    YVFDVY   D K  LIDF+P+    T   LF W EL + ++  DLL
Sbjct:    1 MKQQHVENCNFSSWYPRFKNVTIRSKIIPLSKEFVDYLKTDGVVLPG-----------KPSSLPRHEDDESDSEEWQNLEEDPEQATVEAPEFNDIDTKIKEAIQELGGEVFPKLNWSAPRDASW-ISHDNTLRCKSPGDIYLLLKSSDTIDRVLCDAFIHCEDN-STQTHDSFELILRKWQNIYPAMEFRCFVRNNELVAISQRDISNYYHFLAENEDEICADILNFYESKIAEKFPDTSYVFDVYKYADQKCTLIDFSPYGV-PTNPLLFTWSEL-DTEVVPDLL 272          
BLAST of Cell division cycle protein 123-like protein vs. Ensembl Medaka
Match: cdc123 (cell division cycle 123 [Source:NCBI gene;Acc:101160797])

HSP 1 Score: 141.354 bits (355), Expect = 1.093e-38
Identity = 96/283 (33.92%), Postives = 138/283 (48.76%), Query Frame = 1
Query:   13 MKVADINKCGLPNWYSKFAKVTIPCSLIELDDEFIDYLKRDKIILPKGWLVYRYVFLYKIFTINPKRDHVNDSKEIEHENI-------------------LKQVKNAIKRFDGEVFLKLNWSAPRDAIYMICNGATLKCTHESDIIYLLKGSMFITHDLISPYRSCTDFIDGKKNPRLYLALKKYIEINPAFEFRCFVKNDKLIAICQRYGDLFDEEVKKRFQKYVERIKMFYLEEIRSLFELNEYVFDVYV-TDVKVLLIDFNPFSPDVTESALFDWQELIN 801
            MK   +  C    WY  F K TI   ++ L    IDYL  D  ++  G               N +  H ++S   + E++                     +V  AI    G VF KLNWSAPRDA ++  N ++L+C   +DI  L K S FITHDL  P+  C+D        +  L L+K+ E+ P  EFRCFVK +KLIAI QR    +   +  + ++  + I+ F+ + ++  F   ++VFDVY  +  KV LID NPF  +VT+S LF W EL +
Sbjct:    1 MKKEQVVNCQFSAWYPIFKKHTIKSLILPLPQNVIDYLLDDGTLVVSG------------SDQNTQPRHTDNSDSEDQEDVQWSDDETTTTVTAPEFPEFTSKVLEAINSLGGRVFPKLNWSAPRDANWIALN-SSLQCCSLADIFLLFKSSDFITHDLTQPFLQCSDQDSPDPVIKYELVLRKWSELIPGGEFRCFVKENKLIAISQRDYTQYYPHILTQEEQVSQAIQDFFSQNVQYNFLDEDFVFDVYRDSQGKVWLIDLNPFG-EVTDSLLFTWDELTS 269          
BLAST of Cell division cycle protein 123-like protein vs. Planmine SMEST
Match: SMESG000035045.1 (SMESG000035045.1)

HSP 1 Score: 604.364 bits (1557), Expect = 0.000e+0
Identity = 298/316 (94.30%), Postives = 298/316 (94.30%), Query Frame = 1
Query:   13 MKVADINKCGLPNWYSKFAKVTIPCSLIELDDEFIDYLKRDKIILPKGWLVYRYVFLYKIFTINPKRDHVNDSKEIEHENILKQVKNAIKRFDGEVFLKLNWSAPRDAIYMICNGATLKCTHESDIIYLLKGSMFITHDLISPYRSCTDFIDGKKNPRLYLALKKYIEINPAFEFRCFVKNDKLIAICQRYGDLFDEEVKKRFQKYVERIKMFYLEEIRSLFELNEYVFDVYVTDVKVLLIDFNPFSPDVTESALFDWQELINVDLQSDLLPLTMCVEHEHGVCRSSIEQYALPMEVETVLRGQHDNLFEYLQKAM 960
            MKVADINKCGLPNWYSKFAKVTIPCSLIELDDEFIDYLKRDKIILPKGW                  DHVNDSKEIEHENILKQVKNAIKRFDGEVFLKLNWSAPRDAIYMICNGATLKCTHESDIIYLLKGSMFITHDLISPYRSCTDFIDGKKNPRLYLALKKYIEINPAFEFRCFVKNDKLIAICQRYGDLFDEEVKKRFQKYVERIKMFYLEEIRSLFELNEYVFDVYVTDVKVLLIDFNPFSPDVTESALFDWQELINVDLQSDLLPLTMCVEHEHGVCRSSIEQYALPMEVETVLRGQHDNLFEYLQKAM
Sbjct:    1 MKVADINKCGLPNWYSKFAKVTIPCSLIELDDEFIDYLKRDKIILPKGW------------------DHVNDSKEIEHENILKQVKNAIKRFDGEVFLKLNWSAPRDAIYMICNGATLKCTHESDIIYLLKGSMFITHDLISPYRSCTDFIDGKKNPRLYLALKKYIEINPAFEFRCFVKNDKLIAICQRYGDLFDEEVKKRFQKYVERIKMFYLEEIRSLFELNEYVFDVYVTDVKVLLIDFNPFSPDVTESALFDWQELINVDLQSDLLPLTMCVEHEHGVCRSSIEQYALPMEVETVLRGQHDNLFEYLQKAM 298          
The following BLAST results are available for this feature:
BLAST of Cell division cycle protein 123-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CDC1239.283e-4033.84cell division cycle 123 [Source:HGNC Symbol;Acc:HG... [more]
CDC1235.915e-3031.42cell division cycle 123 [Source:HGNC Symbol;Acc:HG... [more]
CDC1237.586e-1643.27cell division cycle 123 [Source:HGNC Symbol;Acc:HG... [more]
CDC1232.005e-1533.13cell division cycle 123 [Source:HGNC Symbol;Acc:HG... [more]
CDC1231.208e-1432.20cell division cycle 123 [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of Cell division cycle protein 123-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cell division cycle protein 123-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cell division cycle protein 123-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
cdc1234.569e-3734.27cell division cycle 123 homolog (S. cerevisiae) [S... [more]
cdc1236.983e-3734.27cell division cycle 123 homolog (S. cerevisiae) [S... [more]
back to top
BLAST of Cell division cycle protein 123-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cdc1231.904e-4134.71cell division cycle 123 [Source:NCBI gene;Acc:5499... [more]
cdc1232.693e-4133.64cell division cycle 123 [Source:NCBI gene;Acc:5499... [more]
cdc1233.396e-4133.64cell division cycle 123 [Source:NCBI gene;Acc:5499... [more]
cdc1239.508e-4033.02cell division cycle 123 [Source:NCBI gene;Acc:5499... [more]
cdc1232.982e-3932.81cell division cycle 123 [Source:NCBI gene;Acc:5499... [more]
back to top
BLAST of Cell division cycle protein 123-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Cdc1239.468e-4133.23cell division cycle 123 [Source:MGI Symbol;Acc:MGI... [more]
Cdc1232.418e-1556.06cell division cycle 123 [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of Cell division cycle protein 123-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A6SDA8|CD123_BOTFB7.447e-4234.56Cell division cycle protein 123 OS=Botryotinia fuc... [more]
sp|A1CMB9|CD123_ASPCL1.918e-4134.72Cell division cycle protein 123 OS=Aspergillus cla... [more]
sp|Q2PG37|CD123_MACFA4.540e-4034.14Cell division cycle protein 123 homolog OS=Macaca ... [more]
sp|Q8CII2|CD123_MOUSE6.623e-4033.23Cell division cycle protein 123 homolog OS=Mus mus... [more]
sp|Q4WDA4|CD123_ASPFU9.957e-4035.09Cell division cycle protein 123 OS=Neosartorya fum... [more]
back to top
BLAST of Cell division cycle protein 123-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2L2YFC91.348e-5438.63Cell division cycle protein 123-like protein OS=Pa... [more]
A0A2L2YHJ41.550e-5438.63Cell division cycle protein 123-like protein OS=Pa... [more]
A0A224YVJ66.921e-5339.12Cell division cycle protein 123-like protein OS=Rh... [more]
A0A131XK031.028e-5238.80Uncharacterized protein OS=Hyalomma excavatum OX=2... [more]
L7M5H82.804e-5238.49Uncharacterized protein OS=Rhipicephalus pulchellu... [more]
back to top
BLAST of Cell division cycle protein 123-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
cdc1237.867e-3133.33cell division cycle 123 homolog (S. cerevisiae) [S... [more]
cdc1237.478e-2830.86cell division cycle 123 homolog (S. cerevisiae) [S... [more]
back to top
BLAST of Cell division cycle protein 123-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cell division cycle protein 123-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
CDC1235.057e-2830.18Assembly factor for the eIF2 translation initiatio... [more]
back to top
BLAST of Cell division cycle protein 123-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
CDC1232.722e-3935.89Cell division cycle protein 123 homolog [Source:U... [more]
back to top
BLAST of Cell division cycle protein 123-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
cdc1231.093e-3833.92cell division cycle 123 [Source:NCBI gene;Acc:1011... [more]
back to top
BLAST of Cell division cycle protein 123-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000035045.10.000e+094.30SMESG000035045.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028090 ID=SMED30028090|Name=Cell division cycle protein 123-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1048bp
ATTTGAAATAATATGAAGGTCGCTGATATTAATAAATGTGGATTACCAAA
TTGGTATTCAAAATTTGCGAAAGTTACAATTCCATGTTCTTTGATAGAAC
TCGACGATGAGTTTATTGATTATTTAAAAAGAGATAAAATTATCTTACCA
AAAGGATGGTTAGTTTATAGATATGTATTTCTTTATAAAATTTTCACAAT
TAATCCTAAAAGGGATCATGTTAATGACAGTAAAGAAATTGAACATGAGA
ATATATTGAAACAAGTAAAAAACGCAATTAAAAGATTTGACGGAGAAGTA
TTTCTTAAATTAAATTGGAGTGCTCCCAGAGATGCAATTTATATGATTTG
CAATGGAGCCACTTTGAAATGTACTCATGAATCTGATATCATATACCTAC
TGAAAGGCTCAATGTTTATAACACATGATTTGATTTCACCGTATCGGTCA
TGCACAGATTTTATTGATGGAAAGAAAAATCCCAGACTTTATTTAGCACT
TAAAAAATACATAGAAATAAATCCAGCATTTGAATTTCGTTGTTTTGTGA
AAAATGATAAATTAATTGCTATTTGTCAAAGATATGGGGATTTGTTTGAT
GAGGAAGTTAAAAAACGGTTTCAAAAATATGTCGAAAGAATTAAGATGTT
TTATCTCGAAGAAATTCGTTCTTTATTTGAATTAAATGAATATGTATTCG
ATGTTTACGTTACTGATGTCAAGGTACTGCTTATAGATTTCAATCCTTTC
TCTCCGGACGTCACCGAATCCGCCTTGTTTGATTGGCAGGAATTGATCAA
TGTCGATTTGCAGTCAGATTTATTGCCGTTAACAATGTGCGTTGAACATG
AACATGGAGTTTGCCGCAGTTCAATAGAACAATATGCACTACCGATGGAA
GTTGAAACAGTCCTCCGAGGCCAGCATGATAATTTGTTTGAATATCTGCA
AAAAGCGATGGAACACGAATCAGATTCATCGGATGATGAATGATACCGTC
TATATTAGTTATTTGTTTTTAATAAAAAGTTTTTATCCCTTTTCAAAA
back to top

protein sequence of SMED30028090-orf-1

>SMED30028090-orf-1 ID=SMED30028090-orf-1|Name=SMED30028090-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=327bp
MKVADINKCGLPNWYSKFAKVTIPCSLIELDDEFIDYLKRDKIILPKGWL
VYRYVFLYKIFTINPKRDHVNDSKEIEHENILKQVKNAIKRFDGEVFLKL
NWSAPRDAIYMICNGATLKCTHESDIIYLLKGSMFITHDLISPYRSCTDF
IDGKKNPRLYLALKKYIEINPAFEFRCFVKNDKLIAICQRYGDLFDEEVK
KRFQKYVERIKMFYLEEIRSLFELNEYVFDVYVTDVKVLLIDFNPFSPDV
TESALFDWQELINVDLQSDLLPLTMCVEHEHGVCRSSIEQYALPMEVETV
LRGQHDNLFEYLQKAMEHESDSSDDE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR009772CDC123
Vocabulary: biological process
TermDefinition
GO:0007049cell cycle
GO:0051301cell division
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR009772Cell division cycle protein 123PFAMPF07065D123coord: 14..297
e-value: 6.2E-70
score: 235.8
IPR009772Cell division cycle protein 123PANTHERPTHR15323D123 PROTEINcoord: 1..319