SMED30028080

Overview
NameSMED30028080
Smed IDSMED30028080
Length (bp)1491
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30028080 (SMED30028080) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30028080 (SMED30028080) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30028080 (SMED30028080) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30028080 (SMED30028080) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028080

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30028080SMESG000037355.1 Contig5533GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30028080SMESG000037355.1 Contig5533GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30028080SMESG000024479.1 PL030011B10G11ncbi_smed_estsPMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30028080SMESG000024479.1 PL030011B10G11ncbi_smed_estsPMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30028080SMESG000024479.1 PL030011B10G11ncbi_smed_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30028080SMESG000024479.1 Contig5533GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30028080SMESG000024479.1 Contig5533GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30028080SMESG000024479.1 dd_Smed_v4_1163_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30028080SMESG000024479.1 dd_Smed_v4_1163_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30028080SMESG000024479.1 dd_Smed_v4_1163_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30028080SMESG000024479.1 Contig48818uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30028080SMESG000024479.1 Contig48818newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30028080 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.018439:8339..12038 -7039
v31.020816:2236..6017 -6884
Homology
BLAST of SMED30028080 vs. TrEMBL
Match: I1ZID8 (TNF receptor associated factor-2 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 98.9821 bits (245), Expect = 3.717e-20
Identity = 59/174 (33.91%), Postives = 97/174 (55.75%), Query Frame = 2
Query:   89 DHISQLLSKHKLEFIES--PNSLTCTLCNKVLVNAYKTPSGGHFCCKCVDEYLAKTNDNSLSKSVKDQLDNLKCFS---SDNLTNKRISVLFSKCPIETCTYECSMNEMEEHLLYCSKKYFKCPFYEFGCIHDKIENNRLDDHIQVETISHYRLMIDMIIQLKNEVLELKQNEL 595
            + I++LL  +  E +E   P++L C LC  +LVNA ++  G  FC KC+ EY+++ N      + + + +NL   S   +D   N++I+ +  KCP ETC   C + ++EEHL  C+ K   CPF+  GC   K+    L +H+Q  T  H +L+ID+I  ++N+   L   E+
Sbjct:    4 EKINRLLITYNFE-VEGGVPDNLKCDLCKNLLVNACQSRCGCRFCSKCIMEYVSRGNLYCPGGTSECKEENLTICSNIHTDYRVNRKIAKMRVKCPEETCKVYCELVDIEEHLRLCTMKSQNCPFFVLGCNQPKMVIQDLTNHLQNGTFQHSKLIIDIISNMRNDFFGLTTKEV 176          
BLAST of SMED30028080 vs. TrEMBL
Match: I1ZID7 (TNF receptor associated factor-3 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 3.671e-13
Identity = 51/166 (30.72%), Postives = 90/166 (54.22%), Query Frame = 2
Query:  917 MNKKIQESTEEILDKLNEINKRFNMK----DNIFEWHINKIIQITK-SENITSDFFFNRMNPYKLRLKLRVSIN------FLWVRLRVYSGLSDPCLKWPFHADVTIKISNVNSPDACRIITQNCKINKPIVSSYKSSARFTFLFSDLSAVGLLNDCDCVVECFVN 1381
            + +  QE  E I  K+  I      K      IF W++N I    K ++++ S++F+ +++ +K+ L+   +++         V L ++SG+ +  L WPF A+VTIKI N + PD+ +I+T+  +I +P   +Y  S  F F + +LS  GLL +    +ECFV+
Sbjct:   50 LRRDFQEFQERIELKVQNIESYLKQKIDETSGIFSWNVNGISAKRKENQSMFSEYFYTKVSKHKVSLQFTANVSNDINEIGFNVFLFIFSGIQESKLNWPFQANVTIKIVNRSVPDSSKIVTKCFRIEEP-PCNYNWSDPFYFCYDELSGAGLLLNDSFTIECFVD 214          
BLAST of SMED30028080 vs. TrEMBL
Match: T1E101 (TRAF-6 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 5.299e-11
Identity = 45/168 (26.79%), Postives = 86/168 (51.19%), Query Frame = 2
Query:   86 FDHISQLLSKHKLEFIESP--NSLTCTLCNKVLVNAYKTPSGGHFCCKCVDEYLAKTNDNSLSKSVKDQLDNLKCFSSDNLTN----KRISVLFSKCPIETCTYECSMNEMEEHLLYCSKKYFKCPFYEFGCIHDKIENNRLDDHIQVETISHYRLMIDMIIQLKNEV 571
             D++ +LLSK+ ++ ++    N L C LCNK++ +A ++  G H+C  C+  YL++ ++       + + D L     D   N     RIS +  KCP   C Y   +  ++EHL  C+ +  +CP    GC  + +  + +  H+  + + H +L++    +LK+E+
Sbjct:    6 LDNVQELLSKYNVKRVDESVNNDLLCILCNKLMRDACESACGCHYCYTCIRIYLSQNHNYCPGDKTECKEDYLN-LEGDVFRNIRLSTRISRIVVKCPNIRCNYTSELLRLKEHLDKCTPESVECPCVTIGCEEEPLLKDEMAKHLTDQVLRHTQLIMSFCNELKSEI 172          
BLAST of SMED30028080 vs. TrEMBL
Match: A0A0F7GWW3 (TNF receptor associated factor 4 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 58.9214 bits (141), Expect = 2.116e-6
Identity = 28/88 (31.82%), Postives = 47/88 (53.41%), Query Frame = 2
Query:  326 NKRISVLFSKCPIETCTYECSMNEMEEHLLYCSKKYFKCPFYEFGCIHDKIENNRLDDHIQVETISHYRLMIDMIIQLKNEVLELKQN 589
            N +I+ L  KC  ++C Y   + +ME+H   C  +   CP+   GC    I  +++ DH+Q E   H +L++D ++   NE+  LK N
Sbjct:   23 NMKIAKLQVKCKEKSCDYVDELRKMEDHSRTCKYRSVACPYSNIGCDKCNISQDKVTDHLQSEIFVHTKLLMDFVVNFNNEMEMLKAN 110          
BLAST of SMED30028080 vs. TrEMBL
Match: A0A2C5YRI7 (Uncharacterized protein OS=Ophiocordyceps australis OX=1399860 GN=CDD82_7309 PE=4 SV=1)

HSP 1 Score: 61.2326 bits (147), Expect = 3.158e-6
Identity = 38/139 (27.34%), Postives = 64/139 (46.04%), Query Frame = 2
Query:   44 LIDPHNNCHKMNENFDHIS-QLLSKHKLEFIESPNS-LTCTLCNKVLVNAYKTPSGGHFCCKCVDEYLAKTNDNSLSKSVKDQLDNLKCFSSDNLTNKRISVLFSKCP--IETCTYECSMNEMEEHL-LYCSKKYFKCP 445
            L+ PH +   ++    H    L   + L ++  P+S L C +C+  LV+   TP    FC +C+   +A +   +     ++ L  L CFS+  L   +++ L  KCP     CT E     +E H  + C+ + F CP
Sbjct:  130 LLQPHAS--SLDVPLRHGGGALFDMYMLSYVAEPDSNLLCPICHDPLVDPVTTPCDHTFCYRCIRRSIASSPSGTACPIDREVLSWLDCFSAGRLIRTQLNALVVKCPYYARGCTVELRRENIERHATVECTYREFACP 266          
BLAST of SMED30028080 vs. Planmine SMEST
Match: SMESG000024479.1 (SMESG000024479.1)

HSP 1 Score: 828.165 bits (2138), Expect = 0.000e+0
Identity = 428/438 (97.72%), Postives = 428/438 (97.72%), Query Frame = 2
Query:   74 MNENFDHISQLLSKHKLEFIESPNSLTCTLCNKVLVNAYKTPSGGHFCCKCVDEYLAKTNDNSLSKSVKDQLDNLKCFSSDNLTNKRISVLFSKCPIETCTYECSMNEMEEHLLYCSKKYFKCPFYEFGCIHDKIENNRLDDHIQVETISHYRLMIDMIIQLKNEVLELKQNELFIXXXXXXXXXXXXXXXXXINILEASNSDEIFIEMERNSVDRSMEVQSVERKSDTENYNPDNSQTWSRLGNESFGSQQGTNEDHFIIHMEEKFSDIKQKWNRKLDQTMNKKIQESTEEILDKLNEINKRFNMKDNIFEWHINKIIQITKSENITSDFFFNRMNPYKLRLKLRVSINFLWVRLRVYSGLSDPCLKWPFHADVTIKISNVNSPDACRIITQNCKINKPIVSSYKSSARFTFLFSDLSAVGLLNDCDCVVECFVNFE 1387
            MNENFDHISQLLSKHKLEFIESPNSLTCTLCNKVLVNAYKTPSG HFCCKCVDEYLAKTNDNSLSKSVKDQLDNLKCFSSDNLTNKRISVLFSKCPIETCTYECSMNEMEEHLLYCSKKYFKCPFYEFGCIHDKIENNRLDDHIQVETISHYRLMIDMIIQLKNEVLELKQNELFIKSELKLLKENEEKRMKEINILEASNSDEIFIE ERNSVDR MEVQSVERKSD ENYNPDNSQT SRL NESFGSQQG NEDHFIIHMEEKFSDIKQKWNRKLDQTMNKKIQESTEEIL KLNEINKRFNMKDNIFEWHINKIIQITKSENITSDFFFNRMNPYKLRLKLRVSINFLWVRLRVYSGLSD CLKWPFHADVTIKISNVNSPDACRII QNCKINKPIVSSYKSSARFTFLFSDLSAVGLLNDCDCVVECFVNFE
Sbjct:    1 MNENFDHISQLLSKHKLEFIESPNSLTCTLCNKVLVNAYKTPSGCHFCCKCVDEYLAKTNDNSLSKSVKDQLDNLKCFSSDNLTNKRISVLFSKCPIETCTYECSMNEMEEHLLYCSKKYFKCPFYEFGCIHDKIENNRLDDHIQVETISHYRLMIDMIIQLKNEVLELKQNELFIKSELKLLKENEEKRMKEINILEASNSDEIFIERERNSVDRGMEVQSVERKSDAENYNPDNSQTRSRLWNESFGSQQGINEDHFIIHMEEKFSDIKQKWNRKLDQTMNKKIQESTEEILAKLNEINKRFNMKDNIFEWHINKIIQITKSENITSDFFFNRMNPYKLRLKLRVSINFLWVRLRVYSGLSDSCLKWPFHADVTIKISNVNSPDACRIIIQNCKINKPIVSSYKSSARFTFLFSDLSAVGLLNDCDCVVECFVNFE 438          
BLAST of SMED30028080 vs. Planmine SMEST
Match: SMESG000024479.1 (SMESG000024479.1)

HSP 1 Score: 514.998 bits (1325), Expect = 0.000e+0
Identity = 275/284 (96.83%), Postives = 275/284 (96.83%), Query Frame = 2
Query:  536 MIDMIIQLKNEVLELKQNELFIXXXXXXXXXXXXXXXXXINILEASNSDEIFIEMERNSVDRSMEVQSVERKSDTENYNPDNSQTWSRLGNESFGSQQGTNEDHFIIHMEEKFSDIKQKWNRKLDQTMNKKIQESTEEILDKLNEINKRFNMKDNIFEWHINKIIQITKSENITSDFFFNRMNPYKLRLKLRVSINFLWVRLRVYSGLSDPCLKWPFHADVTIKISNVNSPDACRIITQNCKINKPIVSSYKSSARFTFLFSDLSAVGLLNDCDCVVECFVNFE 1387
            MIDMIIQLKNEVLELKQNELFIKSELKLLKENEEKRMKEINILEASNSDEIFIE ERNSVDR MEVQSVERKSD ENYNPDNSQT SRL NESFGSQQG NEDHFIIHMEEKFSDIKQKWNRKLDQTMNKKIQESTEEIL KLNEINKRFNMKDNIFEWHINKIIQITKSENITSDFFFNRMNPYKLRLKLRVSINFLWVRLRVYSGLSD CLKWPFHADVTIKISNVNSPDACRII QNCKINKPIVSSYKSSARFTFLFSDLSAVGLLNDCDCVVECFVNFE
Sbjct:    1 MIDMIIQLKNEVLELKQNELFIKSELKLLKENEEKRMKEINILEASNSDEIFIERERNSVDRGMEVQSVERKSDAENYNPDNSQTRSRLWNESFGSQQGINEDHFIIHMEEKFSDIKQKWNRKLDQTMNKKIQESTEEILAKLNEINKRFNMKDNIFEWHINKIIQITKSENITSDFFFNRMNPYKLRLKLRVSINFLWVRLRVYSGLSDSCLKWPFHADVTIKISNVNSPDACRIIIQNCKINKPIVSSYKSSARFTFLFSDLSAVGLLNDCDCVVECFVNFE 284          
BLAST of SMED30028080 vs. Planmine SMEST
Match: SMESG000024479.1 (SMESG000024479.1)

HSP 1 Score: 509.22 bits (1310), Expect = 0.000e+0
Identity = 272/281 (96.80%), Postives = 272/281 (96.80%), Query Frame = 2
Query:  545 MIIQLKNEVLELKQNELFIXXXXXXXXXXXXXXXXXINILEASNSDEIFIEMERNSVDRSMEVQSVERKSDTENYNPDNSQTWSRLGNESFGSQQGTNEDHFIIHMEEKFSDIKQKWNRKLDQTMNKKIQESTEEILDKLNEINKRFNMKDNIFEWHINKIIQITKSENITSDFFFNRMNPYKLRLKLRVSINFLWVRLRVYSGLSDPCLKWPFHADVTIKISNVNSPDACRIITQNCKINKPIVSSYKSSARFTFLFSDLSAVGLLNDCDCVVECFVNFE 1387
            MIIQLKNEVLELKQNELFIKSELKLLKENEEKRMKEINILEASNSDEIFIE ERNSVDR MEVQSVERKSD ENYNPDNSQT SRL NESFGSQQG NEDHFIIHMEEKFSDIKQKWNRKLDQTMNKKIQESTEEIL KLNEINKRFNMKDNIFEWHINKIIQITKSENITSDFFFNRMNPYKLRLKLRVSINFLWVRLRVYSGLSD CLKWPFHADVTIKISNVNSPDACRII QNCKINKPIVSSYKSSARFTFLFSDLSAVGLLNDCDCVVECFVNFE
Sbjct:    1 MIIQLKNEVLELKQNELFIKSELKLLKENEEKRMKEINILEASNSDEIFIERERNSVDRGMEVQSVERKSDAENYNPDNSQTRSRLWNESFGSQQGINEDHFIIHMEEKFSDIKQKWNRKLDQTMNKKIQESTEEILAKLNEINKRFNMKDNIFEWHINKIIQITKSENITSDFFFNRMNPYKLRLKLRVSINFLWVRLRVYSGLSDSCLKWPFHADVTIKISNVNSPDACRIIIQNCKINKPIVSSYKSSARFTFLFSDLSAVGLLNDCDCVVECFVNFE 281          
BLAST of SMED30028080 vs. Planmine SMEST
Match: SMESG000075344.1 (SMESG000075344.1)

HSP 1 Score: 172.94 bits (437), Expect = 1.365e-48
Identity = 130/456 (28.51%), Postives = 234/456 (51.32%), Query Frame = 2
Query:   74 MNENFDHISQLLSKHKLEFI-ESPNSLTCTLCNKVLVNAYKTPSGGHFCCKCVDEYLAKTNDNSLSKSVKDQLDNLKCFSSDNLTNKRISVLFSKCPIETCTYECSMNEMEEHLLYCSKKYFKCPFYEFGCIHDKIENNRLDDHIQVETISHYRLMIDMIIQLKNEVLELKQNELFIXXXXXXXXXXXXXXXXXINILEASNSDEIFIEMERNSVDRSMEVQSVERKSDTENYNPDNSQTWSRLGNESFGSQQGTNEDHFIIHMEEKFSDIKQKWNRKLDQTM---NKKIQE-------------STEEILDKLNEINKRFNMKDNI-FEWHINKIIQITKSENITSDFFFNRMNPYKLRLKLRVSINFLWVRLRVYSGLSDPCLKWPFHADVTIKISNVNSPDACRIITQNCKINKPIVSSYKSSARFTFLFSDLSAVGLLNDCDCVVECFVNFE 1387
            +N+  + ISQLLS+HK   + +  +   C +CN ++ NA++   G +FC +C++ ++    +N  +K    Q +N+   + + L N RIS +  KCP E C+YEC + EM EHL  CS +  +CPF   GC   ++ + +L+DH       H +++I++I QL+NE+ +LK+N +                            DE  IE  RN + ++++ ++ E K+  +N    N+  W +L N+      G + +  + H+ +K   ++     +L+Q M   ++K QE              T+++  +   INK   M+++    W I KI ++     I S+ F++  NPYK++L L  + + + ++L +YSG  D  L+WP  A + I+I+++N     + +T +C+I KP  +SY+ SA F+    DL    +L D +C + C V F+
Sbjct:    4 INKKLNKISQLLSEHKFVIVNDITDDYKCAICNGIVNNAHQAICGCNFCEECINRFI----ENGGAKCPACQCENVLVITKNYLLNIRISKITVKCPNENCSYECKLIEMNEHLRLCSTRNVECPFSGIGCQLKEMSSEKLNDHFISNVEGHSKILIELIGQLRNEMKDLKENSM--------------------------KKDEA-IESLRNEI-KAIKHENQELKTLIKN---SNNNLWIKL-NQIDVEMNGRSNNGTVKHINDKIESMRIA-GSELEQQMKIVDRKCQELNGNVQIIHQVKAETDKLTKETERINKFLKMRNSGHLLWPIGKINEMKM---IGSEMFYDFQNPYKIQLWLINATDNMNIQLLIYSGAFDEDLQWPVKAKLNIQITSLNDDQQSKSLTISCRIPKPAKNSYEESAEFSVARVDLDKWQML-DNNCSLVCSVKFK 418          
BLAST of SMED30028080 vs. Planmine SMEST
Match: SMESG000012306.1 (SMESG000012306.1)

HSP 1 Score: 167.548 bits (423), Expect = 2.078e-46
Identity = 136/449 (30.29%), Postives = 244/449 (54.34%), Query Frame = 2
Query:   74 MNENFDHISQLLSKHKLEFIESPNS-LTCTLCNKVLVNAYKTPSGGHFCCKCVDEYLAKTNDNSLSKSVKDQLDNLKCFSSDNLTNKRISVLFSKCPIETCTYECSMNEMEEHLLYCSKKYFKCPFYEFGCIHDKIENNRLDDHIQVETISHYRLMIDMIIQLKNEVLELKQNELFIXXXXXXXXXXXXXXXXXINILEASNSDEIFIEMERNSVDRSMEVQSVERKSDTENYNPDNS---QTWSRLGNESFGSQQGTNEDHFIIHMEEKFSDIKQKWNRKLDQTMNKKIQ------ESTEEILDKLNEINKRFNMK-DNIFEWHINKIIQITKSENITSDFFFNRMNPYKLRLKLRVSINFLWVRLRVYSGLSDPCLKWPFHADVTIKISNVNSPDACRIITQNCKINKPIVSSYKSSARFTFLFSDLSAVGLLNDCDCVVECFVNFE 1387
            MNEN ++I QLLS+ K       N  L C +C+ ++ NA++   G +FC +C+ + +   ND+    S K   +N+   S +   N RIS +  +C  E C +EC + EM+EHL  C  +  +CPF   GC    + +++L++H       H +++I++I QL+NE+ ELK++E   +S++K+L  N+ K+ + I IL    S+EI    + N      E++++ R S+   +N  N    +   R  NE+  S    +ED  +I +++   + + K   +  Q MN  +Q      +  ++ + ++  INK   M+ D    W I KI ++ +   + S+ F +  NPY+++L +  + N L ++L + SG  D  LKWP  A ++I I ++ + +  + +T++C INKP ++S + S +FTF   DL+ + +L D +C+V C++ FE
Sbjct:    1 MNENLNNIFQLLSEFKFTIANDINEDLKCGICSGIINNAHQANCGCNFCFRCISQLIK--NDSINCPSCK--AENISEISKNYGLNIRISKINVRCTSENCAHECKLVEMDEHLRLCFSRSVECPFSSIGCQLKNMSSDKLNNHFISNIEDHSKILIELIGQLRNEMRELKEDEAKNQSQIKILIANDMKKDEAIEIL----SNEINTLKQENQ-----ELKTLIRNSNDSLWNKLNQMDIEMNERCRNETVKS---IDEDIKLIKIDKSKLENQMKIIERKCQEMNANLQIIHQTKDENDKRIKEIERINKFLQMQNDGHLLWPIGKINEMKQ---MISEIFHSFQNPYQMQLWIDNAANKLNIQLLIVSGGLDEGLKWPIKAKISIDILSLVNREKSKSLTKSCTINKPKINSCERSVKFTFSHKDLANLQML-DNNCLVVCYIEFE 429          
The following BLAST results are available for this feature:
BLAST of SMED30028080 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30028080 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30028080 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30028080 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30028080 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30028080 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30028080 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30028080 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
I1ZID83.717e-2033.91TNF receptor associated factor-2 (Fragment) OS=Sch... [more]
I1ZID73.671e-1330.72TNF receptor associated factor-3 (Fragment) OS=Sch... [more]
T1E1015.299e-1126.79TRAF-6 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1[more]
A0A0F7GWW32.116e-631.82TNF receptor associated factor 4 (Fragment) OS=Sch... [more]
A0A2C5YRI73.158e-627.34Uncharacterized protein OS=Ophiocordyceps australi... [more]
back to top
BLAST of SMED30028080 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30028080 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30028080 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30028080 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30028080 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30028080 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000024479.10.000e+097.72SMESG000024479.1[more]
SMESG000024479.10.000e+096.83SMESG000024479.1[more]
SMESG000024479.10.000e+096.80SMESG000024479.1[more]
SMESG000075344.11.365e-4828.51SMESG000075344.1[more]
SMESG000012306.12.078e-4630.29SMESG000012306.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028080 ID=SMED30028080|Name=SMED30028080|organism=Schmidtea mediterranea sexual|type=transcript|length=1491bp
AAGTTGGCAATATTGCGATGATTATTAAATTTGAAATTTGGTATTAATTG
ATCCTCATAACAATTGTCACAAAATGAATGAAAACTTTGATCATATATCC
CAATTATTATCAAAACACAAACTTGAATTTATTGAAAGCCCAAATTCATT
GACATGTACCTTATGTAATAAAGTTCTAGTGAATGCTTATAAGACACCTT
CTGGCGGTCATTTCTGTTGCAAATGTGTTGATGAATACCTTGCGAAAACG
AATGATAATTCTCTATCAAAGTCCGTAAAAGATCAACTAGATAATCTGAA
ATGTTTCTCATCTGACAATTTAACTAATAAACGAATATCCGTTTTATTCT
CAAAGTGTCCAATAGAGACATGTACATACGAATGTTCTATGAATGAAATG
GAAGAACATTTGCTATATTGTTCAAAGAAATATTTTAAATGTCCATTTTA
TGAATTCGGTTGCATTCATGACAAGATCGAAAACAATAGGTTGGACGACC
ATATCCAGGTTGAAACGATCAGTCATTACAGGTTGATGATAGACATGATA
ATCCAGTTGAAAAATGAGGTCCTAGAGTTAAAACAAAATGAATTGTTTAT
CAAGTCCGAATTGAAACTTTTGAAAGAAAACGAAGAGAAAAGGATGAAAG
AAATTAATATTTTGGAAGCCTCCAATTCAGACGAAATTTTTATAGAAATG
GAGAGAAATAGTGTGGATCGCAGCATGGAAGTACAAAGTGTGGAGAGAAA
AAGCGATACAGAAAATTATAATCCAGACAACTCACAAACCTGGTCACGCT
TGGGGAATGAGTCCTTCGGAAGTCAGCAAGGAACCAACGAAGACCACTTC
ATCATTCACATGGAAGAGAAATTCAGTGACATTAAACAAAAATGGAATCG
GAAATTGGATCAAACAATGAATAAGAAAATTCAAGAGAGCACAGAAGAGA
TATTGGATAAACTAAATGAAATAAACAAACGATTCAATATGAAAGACAAT
ATTTTTGAATGGCATATTAATAAGATTATTCAGATTACAAAAAGTGAAAA
TATTACTAGCGACTTTTTTTTCAACAGGATGAATCCTTATAAATTGAGAC
TAAAACTGAGAGTTTCCATCAACTTCTTGTGGGTTCGACTGAGAGTCTAC
TCGGGCCTAAGTGATCCTTGTCTCAAATGGCCGTTTCATGCCGACGTGAC
AATCAAAATATCCAACGTTAACAGTCCGGATGCCTGTCGGATCATCACCC
AAAATTGTAAGATCAACAAGCCGATTGTCAGTTCGTACAAAAGTAGCGCC
AGATTTACTTTTCTCTTTTCTGATTTATCAGCCGTTGGACTATTGAATGA
TTGTGATTGCGTTGTTGAATGTTTTGTCAATTTTGAATGAATTTTTTATA
CTTTTGTTTTCCCTTATTATCGTCAATTAACATATACATTTTTCTTATCA
AACCTCGAAAATAAAAATTACAGGTGTTAAAAAAGATCGGA
back to top

protein sequence of SMED30028080-orf-1

>SMED30028080-orf-1 ID=SMED30028080-orf-1|Name=SMED30028080-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=439bp
MNENFDHISQLLSKHKLEFIESPNSLTCTLCNKVLVNAYKTPSGGHFCCK
CVDEYLAKTNDNSLSKSVKDQLDNLKCFSSDNLTNKRISVLFSKCPIETC
TYECSMNEMEEHLLYCSKKYFKCPFYEFGCIHDKIENNRLDDHIQVETIS
HYRLMIDMIIQLKNEVLELKQNELFIKSELKLLKENEEKRMKEINILEAS
NSDEIFIEMERNSVDRSMEVQSVERKSDTENYNPDNSQTWSRLGNESFGS
QQGTNEDHFIIHMEEKFSDIKQKWNRKLDQTMNKKIQESTEEILDKLNEI
NKRFNMKDNIFEWHINKIIQITKSENITSDFFFNRMNPYKLRLKLRVSIN
FLWVRLRVYSGLSDPCLKWPFHADVTIKISNVNSPDACRIITQNCKINKP
IVSSYKSSARFTFLFSDLSAVGLLNDCDCVVECFVNFE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR043211TNF_rcpt-assoc_TRAF
IPR008974TRAF-like
IPR013083Znf_RING/FYVE/PHD
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0004842ubiquitin-protein transferase activity
GO:0008270zinc ion binding
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0006955immune response
GO:0007165signal transduction
GO:0016567protein ubiquitination
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 283..303
NoneNo IPR availableCOILSCoilCoilcoord: 177..197
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 217..231
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 217..239
NoneNo IPR availablePANTHERPTHR10131:SF129TNF RECEPTOR-ASSOCIATED FACTOR 6coord: 107..384
NoneNo IPR availableSUPERFAMILYSSF57850RING/U-boxcoord: 9..58
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 9..127
e-value: 1.4E-6
score: 30.2
IPR008974TRAF-likeGENE3DG3DSA:2.60.210.10coord: 259..436
e-value: 7.3E-10
score: 40.7
IPR008974TRAF-likeSUPERFAMILYSSF49599TRAF domain-likecoord: 308..391
IPR043211TNF receptor-associated factor TRAFPANTHERPTHR10131TNF RECEPTOR ASSOCIATED FACTORcoord: 107..384