DAB2 interacting protein b

Overview
NameDAB2 interacting protein b
Smed IDSMED30028071
Length (bp)3236
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of DAB2 interacting protein b (SMED30028071) t-SNE clustered cells

Violin plots show distribution of expression levels for DAB2 interacting protein b (SMED30028071) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of DAB2 interacting protein b (SMED30028071) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for DAB2 interacting protein b (SMED30028071) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028071

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30028071SMESG000000171.1 dd_Smed_v4_3907_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30028071SMESG000000171.1 dd_Smed_v4_3907_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30028071SMESG000000171.1 dd_Smed_v4_3907_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of DAB2 interacting protein b vs. Ensembl Human
Match: DAB2IP (DAB2 interacting protein [Source:HGNC Symbol;Acc:HGNC:17294])

HSP 1 Score: 224.172 bits (570), Expect = 1.647e-59
Identity = 145/487 (29.77%), Postives = 249/487 (51.13%), Query Frame = 1
Query:  448 IIPIHHSLCFGKRFCYRIVTVGGPNEAKSIVFNSSNQTERDLCIKQIRCAXXXXXXXXXXXXNNLKISIQEAKNLTLKNKYYCEIKLDNLIYARTSVKEMKEILIWGEEFDLMSLPCIEMVSITLWRLPRSKEKHKECQIVSHFNIPIENIDQHCITEKWYSPSPVCLPHSGSKLAHNLTFSAACDIDELPKNNTRTLNQVTDSAPLLRAKSKYSPLKVLDAKYYMEFVEFIKENGINMLREMEAGIKAKYREVLVWSMIQLSISENWVEEFLSDLILKEAQSC--DIKIILRGNSMASKSIEFFLKLECQDYLRQILHSTIKDIIHKTNDLEIDQSQLIKRNESISASAMRKRNQRLEMIVDKVLNKIFSNVDIIPRRVRSIFSRIRCSLKNFGTIDLEFTQKVVSACFFLRLVCPAIMTPHLFDLLPEYSDNVNINRSFTLVAKCVQNIANFAGIDDTKESYMQSIALHCRDYYNQMSEFINSIS 1902
            I P+H S+  G+ +C+ + T  G     S  F+  +  ERD  ++ +R A+  +  +    E+ LK+ + EAK+L  K KY CE+ LD+++YART+ K   + + WGE F+  +LP +  V++ L+R    K+K +    +   ++P  ++      EKWY   PV  P+                    PK             P++R K++Y  + +L  + Y EF E I  + + +   +E  + AK +E +  +++ +  S   V++FL+DL++ E   C  +  +I R N++A+K+IE +LKL  Q YL+  L   IK +     + E+D S+        SA+ + +    L+M  +    KI ++  + PR ++ +F+  R    + G  D+  +++++SA  FLR +CPAIM+P LF+LL EY D+    R+ TL+AK  QN+ANFA    +KE YM  +       +  M  F+  IS
Sbjct:   33 IKPVHSSI-LGQDYCFEVTTSSG-----SKCFSCRSAAERDKWMENLRRAVHPNKDNSRRVEHILKLWVIEAKDLPAKKKYLCELCLDDVLYARTTGKLKTDNVFWGEHFEFHNLPPLRTVTVHLYRETDKKKKKERNSYLGLVSLPAASVAGRQFVEKWY---PVVTPN--------------------PKGGK-------GPGPMIRIKARYQTITILPMEMYKEFAEHITNHYLGLCAALEPILSAKTKEEMASALVHILQSTGKVKDFLTDLMMSEVDRCGDNEHLIFRENTLATKAIEEYLKLVGQKYLQDALGEFIKALYESDENCEVDPSK-------CSAADLPEHQGNLKMCCELAFCKIINSYCVFPRELKEVFASWRQECSSRGRPDI--SERLISASLFLRFLCPAIMSPSLFNLLQEYPDD-RTARTLTLIAKVTQNLANFAKF-GSKEEYMSFMNQFLEHEWTNMQRFLLEIS 472          
BLAST of DAB2 interacting protein b vs. Ensembl Human
Match: DAB2IP (DAB2 interacting protein [Source:HGNC Symbol;Acc:HGNC:17294])

HSP 1 Score: 224.172 bits (570), Expect = 1.891e-59
Identity = 145/487 (29.77%), Postives = 249/487 (51.13%), Query Frame = 1
Query:  448 IIPIHHSLCFGKRFCYRIVTVGGPNEAKSIVFNSSNQTERDLCIKQIRCAXXXXXXXXXXXXNNLKISIQEAKNLTLKNKYYCEIKLDNLIYARTSVKEMKEILIWGEEFDLMSLPCIEMVSITLWRLPRSKEKHKECQIVSHFNIPIENIDQHCITEKWYSPSPVCLPHSGSKLAHNLTFSAACDIDELPKNNTRTLNQVTDSAPLLRAKSKYSPLKVLDAKYYMEFVEFIKENGINMLREMEAGIKAKYREVLVWSMIQLSISENWVEEFLSDLILKEAQSC--DIKIILRGNSMASKSIEFFLKLECQDYLRQILHSTIKDIIHKTNDLEIDQSQLIKRNESISASAMRKRNQRLEMIVDKVLNKIFSNVDIIPRRVRSIFSRIRCSLKNFGTIDLEFTQKVVSACFFLRLVCPAIMTPHLFDLLPEYSDNVNINRSFTLVAKCVQNIANFAGIDDTKESYMQSIALHCRDYYNQMSEFINSIS 1902
            I P+H S+  G+ +C+ + T  G     S  F+  +  ERD  ++ +R A+  +  +    E+ LK+ + EAK+L  K KY CE+ LD+++YART+ K   + + WGE F+  +LP +  V++ L+R    K+K +    +   ++P  ++      EKWY   PV  P+                    PK             P++R K++Y  + +L  + Y EF E I  + + +   +E  + AK +E +  +++ +  S   V++FL+DL++ E   C  +  +I R N++A+K+IE +LKL  Q YL+  L   IK +     + E+D S+        SA+ + +    L+M  +    KI ++  + PR ++ +F+  R    + G  D+  +++++SA  FLR +CPAIM+P LF+LL EY D+    R+ TL+AK  QN+ANFA    +KE YM  +       +  M  F+  IS
Sbjct:   66 IKPVHSSI-LGQDYCFEVTTSSG-----SKCFSCRSAAERDKWMENLRRAVHPNKDNSRRVEHILKLWVIEAKDLPAKKKYLCELCLDDVLYARTTGKLKTDNVFWGEHFEFHNLPPLRTVTVHLYRETDKKKKKERNSYLGLVSLPAASVAGRQFVEKWY---PVVTPN--------------------PKGGK-------GPGPMIRIKARYQTITILPMEMYKEFAEHITNHYLGLCAALEPILSAKTKEEMASALVHILQSTGKVKDFLTDLMMSEVDRCGDNEHLIFRENTLATKAIEEYLKLVGQKYLQDALGEFIKALYESDENCEVDPSK-------CSAADLPEHQGNLKMCCELAFCKIINSYCVFPRELKEVFASWRQECSSRGRPDI--SERLISASLFLRFLCPAIMSPSLFNLLQEYPDD-RTARTLTLIAKVTQNLANFAKF-GSKEEYMSFMNQFLEHEWTNMQRFLLEIS 505          
BLAST of DAB2 interacting protein b vs. Ensembl Human
Match: DAB2IP (DAB2 interacting protein [Source:HGNC Symbol;Acc:HGNC:17294])

HSP 1 Score: 224.172 bits (570), Expect = 2.467e-59
Identity = 145/487 (29.77%), Postives = 249/487 (51.13%), Query Frame = 1
Query:  448 IIPIHHSLCFGKRFCYRIVTVGGPNEAKSIVFNSSNQTERDLCIKQIRCAXXXXXXXXXXXXNNLKISIQEAKNLTLKNKYYCEIKLDNLIYARTSVKEMKEILIWGEEFDLMSLPCIEMVSITLWRLPRSKEKHKECQIVSHFNIPIENIDQHCITEKWYSPSPVCLPHSGSKLAHNLTFSAACDIDELPKNNTRTLNQVTDSAPLLRAKSKYSPLKVLDAKYYMEFVEFIKENGINMLREMEAGIKAKYREVLVWSMIQLSISENWVEEFLSDLILKEAQSC--DIKIILRGNSMASKSIEFFLKLECQDYLRQILHSTIKDIIHKTNDLEIDQSQLIKRNESISASAMRKRNQRLEMIVDKVLNKIFSNVDIIPRRVRSIFSRIRCSLKNFGTIDLEFTQKVVSACFFLRLVCPAIMTPHLFDLLPEYSDNVNINRSFTLVAKCVQNIANFAGIDDTKESYMQSIALHCRDYYNQMSEFINSIS 1902
            I P+H S+  G+ +C+ + T  G     S  F+  +  ERD  ++ +R A+  +  +    E+ LK+ + EAK+L  K KY CE+ LD+++YART+ K   + + WGE F+  +LP +  V++ L+R    K+K +    +   ++P  ++      EKWY   PV  P+                    PK             P++R K++Y  + +L  + Y EF E I  + + +   +E  + AK +E +  +++ +  S   V++FL+DL++ E   C  +  +I R N++A+K+IE +LKL  Q YL+  L   IK +     + E+D S+        SA+ + +    L+M  +    KI ++  + PR ++ +F+  R    + G  D+  +++++SA  FLR +CPAIM+P LF+LL EY D+    R+ TL+AK  QN+ANFA    +KE YM  +       +  M  F+  IS
Sbjct:  129 IKPVHSSI-LGQDYCFEVTTSSG-----SKCFSCRSAAERDKWMENLRRAVHPNKDNSRRVEHILKLWVIEAKDLPAKKKYLCELCLDDVLYARTTGKLKTDNVFWGEHFEFHNLPPLRTVTVHLYRETDKKKKKERNSYLGLVSLPAASVAGRQFVEKWY---PVVTPN--------------------PKGGK-------GPGPMIRIKARYQTITILPMEMYKEFAEHITNHYLGLCAALEPILSAKTKEEMASALVHILQSTGKVKDFLTDLMMSEVDRCGDNEHLIFRENTLATKAIEEYLKLVGQKYLQDALGEFIKALYESDENCEVDPSK-------CSAADLPEHQGNLKMCCELAFCKIINSYCVFPRELKEVFASWRQECSSRGRPDI--SERLISASLFLRFLCPAIMSPSLFNLLQEYPDD-RTARTLTLIAKVTQNLANFAKF-GSKEEYMSFMNQFLEHEWTNMQRFLLEIS 568          
BLAST of DAB2 interacting protein b vs. Ensembl Human
Match: DAB2IP (DAB2 interacting protein [Source:HGNC Symbol;Acc:HGNC:17294])

HSP 1 Score: 223.787 bits (569), Expect = 3.176e-59
Identity = 145/487 (29.77%), Postives = 249/487 (51.13%), Query Frame = 1
Query:  448 IIPIHHSLCFGKRFCYRIVTVGGPNEAKSIVFNSSNQTERDLCIKQIRCAXXXXXXXXXXXXNNLKISIQEAKNLTLKNKYYCEIKLDNLIYARTSVKEMKEILIWGEEFDLMSLPCIEMVSITLWRLPRSKEKHKECQIVSHFNIPIENIDQHCITEKWYSPSPVCLPHSGSKLAHNLTFSAACDIDELPKNNTRTLNQVTDSAPLLRAKSKYSPLKVLDAKYYMEFVEFIKENGINMLREMEAGIKAKYREVLVWSMIQLSISENWVEEFLSDLILKEAQSC--DIKIILRGNSMASKSIEFFLKLECQDYLRQILHSTIKDIIHKTNDLEIDQSQLIKRNESISASAMRKRNQRLEMIVDKVLNKIFSNVDIIPRRVRSIFSRIRCSLKNFGTIDLEFTQKVVSACFFLRLVCPAIMTPHLFDLLPEYSDNVNINRSFTLVAKCVQNIANFAGIDDTKESYMQSIALHCRDYYNQMSEFINSIS 1902
            I P+H S+  G+ +C+ + T  G     S  F+  +  ERD  ++ +R A+  +  +    E+ LK+ + EAK+L  K KY CE+ LD+++YART+ K   + + WGE F+  +LP +  V++ L+R    K+K +    +   ++P  ++      EKWY   PV  P+                    PK             P++R K++Y  + +L  + Y EF E I  + + +   +E  + AK +E +  +++ +  S   V++FL+DL++ E   C  +  +I R N++A+K+IE +LKL  Q YL+  L   IK +     + E+D S+        SA+ + +    L+M  +    KI ++  + PR ++ +F+  R    + G  D+  +++++SA  FLR +CPAIM+P LF+LL EY D+    R+ TL+AK  QN+ANFA    +KE YM  +       +  M  F+  IS
Sbjct:   96 IKPVHSSI-LGQDYCFEVTTSSG-----SKCFSCRSAAERDKWMENLRRAVHPNKDNSRRVEHILKLWVIEAKDLPAKKKYLCELCLDDVLYARTTGKLKTDNVFWGEHFEFHNLPPLRTVTVHLYRETDKKKKKERNSYLGLVSLPAASVAGRQFVEKWY---PVVTPN--------------------PKGGK-------GPGPMIRIKARYQTITILPMEMYKEFAEHITNHYLGLCAALEPILSAKTKEEMASALVHILQSTGKVKDFLTDLMMSEVDRCGDNEHLIFRENTLATKAIEEYLKLVGQKYLQDALGEFIKALYESDENCEVDPSK-------CSAADLPEHQGNLKMCCELAFCKIINSYCVFPRELKEVFASWRQECSSRGRPDI--SERLISASLFLRFLCPAIMSPSLFNLLQEYPDD-RTARTLTLIAKVTQNLANFAKF-GSKEEYMSFMNQFLEHEWTNMQRFLLEIS 535          
BLAST of DAB2 interacting protein b vs. Ensembl Human
Match: DAB2IP (DAB2 interacting protein [Source:HGNC Symbol;Acc:HGNC:17294])

HSP 1 Score: 223.787 bits (569), Expect = 3.395e-59
Identity = 145/487 (29.77%), Postives = 249/487 (51.13%), Query Frame = 1
Query:  448 IIPIHHSLCFGKRFCYRIVTVGGPNEAKSIVFNSSNQTERDLCIKQIRCAXXXXXXXXXXXXNNLKISIQEAKNLTLKNKYYCEIKLDNLIYARTSVKEMKEILIWGEEFDLMSLPCIEMVSITLWRLPRSKEKHKECQIVSHFNIPIENIDQHCITEKWYSPSPVCLPHSGSKLAHNLTFSAACDIDELPKNNTRTLNQVTDSAPLLRAKSKYSPLKVLDAKYYMEFVEFIKENGINMLREMEAGIKAKYREVLVWSMIQLSISENWVEEFLSDLILKEAQSC--DIKIILRGNSMASKSIEFFLKLECQDYLRQILHSTIKDIIHKTNDLEIDQSQLIKRNESISASAMRKRNQRLEMIVDKVLNKIFSNVDIIPRRVRSIFSRIRCSLKNFGTIDLEFTQKVVSACFFLRLVCPAIMTPHLFDLLPEYSDNVNINRSFTLVAKCVQNIANFAGIDDTKESYMQSIALHCRDYYNQMSEFINSIS 1902
            I P+H S+  G+ +C+ + T  G     S  F+  +  ERD  ++ +R A+  +  +    E+ LK+ + EAK+L  K KY CE+ LD+++YART+ K   + + WGE F+  +LP +  V++ L+R    K+K +    +   ++P  ++      EKWY   PV  P+                    PK             P++R K++Y  + +L  + Y EF E I  + + +   +E  + AK +E +  +++ +  S   V++FL+DL++ E   C  +  +I R N++A+K+IE +LKL  Q YL+  L   IK +     + E+D S+        SA+ + +    L+M  +    KI ++  + PR ++ +F+  R    + G  D+  +++++SA  FLR +CPAIM+P LF+LL EY D+    R+ TL+AK  QN+ANFA    +KE YM  +       +  M  F+  IS
Sbjct:  157 IKPVHSSI-LGQDYCFEVTTSSG-----SKCFSCRSAAERDKWMENLRRAVHPNKDNSRRVEHILKLWVIEAKDLPAKKKYLCELCLDDVLYARTTGKLKTDNVFWGEHFEFHNLPPLRTVTVHLYRETDKKKKKERNSYLGLVSLPAASVAGRQFVEKWY---PVVTPN--------------------PKGGK-------GPGPMIRIKARYQTITILPMEMYKEFAEHITNHYLGLCAALEPILSAKTKEEMASALVHILQSTGKVKDFLTDLMMSEVDRCGDNEHLIFRENTLATKAIEEYLKLVGQKYLQDALGEFIKALYESDENCEVDPSK-------CSAADLPEHQGNLKMCCELAFCKIINSYCVFPRELKEVFASWRQECSSRGRPDI--SERLISASLFLRFLCPAIMSPSLFNLLQEYPDD-RTARTLTLIAKVTQNLANFAKF-GSKEEYMSFMNQFLEHEWTNMQRFLLEIS 596          
BLAST of DAB2 interacting protein b vs. Ensembl Celegans
Match: gap-2 (Ras GTPase-activating protein gap-2 [Source:UniProtKB/Swiss-Prot;Acc:Q8MLZ5])

HSP 1 Score: 215.698 bits (548), Expect = 1.776e-57
Identity = 146/491 (29.74%), Postives = 254/491 (51.73%), Query Frame = 1
Query:  445 KIIPIHHSLCFGKRFCYRIVTVGGPNEAKSIVFNSSNQTERDLCIKQIRCAXXXXXXXXXXXXNNLKISIQEAKNLTLKNKYYCEIKLDNLIYARTSVKEMKEILIWGEEFDLMSLPCIEMVSITLWRLPRSKEKHKECQIVSHFNIPIENIDQHCITEKWYSPSPVCLPHSG---SKLAHNLTFSAACDIDELPKNNTRTLNQVTDSAPLLRAKSKYSPLKVLDAKYYMEFVEFIKENGINMLREMEAGIKAKYREVLVWSMIQLSISENWVEEFLSDLILKEAQSCD-IKIILRGNSMASKSIEFFLKLECQDYLRQILHSTIKDIIHKTNDLEIDQSQLIKRNESISASAMRKRNQRLEMIVDKVLNKIFSNVDIIPRRVRSIFSRIRCSLKNFGTIDLEFTQKVVSACFFLRLVCPAIMTPHLFDLLPEYSDNVNINRSFTLVAKCVQNIANFAGIDDTKESYMQSIALHCRDYYNQMSEFINSIST 1905
            ++ P+H S+ F    C+R+          S  ++     ER   ++ +R  ++         EN++ I I EAK L  K KYYCE+ LD  +YA+TS K   + + WGE F+ M LP I+ V ++L+R   S  K K+  ++ +  I I+ +      E+WY+   V   HS    S++A  L   ++                 +  +P LR K+++  + +L  + Y   +E +  N + +  ++E  +  + +E L  S++++    N  +EFL DLI+KE +  D   ++ RGN++A+K++E F+KL   DYL   L   IK ++   +  E+D  +L     ++S S++ K    L   V+    KI +NV  +P+ +R +FS +RC L+      L  T  ++S+  FLR +CPAI++P LF+L+ EY    N  R+ TL+AK +QN+ANF+     KE +M+ +       +++M +F+  IS+
Sbjct:   82 RLHPVHPSI-FEVPNCFRLA---------STYYSCRTPLERAKWMENLRKTMNPRRDQQRRTENSMLIWILEAKGLPAKRKYYCEMTLDKTLYAKTSSKARTDNVFWGENFEFMMLPKIDEVCVSLFR--ESDSKKKKDTLIGYVTIGIDQLSSRSPVERWYT---VNTSHSDSGTSRIASALGGKSS-----------------SQESPSLRIKARWQSVHILPLRAYDNLLETLCYNYLPLCEQLEPVLNVRDKEDLATSLVRVMYKHNLAKEFLCDLIMKEVEKLDNDHLMFRGNTLATKAMESFMKLVADDYLDSTLSDFIKTVLQCEDSCEVDPQKL----GNVSNSSLEKNRALLMRYVEVAWTKILNNVHQLPKNLRDVFSALRCRLEAQNREALADT--LISSSIFLRFLCPAILSPSLFNLVSEYPSPTNA-RNLTLIAKTLQNLANFSKFGG-KEPHMEFMNEFVDREWHRMKDFLLRISS 532          
BLAST of DAB2 interacting protein b vs. Ensembl Celegans
Match: gap-2 (Ras GTPase-activating protein gap-2 [Source:UniProtKB/Swiss-Prot;Acc:Q8MLZ5])

HSP 1 Score: 215.312 bits (547), Expect = 2.360e-57
Identity = 146/491 (29.74%), Postives = 254/491 (51.73%), Query Frame = 1
Query:  445 KIIPIHHSLCFGKRFCYRIVTVGGPNEAKSIVFNSSNQTERDLCIKQIRCAXXXXXXXXXXXXNNLKISIQEAKNLTLKNKYYCEIKLDNLIYARTSVKEMKEILIWGEEFDLMSLPCIEMVSITLWRLPRSKEKHKECQIVSHFNIPIENIDQHCITEKWYSPSPVCLPHSG---SKLAHNLTFSAACDIDELPKNNTRTLNQVTDSAPLLRAKSKYSPLKVLDAKYYMEFVEFIKENGINMLREMEAGIKAKYREVLVWSMIQLSISENWVEEFLSDLILKEAQSCD-IKIILRGNSMASKSIEFFLKLECQDYLRQILHSTIKDIIHKTNDLEIDQSQLIKRNESISASAMRKRNQRLEMIVDKVLNKIFSNVDIIPRRVRSIFSRIRCSLKNFGTIDLEFTQKVVSACFFLRLVCPAIMTPHLFDLLPEYSDNVNINRSFTLVAKCVQNIANFAGIDDTKESYMQSIALHCRDYYNQMSEFINSIST 1905
            ++ P+H S+ F    C+R+          S  ++     ER   ++ +R  ++         EN++ I I EAK L  K KYYCE+ LD  +YA+TS K   + + WGE F+ M LP I+ V ++L+R   S  K K+  ++ +  I I+ +      E+WY+   V   HS    S++A  L   ++                 +  +P LR K+++  + +L  + Y   +E +  N + +  ++E  +  + +E L  S++++    N  +EFL DLI+KE +  D   ++ RGN++A+K++E F+KL   DYL   L   IK ++   +  E+D  +L     ++S S++ K    L   V+    KI +NV  +P+ +R +FS +RC L+      L  T  ++S+  FLR +CPAI++P LF+L+ EY    N  R+ TL+AK +QN+ANF+     KE +M+ +       +++M +F+  IS+
Sbjct:   90 RLHPVHPSI-FEVPNCFRLA---------STYYSCRTPLERAKWMENLRKTMNPRRDQQRRTENSMLIWILEAKGLPAKRKYYCEMTLDKTLYAKTSSKARTDNVFWGENFEFMMLPKIDEVCVSLFR--ESDSKKKKDTLIGYVTIGIDQLSSRSPVERWYT---VNTSHSDSGTSRIASALGGKSS-----------------SQESPSLRIKARWQSVHILPLRAYDNLLETLCYNYLPLCEQLEPVLNVRDKEDLATSLVRVMYKHNLAKEFLCDLIMKEVEKLDNDHLMFRGNTLATKAMESFMKLVADDYLDSTLSDFIKTVLQCEDSCEVDPQKL----GNVSNSSLEKNRALLMRYVEVAWTKILNNVHQLPKNLRDVFSALRCRLEAQNREALADT--LISSSIFLRFLCPAILSPSLFNLVSEYPSPTNA-RNLTLIAKTLQNLANFSKFGG-KEPHMEFMNEFVDREWHRMKDFLLRISS 540          
BLAST of DAB2 interacting protein b vs. Ensembl Celegans
Match: gap-2 (Ras GTPase-activating protein gap-2 [Source:UniProtKB/Swiss-Prot;Acc:Q8MLZ5])

HSP 1 Score: 215.698 bits (548), Expect = 3.536e-57
Identity = 146/491 (29.74%), Postives = 254/491 (51.73%), Query Frame = 1
Query:  445 KIIPIHHSLCFGKRFCYRIVTVGGPNEAKSIVFNSSNQTERDLCIKQIRCAXXXXXXXXXXXXNNLKISIQEAKNLTLKNKYYCEIKLDNLIYARTSVKEMKEILIWGEEFDLMSLPCIEMVSITLWRLPRSKEKHKECQIVSHFNIPIENIDQHCITEKWYSPSPVCLPHSG---SKLAHNLTFSAACDIDELPKNNTRTLNQVTDSAPLLRAKSKYSPLKVLDAKYYMEFVEFIKENGINMLREMEAGIKAKYREVLVWSMIQLSISENWVEEFLSDLILKEAQSCD-IKIILRGNSMASKSIEFFLKLECQDYLRQILHSTIKDIIHKTNDLEIDQSQLIKRNESISASAMRKRNQRLEMIVDKVLNKIFSNVDIIPRRVRSIFSRIRCSLKNFGTIDLEFTQKVVSACFFLRLVCPAIMTPHLFDLLPEYSDNVNINRSFTLVAKCVQNIANFAGIDDTKESYMQSIALHCRDYYNQMSEFINSIST 1905
            ++ P+H S+ F    C+R+          S  ++     ER   ++ +R  ++         EN++ I I EAK L  K KYYCE+ LD  +YA+TS K   + + WGE F+ M LP I+ V ++L+R   S  K K+  ++ +  I I+ +      E+WY+   V   HS    S++A  L   ++                 +  +P LR K+++  + +L  + Y   +E +  N + +  ++E  +  + +E L  S++++    N  +EFL DLI+KE +  D   ++ RGN++A+K++E F+KL   DYL   L   IK ++   +  E+D  +L     ++S S++ K    L   V+    KI +NV  +P+ +R +FS +RC L+      L  T  ++S+  FLR +CPAI++P LF+L+ EY    N  R+ TL+AK +QN+ANF+     KE +M+ +       +++M +F+  IS+
Sbjct:  182 RLHPVHPSI-FEVPNCFRLA---------STYYSCRTPLERAKWMENLRKTMNPRRDQQRRTENSMLIWILEAKGLPAKRKYYCEMTLDKTLYAKTSSKARTDNVFWGENFEFMMLPKIDEVCVSLFR--ESDSKKKKDTLIGYVTIGIDQLSSRSPVERWYT---VNTSHSDSGTSRIASALGGKSS-----------------SQESPSLRIKARWQSVHILPLRAYDNLLETLCYNYLPLCEQLEPVLNVRDKEDLATSLVRVMYKHNLAKEFLCDLIMKEVEKLDNDHLMFRGNTLATKAMESFMKLVADDYLDSTLSDFIKTVLQCEDSCEVDPQKL----GNVSNSSLEKNRALLMRYVEVAWTKILNNVHQLPKNLRDVFSALRCRLEAQNREALADT--LISSSIFLRFLCPAILSPSLFNLVSEYPSPTNA-RNLTLIAKTLQNLANFSKFGG-KEPHMEFMNEFVDREWHRMKDFLLRISS 632          
BLAST of DAB2 interacting protein b vs. Ensembl Celegans
Match: gap-2 (Ras GTPase-activating protein gap-2 [Source:UniProtKB/Swiss-Prot;Acc:Q8MLZ5])

HSP 1 Score: 215.312 bits (547), Expect = 4.581e-57
Identity = 146/491 (29.74%), Postives = 254/491 (51.73%), Query Frame = 1
Query:  445 KIIPIHHSLCFGKRFCYRIVTVGGPNEAKSIVFNSSNQTERDLCIKQIRCAXXXXXXXXXXXXNNLKISIQEAKNLTLKNKYYCEIKLDNLIYARTSVKEMKEILIWGEEFDLMSLPCIEMVSITLWRLPRSKEKHKECQIVSHFNIPIENIDQHCITEKWYSPSPVCLPHSG---SKLAHNLTFSAACDIDELPKNNTRTLNQVTDSAPLLRAKSKYSPLKVLDAKYYMEFVEFIKENGINMLREMEAGIKAKYREVLVWSMIQLSISENWVEEFLSDLILKEAQSCD-IKIILRGNSMASKSIEFFLKLECQDYLRQILHSTIKDIIHKTNDLEIDQSQLIKRNESISASAMRKRNQRLEMIVDKVLNKIFSNVDIIPRRVRSIFSRIRCSLKNFGTIDLEFTQKVVSACFFLRLVCPAIMTPHLFDLLPEYSDNVNINRSFTLVAKCVQNIANFAGIDDTKESYMQSIALHCRDYYNQMSEFINSIST 1905
            ++ P+H S+ F    C+R+          S  ++     ER   ++ +R  ++         EN++ I I EAK L  K KYYCE+ LD  +YA+TS K   + + WGE F+ M LP I+ V ++L+R   S  K K+  ++ +  I I+ +      E+WY+   V   HS    S++A  L   ++                 +  +P LR K+++  + +L  + Y   +E +  N + +  ++E  +  + +E L  S++++    N  +EFL DLI+KE +  D   ++ RGN++A+K++E F+KL   DYL   L   IK ++   +  E+D  +L     ++S S++ K    L   V+    KI +NV  +P+ +R +FS +RC L+      L  T  ++S+  FLR +CPAI++P LF+L+ EY    N  R+ TL+AK +QN+ANF+     KE +M+ +       +++M +F+  IS+
Sbjct:  222 RLHPVHPSI-FEVPNCFRLA---------STYYSCRTPLERAKWMENLRKTMNPRRDQQRRTENSMLIWILEAKGLPAKRKYYCEMTLDKTLYAKTSSKARTDNVFWGENFEFMMLPKIDEVCVSLFR--ESDSKKKKDTLIGYVTIGIDQLSSRSPVERWYT---VNTSHSDSGTSRIASALGGKSS-----------------SQESPSLRIKARWQSVHILPLRAYDNLLETLCYNYLPLCEQLEPVLNVRDKEDLATSLVRVMYKHNLAKEFLCDLIMKEVEKLDNDHLMFRGNTLATKAMESFMKLVADDYLDSTLSDFIKTVLQCEDSCEVDPQKL----GNVSNSSLEKNRALLMRYVEVAWTKILNNVHQLPKNLRDVFSALRCRLEAQNREALADT--LISSSIFLRFLCPAILSPSLFNLVSEYPSPTNA-RNLTLIAKTLQNLANFSKFGG-KEPHMEFMNEFVDREWHRMKDFLLRISS 672          
BLAST of DAB2 interacting protein b vs. Ensembl Celegans
Match: gap-2 (Ras GTPase-activating protein gap-2 [Source:UniProtKB/Swiss-Prot;Acc:Q8MLZ5])

HSP 1 Score: 215.312 bits (547), Expect = 6.143e-57
Identity = 146/491 (29.74%), Postives = 254/491 (51.73%), Query Frame = 1
Query:  445 KIIPIHHSLCFGKRFCYRIVTVGGPNEAKSIVFNSSNQTERDLCIKQIRCAXXXXXXXXXXXXNNLKISIQEAKNLTLKNKYYCEIKLDNLIYARTSVKEMKEILIWGEEFDLMSLPCIEMVSITLWRLPRSKEKHKECQIVSHFNIPIENIDQHCITEKWYSPSPVCLPHSG---SKLAHNLTFSAACDIDELPKNNTRTLNQVTDSAPLLRAKSKYSPLKVLDAKYYMEFVEFIKENGINMLREMEAGIKAKYREVLVWSMIQLSISENWVEEFLSDLILKEAQSCD-IKIILRGNSMASKSIEFFLKLECQDYLRQILHSTIKDIIHKTNDLEIDQSQLIKRNESISASAMRKRNQRLEMIVDKVLNKIFSNVDIIPRRVRSIFSRIRCSLKNFGTIDLEFTQKVVSACFFLRLVCPAIMTPHLFDLLPEYSDNVNINRSFTLVAKCVQNIANFAGIDDTKESYMQSIALHCRDYYNQMSEFINSIST 1905
            ++ P+H S+ F    C+R+          S  ++     ER   ++ +R  ++         EN++ I I EAK L  K KYYCE+ LD  +YA+TS K   + + WGE F+ M LP I+ V ++L+R   S  K K+  ++ +  I I+ +      E+WY+   V   HS    S++A  L   ++                 +  +P LR K+++  + +L  + Y   +E +  N + +  ++E  +  + +E L  S++++    N  +EFL DLI+KE +  D   ++ RGN++A+K++E F+KL   DYL   L   IK ++   +  E+D  +L     ++S S++ K    L   V+    KI +NV  +P+ +R +FS +RC L+      L  T  ++S+  FLR +CPAI++P LF+L+ EY    N  R+ TL+AK +QN+ANF+     KE +M+ +       +++M +F+  IS+
Sbjct:  271 RLHPVHPSI-FEVPNCFRLA---------STYYSCRTPLERAKWMENLRKTMNPRRDQQRRTENSMLIWILEAKGLPAKRKYYCEMTLDKTLYAKTSSKARTDNVFWGENFEFMMLPKIDEVCVSLFR--ESDSKKKKDTLIGYVTIGIDQLSSRSPVERWYT---VNTSHSDSGTSRIASALGGKSS-----------------SQESPSLRIKARWQSVHILPLRAYDNLLETLCYNYLPLCEQLEPVLNVRDKEDLATSLVRVMYKHNLAKEFLCDLIMKEVEKLDNDHLMFRGNTLATKAMESFMKLVADDYLDSTLSDFIKTVLQCEDSCEVDPQKL----GNVSNSSLEKNRALLMRYVEVAWTKILNNVHQLPKNLRDVFSALRCRLEAQNREALADT--LISSSIFLRFLCPAILSPSLFNLVSEYPSPTNA-RNLTLIAKTLQNLANFSKFGG-KEPHMEFMNEFVDREWHRMKDFLLRISS 721          
BLAST of DAB2 interacting protein b vs. Ensembl Fly
Match: raskol (gene:FBgn0261570 transcript:FBtr0302834)

HSP 1 Score: 232.261 bits (591), Expect = 6.941e-62
Identity = 144/499 (28.86%), Postives = 252/499 (50.50%), Query Frame = 1
Query:  448 IIPIHHSLCFGKRFCYRIVTVGGPNEAKSIVFNSSNQTERDLCIKQIRCAXXXXXXXXXXXXNNLKISIQEAKNLTLKNKYYCEIKLDNLIYARTSVKEMKEILIWGEEFDLMSLPCIEMVSITLWRLPRSKEKHKECQIVSHFNIPIENIDQHCITEKWYSPSPVCLPHSGSKLAHNLTFSAACDIDELPKNNTRTLNQVTDSAPLLRAKSKYSPLKVLDAKYYMEFVEFIKENGINMLREMEAGIKAKYREVLVWSMIQLSISENWVEEFLSDLI-LKEAQSCDIKIILRGNSMASKSIEFFLKLECQDYLRQILHSTIKDIIHKTNDLEIDQSQLIKRNESISASAMRKRNQRLEMIVDKVLNKIFSNVDIIPRRVRSIFSRIRCSLKNFGTIDLEFTQKVVSACFFLRLVCPAIMTPHLFDLLPEYSDNVNINRSFTLVAKCVQNIANFAGIDDTKESYMQSIALHCRDYYNQMSEFINSISTINEATFTTKVYD 1941
            + P+H S+  G+R C+++   GGP   +   ++  ++ ERDL I  +R +I+ +       +N+LK+ + EAKNL  K +Y+CE++LD  +Y RTSVK   ++L WGE FD   +P I ++++ ++R    K+K  + Q V    IP+ ++      E+WY   P+    +G  L        +   D+             +  P LR K ++    +L    Y  F+ ++KEN   +   +E  I  K +E +  +++ L  ++     FL+D++ L   +  D ++  RGNS+A+KS+E FLKL  + YL+  L + I ++I    D E+D +    +    SA +++++   L   V      IF +    P ++R+ F+  R  L+  G  D+     ++SA  FLR +CPAI++P LF++  E   +    R+ TLVAK +Q +ANF      KE++M+ +         +M +F+  IST  E      + D
Sbjct:  221 VAPVHQSV-LGRRHCFQVR--GGPRGER--YYSCGSRQERDLWIYSLRKSIAPNAEHTRRTDNSLKMWVYEAKNLPPKKRYFCELQLDKTLYGRTSVKLQTDLLFWGEHFDFPDIPEINVITVNVFREVDKKKKRDKYQFVGSVKIPVHDVTSRLPCEQWY---PILSDKAGDSLGRTSGGGGSGSKDK-------------EQLPTLRIKCRFQSTDILPINVYGNFLTYLKENYKRVCETLEPVIGVKAKEDIGQALVLLMHAQGLAGAFLTDVVALDLLRVGDQRLTFRGNSLATKSMEAFLKLTGEQYLQDTLSAPINELIQSERDCEVDPT----KTSGSSAGSLQRQQAALRGAVRGAWQCIFESHKHFPAQLRNCFATFRERLQQLGRQDM--ADNLISASIFLRFLCPAILSPSLFNITSELP-SARATRNLTLVAKTLQTLANFTRFQG-KENFMEFLNDFLEQEAARMQQFLEIISTRPEHPAPDSILD 690          
BLAST of DAB2 interacting protein b vs. Ensembl Fly
Match: raskol (gene:FBgn0261570 transcript:FBtr0340630)

HSP 1 Score: 232.261 bits (591), Expect = 7.056e-62
Identity = 144/499 (28.86%), Postives = 252/499 (50.50%), Query Frame = 1
Query:  448 IIPIHHSLCFGKRFCYRIVTVGGPNEAKSIVFNSSNQTERDLCIKQIRCAXXXXXXXXXXXXNNLKISIQEAKNLTLKNKYYCEIKLDNLIYARTSVKEMKEILIWGEEFDLMSLPCIEMVSITLWRLPRSKEKHKECQIVSHFNIPIENIDQHCITEKWYSPSPVCLPHSGSKLAHNLTFSAACDIDELPKNNTRTLNQVTDSAPLLRAKSKYSPLKVLDAKYYMEFVEFIKENGINMLREMEAGIKAKYREVLVWSMIQLSISENWVEEFLSDLI-LKEAQSCDIKIILRGNSMASKSIEFFLKLECQDYLRQILHSTIKDIIHKTNDLEIDQSQLIKRNESISASAMRKRNQRLEMIVDKVLNKIFSNVDIIPRRVRSIFSRIRCSLKNFGTIDLEFTQKVVSACFFLRLVCPAIMTPHLFDLLPEYSDNVNINRSFTLVAKCVQNIANFAGIDDTKESYMQSIALHCRDYYNQMSEFINSISTINEATFTTKVYD 1941
            + P+H S+  G+R C+++   GGP   +   ++  ++ ERDL I  +R +I+ +       +N+LK+ + EAKNL  K +Y+CE++LD  +Y RTSVK   ++L WGE FD   +P I ++++ ++R    K+K  + Q V    IP+ ++      E+WY   P+    +G  L        +   D+             +  P LR K ++    +L    Y  F+ ++KEN   +   +E  I  K +E +  +++ L  ++     FL+D++ L   +  D ++  RGNS+A+KS+E FLKL  + YL+  L + I ++I    D E+D +    +    SA +++++   L   V      IF +    P ++R+ F+  R  L+  G  D+     ++SA  FLR +CPAI++P LF++  E   +    R+ TLVAK +Q +ANF      KE++M+ +         +M +F+  IST  E      + D
Sbjct:  230 VAPVHQSV-LGRRHCFQVR--GGPRGER--YYSCGSRQERDLWIYSLRKSIAPNAEHTRRTDNSLKMWVYEAKNLPPKKRYFCELQLDKTLYGRTSVKLQTDLLFWGEHFDFPDIPEINVITVNVFREVDKKKKRDKYQFVGSVKIPVHDVTSRLPCEQWY---PILSDKAGDSLGRTSGGGGSGSKDK-------------EQLPTLRIKCRFQSTDILPINVYGNFLTYLKENYKRVCETLEPVIGVKAKEDIGQALVLLMHAQGLAGAFLTDVVALDLLRVGDQRLTFRGNSLATKSMEAFLKLTGEQYLQDTLSAPINELIQSERDCEVDPT----KTSGSSAGSLQRQQAALRGAVRGAWQCIFESHKHFPAQLRNCFATFRERLQQLGRQDM--ADNLISASIFLRFLCPAILSPSLFNITSELP-SARATRNLTLVAKTLQTLANFTRFQG-KENFMEFLNDFLEQEAARMQQFLEIISTRPEHPAPDSILD 699          
BLAST of DAB2 interacting protein b vs. Ensembl Fly
Match: raskol (gene:FBgn0261570 transcript:FBtr0340631)

HSP 1 Score: 231.876 bits (590), Expect = 7.561e-62
Identity = 144/499 (28.86%), Postives = 252/499 (50.50%), Query Frame = 1
Query:  448 IIPIHHSLCFGKRFCYRIVTVGGPNEAKSIVFNSSNQTERDLCIKQIRCAXXXXXXXXXXXXNNLKISIQEAKNLTLKNKYYCEIKLDNLIYARTSVKEMKEILIWGEEFDLMSLPCIEMVSITLWRLPRSKEKHKECQIVSHFNIPIENIDQHCITEKWYSPSPVCLPHSGSKLAHNLTFSAACDIDELPKNNTRTLNQVTDSAPLLRAKSKYSPLKVLDAKYYMEFVEFIKENGINMLREMEAGIKAKYREVLVWSMIQLSISENWVEEFLSDLI-LKEAQSCDIKIILRGNSMASKSIEFFLKLECQDYLRQILHSTIKDIIHKTNDLEIDQSQLIKRNESISASAMRKRNQRLEMIVDKVLNKIFSNVDIIPRRVRSIFSRIRCSLKNFGTIDLEFTQKVVSACFFLRLVCPAIMTPHLFDLLPEYSDNVNINRSFTLVAKCVQNIANFAGIDDTKESYMQSIALHCRDYYNQMSEFINSISTINEATFTTKVYD 1941
            + P+H S+  G+R C+++   GGP   +   ++  ++ ERDL I  +R +I+ +       +N+LK+ + EAKNL  K +Y+CE++LD  +Y RTSVK   ++L WGE FD   +P I ++++ ++R    K+K  + Q V    IP+ ++      E+WY   P+    +G  L        +   D+             +  P LR K ++    +L    Y  F+ ++KEN   +   +E  I  K +E +  +++ L  ++     FL+D++ L   +  D ++  RGNS+A+KS+E FLKL  + YL+  L + I ++I    D E+D +    +    SA +++++   L   V      IF +    P ++R+ F+  R  L+  G  D+     ++SA  FLR +CPAI++P LF++  E   +    R+ TLVAK +Q +ANF      KE++M+ +         +M +F+  IST  E      + D
Sbjct:  221 VAPVHQSV-LGRRHCFQVR--GGPRGER--YYSCGSRQERDLWIYSLRKSIAPNAEHTRRTDNSLKMWVYEAKNLPPKKRYFCELQLDKTLYGRTSVKLQTDLLFWGEHFDFPDIPEINVITVNVFREVDKKKKRDKYQFVGSVKIPVHDVTSRLPCEQWY---PILSDKAGDSLGRTSGGGGSGSKDK-------------EQLPTLRIKCRFQSTDILPINVYGNFLTYLKENYKRVCETLEPVIGVKAKEDIGQALVLLMHAQGLAGAFLTDVVALDLLRVGDQRLTFRGNSLATKSMEAFLKLTGEQYLQDTLSAPINELIQSERDCEVDPT----KTSGSSAGSLQRQQAALRGAVRGAWQCIFESHKHFPAQLRNCFATFRERLQQLGRQDM--ADNLISASIFLRFLCPAILSPSLFNITSELP-SARATRNLTLVAKTLQTLANFTRFQG-KENFMEFLNDFLEQEAARMQQFLEIISTRPEHPAPDSILD 690          
BLAST of DAB2 interacting protein b vs. Ensembl Fly
Match: raskol (gene:FBgn0261570 transcript:FBtr0302835)

HSP 1 Score: 231.876 bits (590), Expect = 8.990e-62
Identity = 144/499 (28.86%), Postives = 252/499 (50.50%), Query Frame = 1
Query:  448 IIPIHHSLCFGKRFCYRIVTVGGPNEAKSIVFNSSNQTERDLCIKQIRCAXXXXXXXXXXXXNNLKISIQEAKNLTLKNKYYCEIKLDNLIYARTSVKEMKEILIWGEEFDLMSLPCIEMVSITLWRLPRSKEKHKECQIVSHFNIPIENIDQHCITEKWYSPSPVCLPHSGSKLAHNLTFSAACDIDELPKNNTRTLNQVTDSAPLLRAKSKYSPLKVLDAKYYMEFVEFIKENGINMLREMEAGIKAKYREVLVWSMIQLSISENWVEEFLSDLI-LKEAQSCDIKIILRGNSMASKSIEFFLKLECQDYLRQILHSTIKDIIHKTNDLEIDQSQLIKRNESISASAMRKRNQRLEMIVDKVLNKIFSNVDIIPRRVRSIFSRIRCSLKNFGTIDLEFTQKVVSACFFLRLVCPAIMTPHLFDLLPEYSDNVNINRSFTLVAKCVQNIANFAGIDDTKESYMQSIALHCRDYYNQMSEFINSISTINEATFTTKVYD 1941
            + P+H S+  G+R C+++   GGP   +   ++  ++ ERDL I  +R +I+ +       +N+LK+ + EAKNL  K +Y+CE++LD  +Y RTSVK   ++L WGE FD   +P I ++++ ++R    K+K  + Q V    IP+ ++      E+WY   P+    +G  L        +   D+             +  P LR K ++    +L    Y  F+ ++KEN   +   +E  I  K +E +  +++ L  ++     FL+D++ L   +  D ++  RGNS+A+KS+E FLKL  + YL+  L + I ++I    D E+D +    +    SA +++++   L   V      IF +    P ++R+ F+  R  L+  G  D+     ++SA  FLR +CPAI++P LF++  E   +    R+ TLVAK +Q +ANF      KE++M+ +         +M +F+  IST  E      + D
Sbjct:  245 VAPVHQSV-LGRRHCFQVR--GGPRGER--YYSCGSRQERDLWIYSLRKSIAPNAEHTRRTDNSLKMWVYEAKNLPPKKRYFCELQLDKTLYGRTSVKLQTDLLFWGEHFDFPDIPEINVITVNVFREVDKKKKRDKYQFVGSVKIPVHDVTSRLPCEQWY---PILSDKAGDSLGRTSGGGGSGSKDK-------------EQLPTLRIKCRFQSTDILPINVYGNFLTYLKENYKRVCETLEPVIGVKAKEDIGQALVLLMHAQGLAGAFLTDVVALDLLRVGDQRLTFRGNSLATKSMEAFLKLTGEQYLQDTLSAPINELIQSERDCEVDPT----KTSGSSAGSLQRQQAALRGAVRGAWQCIFESHKHFPAQLRNCFATFRERLQQLGRQDM--ADNLISASIFLRFLCPAILSPSLFNITSELP-SARATRNLTLVAKTLQTLANFTRFQG-KENFMEFLNDFLEQEAARMQQFLEIISTRPEHPAPDSILD 714          
BLAST of DAB2 interacting protein b vs. Ensembl Fly
Match: raskol (gene:FBgn0261570 transcript:FBtr0340629)

HSP 1 Score: 231.876 bits (590), Expect = 9.143e-62
Identity = 144/499 (28.86%), Postives = 252/499 (50.50%), Query Frame = 1
Query:  448 IIPIHHSLCFGKRFCYRIVTVGGPNEAKSIVFNSSNQTERDLCIKQIRCAXXXXXXXXXXXXNNLKISIQEAKNLTLKNKYYCEIKLDNLIYARTSVKEMKEILIWGEEFDLMSLPCIEMVSITLWRLPRSKEKHKECQIVSHFNIPIENIDQHCITEKWYSPSPVCLPHSGSKLAHNLTFSAACDIDELPKNNTRTLNQVTDSAPLLRAKSKYSPLKVLDAKYYMEFVEFIKENGINMLREMEAGIKAKYREVLVWSMIQLSISENWVEEFLSDLI-LKEAQSCDIKIILRGNSMASKSIEFFLKLECQDYLRQILHSTIKDIIHKTNDLEIDQSQLIKRNESISASAMRKRNQRLEMIVDKVLNKIFSNVDIIPRRVRSIFSRIRCSLKNFGTIDLEFTQKVVSACFFLRLVCPAIMTPHLFDLLPEYSDNVNINRSFTLVAKCVQNIANFAGIDDTKESYMQSIALHCRDYYNQMSEFINSISTINEATFTTKVYD 1941
            + P+H S+  G+R C+++   GGP   +   ++  ++ ERDL I  +R +I+ +       +N+LK+ + EAKNL  K +Y+CE++LD  +Y RTSVK   ++L WGE FD   +P I ++++ ++R    K+K  + Q V    IP+ ++      E+WY   P+    +G  L        +   D+             +  P LR K ++    +L    Y  F+ ++KEN   +   +E  I  K +E +  +++ L  ++     FL+D++ L   +  D ++  RGNS+A+KS+E FLKL  + YL+  L + I ++I    D E+D +    +    SA +++++   L   V      IF +    P ++R+ F+  R  L+  G  D+     ++SA  FLR +CPAI++P LF++  E   +    R+ TLVAK +Q +ANF      KE++M+ +         +M +F+  IST  E      + D
Sbjct:  248 VAPVHQSV-LGRRHCFQVR--GGPRGER--YYSCGSRQERDLWIYSLRKSIAPNAEHTRRTDNSLKMWVYEAKNLPPKKRYFCELQLDKTLYGRTSVKLQTDLLFWGEHFDFPDIPEINVITVNVFREVDKKKKRDKYQFVGSVKIPVHDVTSRLPCEQWY---PILSDKAGDSLGRTSGGGGSGSKDK-------------EQLPTLRIKCRFQSTDILPINVYGNFLTYLKENYKRVCETLEPVIGVKAKEDIGQALVLLMHAQGLAGAFLTDVVALDLLRVGDQRLTFRGNSLATKSMEAFLKLTGEQYLQDTLSAPINELIQSERDCEVDPT----KTSGSSAGSLQRQQAALRGAVRGAWQCIFESHKHFPAQLRNCFATFRERLQQLGRQDM--ADNLISASIFLRFLCPAILSPSLFNITSELP-SARATRNLTLVAKTLQTLANFTRFQG-KENFMEFLNDFLEQEAARMQQFLEIISTRPEHPAPDSILD 717          
BLAST of DAB2 interacting protein b vs. Ensembl Zebrafish
Match: dab2ipa (DAB2 interacting protein a [Source:ZFIN;Acc:ZDB-GENE-081104-516])

HSP 1 Score: 226.483 bits (576), Expect = 2.845e-60
Identity = 148/487 (30.39%), Postives = 246/487 (50.51%), Query Frame = 1
Query:  448 IIPIHHSLCFGKRFCYRIVTVGGPNEAKSIVFNSSNQTERDLCIKQIRCAXXXXXXXXXXXXNNLKISIQEAKNLTLKNKYYCEIKLDNLIYARTSVKEMKEILIWGEEFDLMSLPCIEMVSITLWRLPRSKEKHKECQIVSHFNIPIENIDQHCITEKWYSPSPVCLPHSGSKLAHNLTFSAACDIDELPKNNTRTLNQVTDSAPLLRAKSKYSPLKVLDAKYYMEFVEFIKENGINMLREMEAGIKAKYREVLVWSMIQLSISENWVEEFLSDLILKEAQSC--DIKIILRGNSMASKSIEFFLKLECQDYLRQILHSTIKDIIHKTNDLEIDQSQLIKRNESISASAMRKRNQRLEMIVDKVLNKIFSNVDIIPRRVRSIFSRIRCSLKNFGTIDLEFTQKVVSACFFLRLVCPAIMTPHLFDLLPEYSDNVNINRSFTLVAKCVQNIANFAGIDDTKESYMQSIALHCRDYYNQMSEFINSIS 1902
            I P+H S+  G+ FC+ + T  G     S  F+  +  ERD  ++ +R A+  +  +    EN LK  I EAK+L  K KY+CE+ LD+ +YART+ K   + + WGE F+  +LP ++ +++ L++    K+K  +   V   NIPI  +      EKWYS   V  P+                            N+     P++R KS+Y  + +L  + Y EF E+I  N + M   +E  +  K +E +  +++ +  S    ++FL+DL++ E   C  +  +I R N++A+K+IE +LKL  Q YL+  L   IK +     + E+D S+        S+S + +    L+M  +    KI ++  + PR ++ +F+  R    + G  D+  +++++SA  FLR +CPAIM+P LF L+ EY D+    R+ TL+AK  QN+ANF     +KE YM  +       +  M  F+  IS
Sbjct:  101 IKPVHSSI-LGQDFCFEVTTSTG-----SKCFSCRSAAERDKWMENLRRAVHPNKDNTRRVENMLKCWIIEAKDLPAKKKYFCELCLDDTLYARTTCKLKTDNVFWGEHFEFNNLPSVKSITVHLYKETDKKKKKDKNNYVGLVNIPIATVTGRQFVEKWYS---VSTPNP---------------------------NKGKSPGPMVRMKSRYQSMSILPMELYKEFAEYITNNYMLMCSVLEPALSVKNKEEMACALVHILQSTGKAKDFLTDLMMSEVDRCGDNEHLIFRENTLATKAIEEYLKLVGQKYLQDALGEFIKALYESDENCEVDPSK-------CSSSDLHEHQSNLKMCCELAFCKIINSYCVFPRELKEVFASWRQECSSRGRPDI--SERLISASLFLRFLCPAIMSPSLFSLMQEYPDD-RTARTLTLIAKVTQNLANFTKF-GSKEEYMSFMNQFLEHEWTNMQRFLLEIS 540          
BLAST of DAB2 interacting protein b vs. Ensembl Zebrafish
Match: dab2ipa (DAB2 interacting protein a [Source:ZFIN;Acc:ZDB-GENE-081104-516])

HSP 1 Score: 226.098 bits (575), Expect = 3.666e-60
Identity = 148/487 (30.39%), Postives = 246/487 (50.51%), Query Frame = 1
Query:  448 IIPIHHSLCFGKRFCYRIVTVGGPNEAKSIVFNSSNQTERDLCIKQIRCAXXXXXXXXXXXXNNLKISIQEAKNLTLKNKYYCEIKLDNLIYARTSVKEMKEILIWGEEFDLMSLPCIEMVSITLWRLPRSKEKHKECQIVSHFNIPIENIDQHCITEKWYSPSPVCLPHSGSKLAHNLTFSAACDIDELPKNNTRTLNQVTDSAPLLRAKSKYSPLKVLDAKYYMEFVEFIKENGINMLREMEAGIKAKYREVLVWSMIQLSISENWVEEFLSDLILKEAQSC--DIKIILRGNSMASKSIEFFLKLECQDYLRQILHSTIKDIIHKTNDLEIDQSQLIKRNESISASAMRKRNQRLEMIVDKVLNKIFSNVDIIPRRVRSIFSRIRCSLKNFGTIDLEFTQKVVSACFFLRLVCPAIMTPHLFDLLPEYSDNVNINRSFTLVAKCVQNIANFAGIDDTKESYMQSIALHCRDYYNQMSEFINSIS 1902
            I P+H S+  G+ FC+ + T  G     S  F+  +  ERD  ++ +R A+  +  +    EN LK  I EAK+L  K KY+CE+ LD+ +YART+ K   + + WGE F+  +LP ++ +++ L++    K+K  +   V   NIPI  +      EKWYS   V  P+                            N+     P++R KS+Y  + +L  + Y EF E+I  N + M   +E  +  K +E +  +++ +  S    ++FL+DL++ E   C  +  +I R N++A+K+IE +LKL  Q YL+  L   IK +     + E+D S+        S+S + +    L+M  +    KI ++  + PR ++ +F+  R    + G  D+  +++++SA  FLR +CPAIM+P LF L+ EY D+    R+ TL+AK  QN+ANF     +KE YM  +       +  M  F+  IS
Sbjct:  113 IKPVHSSI-LGQDFCFEVTTSTG-----SKCFSCRSAAERDKWMENLRRAVHPNKDNTRRVENMLKCWIIEAKDLPAKKKYFCELCLDDTLYARTTCKLKTDNVFWGEHFEFNNLPSVKSITVHLYKETDKKKKKDKNNYVGLVNIPIATVTGRQFVEKWYS---VSTPNP---------------------------NKGKSPGPMVRMKSRYQSMSILPMELYKEFAEYITNNYMLMCSVLEPALSVKNKEEMACALVHILQSTGKAKDFLTDLMMSEVDRCGDNEHLIFRENTLATKAIEEYLKLVGQKYLQDALGEFIKALYESDENCEVDPSK-------CSSSDLHEHQSNLKMCCELAFCKIINSYCVFPRELKEVFASWRQECSSRGRPDI--SERLISASLFLRFLCPAIMSPSLFSLMQEYPDD-RTARTLTLIAKVTQNLANFTKF-GSKEEYMSFMNQFLEHEWTNMQRFLLEIS 552          
BLAST of DAB2 interacting protein b vs. Ensembl Zebrafish
Match: rasal2 (RAS protein activator like 2 [Source:ZFIN;Acc:ZDB-GENE-070912-180])

HSP 1 Score: 226.483 bits (576), Expect = 5.165e-60
Identity = 147/490 (30.00%), Postives = 250/490 (51.02%), Query Frame = 1
Query:  448 IIPIHHSLCFGKRFCYRIVTVGGPNEAKSIVFNSSNQTERDLCIKQIRCAXXXXXXXXXXXXNNLKISIQEAKNLTLKNKYYCEIKLDNLIYARTSVKEMKEILIWGEEFDLMSLPCIEMVSITLWRLPRSKEKHKECQIVSHFNIPIENIDQHCITEKWYSPSPVCLPHSGSKLAHNLTFSAACDIDELPKNNTRTLNQVTDSAPLLRAKSKYSPLKVLDAKYYMEFVEFIKENGINMLREMEAGIKAKYREVLVWSMIQLSISENWVEEFLSDLILKEAQSC---DIKIILRGNSMASKSIEFFLKLECQDYLRQILHSTIKDIIHKTNDLEIDQSQLIKRNESISASAMRKRNQRLEMIVDKVLNKIFSNVDIIPRRVRSIFSRIRCSLKNFGTIDLEFTQKVVSACFFLRLVCPAIMTPHLFDLLPEYSDNVNINRSFTLVAKCVQNIANFAGIDDTKESYMQSIALHCRDYYNQMSEFINSISTI 1908
            I P+H S+  G+ FC+ +   GG     S  F+ S+  ERD  ++ ++  +  +  +    EN L++ I EAK+L  K KY+CE+ LD+++YART+ K   + L WGE F+   LP ++ ++I ++R    K+K  +   V   NIP+  +      EKWY   PV  P                           T ++     P +R KS++  + +L  + Y EF EF+  N   +   +E  I  K +E +  +++ +  S    ++FL+DL++ E   C   D+ +I R N++A+K+IE +LKL  Q YL   L   IK +     + E+DQS+        +++ + +    L+M  +    KI ++  + PR ++ +F+  +      G  D+  +Q+++SA  FLR +CPAIM+P LF L+ EY D+   +R+ TL+AK +QN+ANFA   + KE YM  +       +  M+ F+  IS +
Sbjct:  284 IKPLHSSI-LGQDFCFEVAYSGG-----SKCFSCSSAAERDKWMENLKRTVQPNKDNCRRAENVLRLWIIEAKDLPPKKKYFCELCLDDMLYARTTSKTRSDCLFWGEHFEFSGLPSMKSITIHIYRDVDKKKKKDKNNYVGLVNIPVHGVMGRQFVEKWY---PVSTP---------------------------TTSKAKGGGPSIRIKSRFQTISILPMEQYKEFAEFVTNNYTMLCSVLEPVISVKNKEEMASALVHILQSTGRAKDFLTDLVMSEVDRCADHDV-LIFRENTLATKAIEEYLKLVGQKYLHDALGEFIKALYESDENCEVDQSK-------CTSNELPEHQSNLKMCCELAFCKIINSYCVFPRELKEVFASWKQQCHARGKQDI--SQRLISASLFLRFLCPAIMSPSLFGLMQEYPDD-RTSRTLTLIAKVIQNLANFAKFGN-KEEYMAFMNDFLEHEWAGMTRFLLEISNL 725          
BLAST of DAB2 interacting protein b vs. Ensembl Zebrafish
Match: rasal2 (RAS protein activator like 2 [Source:ZFIN;Acc:ZDB-GENE-070912-180])

HSP 1 Score: 226.098 bits (575), Expect = 5.482e-60
Identity = 147/490 (30.00%), Postives = 250/490 (51.02%), Query Frame = 1
Query:  448 IIPIHHSLCFGKRFCYRIVTVGGPNEAKSIVFNSSNQTERDLCIKQIRCAXXXXXXXXXXXXNNLKISIQEAKNLTLKNKYYCEIKLDNLIYARTSVKEMKEILIWGEEFDLMSLPCIEMVSITLWRLPRSKEKHKECQIVSHFNIPIENIDQHCITEKWYSPSPVCLPHSGSKLAHNLTFSAACDIDELPKNNTRTLNQVTDSAPLLRAKSKYSPLKVLDAKYYMEFVEFIKENGINMLREMEAGIKAKYREVLVWSMIQLSISENWVEEFLSDLILKEAQSC---DIKIILRGNSMASKSIEFFLKLECQDYLRQILHSTIKDIIHKTNDLEIDQSQLIKRNESISASAMRKRNQRLEMIVDKVLNKIFSNVDIIPRRVRSIFSRIRCSLKNFGTIDLEFTQKVVSACFFLRLVCPAIMTPHLFDLLPEYSDNVNINRSFTLVAKCVQNIANFAGIDDTKESYMQSIALHCRDYYNQMSEFINSISTI 1908
            I P+H S+  G+ FC+ +   GG     S  F+ S+  ERD  ++ ++  +  +  +    EN L++ I EAK+L  K KY+CE+ LD+++YART+ K   + L WGE F+   LP ++ ++I ++R    K+K  +   V   NIP+  +      EKWY   PV  P                           T ++     P +R KS++  + +L  + Y EF EF+  N   +   +E  I  K +E +  +++ +  S    ++FL+DL++ E   C   D+ +I R N++A+K+IE +LKL  Q YL   L   IK +     + E+DQS+        +++ + +    L+M  +    KI ++  + PR ++ +F+  +      G  D+  +Q+++SA  FLR +CPAIM+P LF L+ EY D+   +R+ TL+AK +QN+ANFA   + KE YM  +       +  M+ F+  IS +
Sbjct:  284 IKPLHSSI-LGQDFCFEVAYSGG-----SKCFSCSSAAERDKWMENLKRTVQPNKDNCRRAENVLRLWIIEAKDLPPKKKYFCELCLDDMLYARTTSKTRSDCLFWGEHFEFSGLPSMKSITIHIYRDVDKKKKKDKNNYVGLVNIPVHGVMGRQFVEKWY---PVSTP---------------------------TTSKAKGGGPSIRIKSRFQTISILPMEQYKEFAEFVTNNYTMLCSVLEPVISVKNKEEMASALVHILQSTGRAKDFLTDLVMSEVDRCADHDV-LIFRENTLATKAIEEYLKLVGQKYLHDALGEFIKALYESDENCEVDQSK-------CTSNELPEHQSNLKMCCELAFCKIINSYCVFPRELKEVFASWKQQCHARGKQDI--SQRLISASLFLRFLCPAIMSPSLFGLMQEYPDD-RTSRTLTLIAKVIQNLANFAKFGN-KEEYMAFMNDFLEHEWAGMTRFLLEISNL 725          
BLAST of DAB2 interacting protein b vs. Ensembl Zebrafish
Match: dab2ipb (DAB2 interacting protein b [Source:ZFIN;Acc:ZDB-GENE-030131-2449])

HSP 1 Score: 220.705 bits (561), Expect = 1.600e-58
Identity = 146/503 (29.03%), Postives = 253/503 (50.30%), Query Frame = 1
Query:  406 TKKMEAVNFISVSKII--PIHHSLCFGKRFCYRIVTVGGPNEAKSIVFNSSNQTERDLCIKQIRCAXXXXXXXXXXXXNNLKISIQEAKNLTLKNKYYCEIKLDNLIYARTSVKEMKEILIWGEEFDLMSLPCIEMVSITLWRLPRSKEKHKECQIVSHFNIPIENIDQHCITEKWYSPSPVCLPHSGSKLAHNLTFSAACDIDELPKNNTRTLNQVTDSAPLLRAKSKYSPLKVLDAKYYMEFVEFIKENGINMLREMEAGIKAKYREVLVWSMIQLSISENWVEEFLSDLILKEAQSC--DIKIILRGNSMASKSIEFFLKLECQDYLRQILHSTIKDIIHKTNDLEIDQSQLIKRNESISASAMRKRNQRLEMIVDKVLNKIFSNVDIIPRRVRSIFSRIRCSLKNFGTIDLEFTQKVVSACFFLRLVCPAIMTPHLFDLLPEYSDNVNINRSFTLVAKCVQNIANFAGIDDTKESYMQSIALHCRDYYNQMSEFINSIS 1902
            T  +EA++     +++  P+H S+  G+ +C+ + T  G     S  F+  +  ERD  ++ +R AI  +  +    EN L++ I EAK+L  K KY+CE+ LD+ +YART+ K   + + WGE F+  +LP ++ +++ ++R    K+K  +   V   +IP+  +    + EKWY   PV  P+ G   A                           + P++R K++Y  + +L  + Y EF E+   N + +   +E  I  K +E +  +++ +  S    ++FL+DL++ E   C  +  +I R N++ +K+IE +LKL  Q YL+  L   IK +     + E+D S+        S+S + +    L M  +    KI  +  + PR ++ +F+  R    N G  D+  +++++SA  FLR +CPAIM+P LF+L  EY D+    R+ TL+AK  QN+ANF    + KE YM  +       +  M  F+  IS
Sbjct:   69 TSAVEALDLSMEEEVLIKPVHSSI-LGQDYCFEVSTSTG-----SKCFSCRSAAERDKWMENLRRAIHPNKDNSRRVENMLRLWIIEAKDLPAKKKYFCELCLDDSLYARTTCKMKTDNVFWGEHFEFNNLPAVQSITVHVYRDSDKKKKKDKNNYVGLVSIPVVTVTSRQLVEKWY---PVSQPNPGKGKA---------------------------AGPMVRIKARYQSMNILPMELYKEFAEYTTNNYMLLCSVLEPVISVKNKEEMACALVHILQSTGKAKDFLTDLMMSEVDRCGENEHLIFRENTLGTKAIEEYLKLVGQKYLQDALGEFIKALYESDENCEVDPSK-------CSSSDLPEHQSNLRMCCELAFCKIIESYRVFPRELKEVFASWRQECGNRGRPDI--SERLISASLFLRFLCPAIMSPSLFNLTQEYPDD-RTARTLTLIAKVTQNLANFTKFGN-KEEYMSFMNQFLEQEWTNMQRFLLEIS 524          
BLAST of DAB2 interacting protein b vs. Ensembl Xenopus
Match: DAB2IP (DAB2 interacting protein [Source:NCBI gene;Acc:100145038])

HSP 1 Score: 220.32 bits (560), Expect = 2.602e-58
Identity = 145/487 (29.77%), Postives = 248/487 (50.92%), Query Frame = 1
Query:  448 IIPIHHSLCFGKRFCYRIVTVGGPNEAKSIVFNSSNQTERDLCIKQIRCAXXXXXXXXXXXXNNLKISIQEAKNLTLKNKYYCEIKLDNLIYARTSVKEMKEILIWGEEFDLMSLPCIEMVSITLWRLPRSKEKHKECQIVSHFNIPIENIDQHCITEKWYSPSPVCLPHSGSKLAHNLTFSAACDIDELPKNNTRTLNQVTDSAPLLRAKSKYSPLKVLDAKYYMEFVEFIKENGINMLREMEAGIKAKYREVLVWSMIQLSISENWVEEFLSDLILKEAQSC--DIKIILRGNSMASKSIEFFLKLECQDYLRQILHSTIKDIIHKTNDLEIDQSQLIKRNESISASAMRKRNQRLEMIVDKVLNKIFSNVDIIPRRVRSIFSRIRCSLKNFGTIDLEFTQKVVSACFFLRLVCPAIMTPHLFDLLPEYSDNVNINRSFTLVAKCVQNIANFAGIDDTKESYMQSIALHCRDYYNQMSEFINSIS 1902
            I P+H S+  G+ FC+ +    G     S  F+  +  ERD  ++ +R A+  +  +    EN LK+ I EAK+L  K KY CE+ LD+++YART+ K   + + WGE F+  +LP ++ +++ L++    K+K  +   V   +IPI  +      EKWY   P+  P        N +   +C                    P++R K++Y  + +L  + Y EF E+I  N + +   +E  +  K +E +  +++ +  S    ++FL+DL++ E   C  +  +I R N++A+K+IE +LKL  Q YL+  L   IK +     + E+D ++        S S + +    L+M  +    KI ++  + PR ++ +F+  R    + G  D+  +++++SA  FLR +CPAIM+P LF+LL EY D+    R+ TL+AK  QN+ANFA    +KE YM  +       +  M  F+  IS
Sbjct:   54 IKPVHSSI-LGQDFCFEVTASTG-----SKCFSCRSAAERDKWMENLRRAVHPNKDNSRRIENMLKLWIIEAKDLPAKKKYLCELYLDDILYARTTCKLKTDNVFWGEHFEFNNLPTLKSITVHLYKETDKKKKKDKNNYVGLVSIPIGAVTGRLFVEKWY---PIVTP--------NPSKGKSC-------------------GPMIRIKTRYQSISILPMEMYKEFAEYITNNYMVLCSTLEGILSVKNKEEMASALVHILQSTGKAKDFLTDLMMSEVDRCGDNEHLIFRENTLATKAIEEYLKLVGQKYLQDALGEFIKALYESDENCEVDPNK-------CSTSDLPEHQSNLKMCCELAFCKIINSYCVFPRELKEVFASWRQECNSRGRPDI--SERLISASLFLRFLCPAIMSPSLFNLLQEYPDD-RTARTLTLIAKVTQNLANFAKF-GSKEEYMSFMNQFLEHEWTNMQRFLLEIS 493          
BLAST of DAB2 interacting protein b vs. Ensembl Xenopus
Match: DAB2IP (DAB2 interacting protein [Source:NCBI gene;Acc:100145038])

HSP 1 Score: 219.935 bits (559), Expect = 3.003e-58
Identity = 145/487 (29.77%), Postives = 248/487 (50.92%), Query Frame = 1
Query:  448 IIPIHHSLCFGKRFCYRIVTVGGPNEAKSIVFNSSNQTERDLCIKQIRCAXXXXXXXXXXXXNNLKISIQEAKNLTLKNKYYCEIKLDNLIYARTSVKEMKEILIWGEEFDLMSLPCIEMVSITLWRLPRSKEKHKECQIVSHFNIPIENIDQHCITEKWYSPSPVCLPHSGSKLAHNLTFSAACDIDELPKNNTRTLNQVTDSAPLLRAKSKYSPLKVLDAKYYMEFVEFIKENGINMLREMEAGIKAKYREVLVWSMIQLSISENWVEEFLSDLILKEAQSC--DIKIILRGNSMASKSIEFFLKLECQDYLRQILHSTIKDIIHKTNDLEIDQSQLIKRNESISASAMRKRNQRLEMIVDKVLNKIFSNVDIIPRRVRSIFSRIRCSLKNFGTIDLEFTQKVVSACFFLRLVCPAIMTPHLFDLLPEYSDNVNINRSFTLVAKCVQNIANFAGIDDTKESYMQSIALHCRDYYNQMSEFINSIS 1902
            I P+H S+  G+ FC+ +    G     S  F+  +  ERD  ++ +R A+  +  +    EN LK+ I EAK+L  K KY CE+ LD+++YART+ K   + + WGE F+  +LP ++ +++ L++    K+K  +   V   +IPI  +      EKWY   P+  P        N +   +C                    P++R K++Y  + +L  + Y EF E+I  N + +   +E  +  K +E +  +++ +  S    ++FL+DL++ E   C  +  +I R N++A+K+IE +LKL  Q YL+  L   IK +     + E+D ++        S S + +    L+M  +    KI ++  + PR ++ +F+  R    + G  D+  +++++SA  FLR +CPAIM+P LF+LL EY D+    R+ TL+AK  QN+ANFA    +KE YM  +       +  M  F+  IS
Sbjct:   33 IKPVHSSI-LGQDFCFEVTASTG-----SKCFSCRSAAERDKWMENLRRAVHPNKDNSRRIENMLKLWIIEAKDLPAKKKYLCELYLDDILYARTTCKLKTDNVFWGEHFEFNNLPTLKSITVHLYKETDKKKKKDKNNYVGLVSIPIGAVTGRLFVEKWY---PIVTP--------NPSKGKSC-------------------GPMIRIKTRYQSISILPMEMYKEFAEYITNNYMVLCSTLEGILSVKNKEEMASALVHILQSTGKAKDFLTDLMMSEVDRCGDNEHLIFRENTLATKAIEEYLKLVGQKYLQDALGEFIKALYESDENCEVDPNK-------CSTSDLPEHQSNLKMCCELAFCKIINSYCVFPRELKEVFASWRQECNSRGRPDI--SERLISASLFLRFLCPAIMSPSLFNLLQEYPDD-RTARTLTLIAKVTQNLANFAKF-GSKEEYMSFMNQFLEHEWTNMQRFLLEIS 472          
BLAST of DAB2 interacting protein b vs. Ensembl Xenopus
Match: DAB2IP (DAB2 interacting protein [Source:NCBI gene;Acc:100145038])

HSP 1 Score: 219.935 bits (559), Expect = 3.174e-58
Identity = 145/487 (29.77%), Postives = 248/487 (50.92%), Query Frame = 1
Query:  448 IIPIHHSLCFGKRFCYRIVTVGGPNEAKSIVFNSSNQTERDLCIKQIRCAXXXXXXXXXXXXNNLKISIQEAKNLTLKNKYYCEIKLDNLIYARTSVKEMKEILIWGEEFDLMSLPCIEMVSITLWRLPRSKEKHKECQIVSHFNIPIENIDQHCITEKWYSPSPVCLPHSGSKLAHNLTFSAACDIDELPKNNTRTLNQVTDSAPLLRAKSKYSPLKVLDAKYYMEFVEFIKENGINMLREMEAGIKAKYREVLVWSMIQLSISENWVEEFLSDLILKEAQSC--DIKIILRGNSMASKSIEFFLKLECQDYLRQILHSTIKDIIHKTNDLEIDQSQLIKRNESISASAMRKRNQRLEMIVDKVLNKIFSNVDIIPRRVRSIFSRIRCSLKNFGTIDLEFTQKVVSACFFLRLVCPAIMTPHLFDLLPEYSDNVNINRSFTLVAKCVQNIANFAGIDDTKESYMQSIALHCRDYYNQMSEFINSIS 1902
            I P+H S+  G+ FC+ +    G     S  F+  +  ERD  ++ +R A+  +  +    EN LK+ I EAK+L  K KY CE+ LD+++YART+ K   + + WGE F+  +LP ++ +++ L++    K+K  +   V   +IPI  +      EKWY   P+  P        N +   +C                    P++R K++Y  + +L  + Y EF E+I  N + +   +E  +  K +E +  +++ +  S    ++FL+DL++ E   C  +  +I R N++A+K+IE +LKL  Q YL+  L   IK +     + E+D ++        S S + +    L+M  +    KI ++  + PR ++ +F+  R    + G  D+  +++++SA  FLR +CPAIM+P LF+LL EY D+    R+ TL+AK  QN+ANFA    +KE YM  +       +  M  F+  IS
Sbjct:   50 IKPVHSSI-LGQDFCFEVTASTG-----SKCFSCRSAAERDKWMENLRRAVHPNKDNSRRIENMLKLWIIEAKDLPAKKKYLCELYLDDILYARTTCKLKTDNVFWGEHFEFNNLPTLKSITVHLYKETDKKKKKDKNNYVGLVSIPIGAVTGRLFVEKWY---PIVTP--------NPSKGKSC-------------------GPMIRIKTRYQSISILPMEMYKEFAEYITNNYMVLCSTLEGILSVKNKEEMASALVHILQSTGKAKDFLTDLMMSEVDRCGDNEHLIFRENTLATKAIEEYLKLVGQKYLQDALGEFIKALYESDENCEVDPNK-------CSTSDLPEHQSNLKMCCELAFCKIINSYCVFPRELKEVFASWRQECNSRGRPDI--SERLISASLFLRFLCPAIMSPSLFNLLQEYPDD-RTARTLTLIAKVTQNLANFAKF-GSKEEYMSFMNQFLEHEWTNMQRFLLEIS 489          
BLAST of DAB2 interacting protein b vs. Ensembl Xenopus
Match: DAB2IP (DAB2 interacting protein [Source:NCBI gene;Acc:100145038])

HSP 1 Score: 220.32 bits (560), Expect = 3.364e-58
Identity = 145/487 (29.77%), Postives = 248/487 (50.92%), Query Frame = 1
Query:  448 IIPIHHSLCFGKRFCYRIVTVGGPNEAKSIVFNSSNQTERDLCIKQIRCAXXXXXXXXXXXXNNLKISIQEAKNLTLKNKYYCEIKLDNLIYARTSVKEMKEILIWGEEFDLMSLPCIEMVSITLWRLPRSKEKHKECQIVSHFNIPIENIDQHCITEKWYSPSPVCLPHSGSKLAHNLTFSAACDIDELPKNNTRTLNQVTDSAPLLRAKSKYSPLKVLDAKYYMEFVEFIKENGINMLREMEAGIKAKYREVLVWSMIQLSISENWVEEFLSDLILKEAQSC--DIKIILRGNSMASKSIEFFLKLECQDYLRQILHSTIKDIIHKTNDLEIDQSQLIKRNESISASAMRKRNQRLEMIVDKVLNKIFSNVDIIPRRVRSIFSRIRCSLKNFGTIDLEFTQKVVSACFFLRLVCPAIMTPHLFDLLPEYSDNVNINRSFTLVAKCVQNIANFAGIDDTKESYMQSIALHCRDYYNQMSEFINSIS 1902
            I P+H S+  G+ FC+ +    G     S  F+  +  ERD  ++ +R A+  +  +    EN LK+ I EAK+L  K KY CE+ LD+++YART+ K   + + WGE F+  +LP ++ +++ L++    K+K  +   V   +IPI  +      EKWY   P+  P        N +   +C                    P++R K++Y  + +L  + Y EF E+I  N + +   +E  +  K +E +  +++ +  S    ++FL+DL++ E   C  +  +I R N++A+K+IE +LKL  Q YL+  L   IK +     + E+D ++        S S + +    L+M  +    KI ++  + PR ++ +F+  R    + G  D+  +++++SA  FLR +CPAIM+P LF+LL EY D+    R+ TL+AK  QN+ANFA    +KE YM  +       +  M  F+  IS
Sbjct:   50 IKPVHSSI-LGQDFCFEVTASTG-----SKCFSCRSAAERDKWMENLRRAVHPNKDNSRRIENMLKLWIIEAKDLPAKKKYLCELYLDDILYARTTCKLKTDNVFWGEHFEFNNLPTLKSITVHLYKETDKKKKKDKNNYVGLVSIPIGAVTGRLFVEKWY---PIVTP--------NPSKGKSC-------------------GPMIRIKTRYQSISILPMEMYKEFAEYITNNYMVLCSTLEGILSVKNKEEMASALVHILQSTGKAKDFLTDLMMSEVDRCGDNEHLIFRENTLATKAIEEYLKLVGQKYLQDALGEFIKALYESDENCEVDPNK-------CSTSDLPEHQSNLKMCCELAFCKIINSYCVFPRELKEVFASWRQECNSRGRPDI--SERLISASLFLRFLCPAIMSPSLFNLLQEYPDD-RTARTLTLIAKVTQNLANFAKF-GSKEEYMSFMNQFLEHEWTNMQRFLLEIS 489          
BLAST of DAB2 interacting protein b vs. Ensembl Xenopus
Match: DAB2IP (DAB2 interacting protein [Source:NCBI gene;Acc:100145038])

HSP 1 Score: 219.935 bits (559), Expect = 3.502e-58
Identity = 145/487 (29.77%), Postives = 248/487 (50.92%), Query Frame = 1
Query:  448 IIPIHHSLCFGKRFCYRIVTVGGPNEAKSIVFNSSNQTERDLCIKQIRCAXXXXXXXXXXXXNNLKISIQEAKNLTLKNKYYCEIKLDNLIYARTSVKEMKEILIWGEEFDLMSLPCIEMVSITLWRLPRSKEKHKECQIVSHFNIPIENIDQHCITEKWYSPSPVCLPHSGSKLAHNLTFSAACDIDELPKNNTRTLNQVTDSAPLLRAKSKYSPLKVLDAKYYMEFVEFIKENGINMLREMEAGIKAKYREVLVWSMIQLSISENWVEEFLSDLILKEAQSC--DIKIILRGNSMASKSIEFFLKLECQDYLRQILHSTIKDIIHKTNDLEIDQSQLIKRNESISASAMRKRNQRLEMIVDKVLNKIFSNVDIIPRRVRSIFSRIRCSLKNFGTIDLEFTQKVVSACFFLRLVCPAIMTPHLFDLLPEYSDNVNINRSFTLVAKCVQNIANFAGIDDTKESYMQSIALHCRDYYNQMSEFINSIS 1902
            I P+H S+  G+ FC+ +    G     S  F+  +  ERD  ++ +R A+  +  +    EN LK+ I EAK+L  K KY CE+ LD+++YART+ K   + + WGE F+  +LP ++ +++ L++    K+K  +   V   +IPI  +      EKWY   P+  P        N +   +C                    P++R K++Y  + +L  + Y EF E+I  N + +   +E  +  K +E +  +++ +  S    ++FL+DL++ E   C  +  +I R N++A+K+IE +LKL  Q YL+  L   IK +     + E+D ++        S S + +    L+M  +    KI ++  + PR ++ +F+  R    + G  D+  +++++SA  FLR +CPAIM+P LF+LL EY D+    R+ TL+AK  QN+ANFA    +KE YM  +       +  M  F+  IS
Sbjct:   47 IKPVHSSI-LGQDFCFEVTASTG-----SKCFSCRSAAERDKWMENLRRAVHPNKDNSRRIENMLKLWIIEAKDLPAKKKYLCELYLDDILYARTTCKLKTDNVFWGEHFEFNNLPTLKSITVHLYKETDKKKKKDKNNYVGLVSIPIGAVTGRLFVEKWY---PIVTP--------NPSKGKSC-------------------GPMIRIKTRYQSISILPMEMYKEFAEYITNNYMVLCSTLEGILSVKNKEEMASALVHILQSTGKAKDFLTDLMMSEVDRCGDNEHLIFRENTLATKAIEEYLKLVGQKYLQDALGEFIKALYESDENCEVDPNK-------CSTSDLPEHQSNLKMCCELAFCKIINSYCVFPRELKEVFASWRQECNSRGRPDI--SERLISASLFLRFLCPAIMSPSLFNLLQEYPDD-RTARTLTLIAKVTQNLANFAKF-GSKEEYMSFMNQFLEHEWTNMQRFLLEIS 486          
BLAST of DAB2 interacting protein b vs. Ensembl Mouse
Match: Dab2ip (disabled 2 interacting protein [Source:MGI Symbol;Acc:MGI:1916851])

HSP 1 Score: 223.016 bits (567), Expect = 2.733e-59
Identity = 144/487 (29.57%), Postives = 249/487 (51.13%), Query Frame = 1
Query:  448 IIPIHHSLCFGKRFCYRIVTVGGPNEAKSIVFNSSNQTERDLCIKQIRCAXXXXXXXXXXXXNNLKISIQEAKNLTLKNKYYCEIKLDNLIYARTSVKEMKEILIWGEEFDLMSLPCIEMVSITLWRLPRSKEKHKECQIVSHFNIPIENIDQHCITEKWYSPSPVCLPHSGSKLAHNLTFSAACDIDELPKNNTRTLNQVTDSAPLLRAKSKYSPLKVLDAKYYMEFVEFIKENGINMLREMEAGIKAKYREVLVWSMIQLSISENWVEEFLSDLILKEAQSC--DIKIILRGNSMASKSIEFFLKLECQDYLRQILHSTIKDIIHKTNDLEIDQSQLIKRNESISASAMRKRNQRLEMIVDKVLNKIFSNVDIIPRRVRSIFSRIRCSLKNFGTIDLEFTQKVVSACFFLRLVCPAIMTPHLFDLLPEYSDNVNINRSFTLVAKCVQNIANFAGIDDTKESYMQSIALHCRDYYNQMSEFINSIS 1902
            I P+H S+  G+ +C+ + T  G     S  F+  +  ERD  ++ +R A+  +  +    E+ LK+ + EAK+L  K KY CE+ LD+++YART+ K   + + WGE F+  +LP +  V++ L+R    K+K +    +   ++P  ++      EKWY   PV  P+                    PK             P++R K++Y  + +L  + Y EF E I  + + +   +E  + AK +E +  +++ +  S   V++FL+DL++ E   C  +  +I R N++A+K+IE +LKL  Q YL+  L   IK +     + E+D S+        S++ + +    L+M  +    KI ++  + PR ++ +F+  R    + G  D+  +++++SA  FLR +CPAIM+P LF+LL EY D+    R+ TL+AK  QN+ANFA    +KE YM  +       +  M  F+  IS
Sbjct:   33 IKPVHSSI-LGQDYCFEVTTSSG-----SKCFSCRSAAERDKWMENLRRAVHPNKDNSRRVEHILKLWVIEAKDLPAKKKYLCELCLDDVLYARTTSKLKTDNVFWGEHFEFHNLPPLRTVTVHLYRETDKKKKKERNSYLGLVSLPAASVAGRQFVEKWY---PVVTPN--------------------PKGGK-------GPGPMIRIKARYQTVSILPMEMYKEFAEHITNHYLGLCAALEPILSAKTKEEMASALVHILQSTGKVKDFLTDLMMSEVDRCGDNEHLIFRENTLATKAIEEYLKLVGQKYLQDALGEFIKALYESDENCEVDPSK-------CSSADLPEHQGNLKMCCELAFCKIINSYCVFPRELKEVFASWRQECSSRGRPDI--SERLISASLFLRFLCPAIMSPSLFNLLQEYPDD-RTARTLTLIAKVTQNLANFAKF-GSKEEYMSFMNQFLEHEWTNMQRFLLEIS 472          
BLAST of DAB2 interacting protein b vs. Ensembl Mouse
Match: Dab2ip (disabled 2 interacting protein [Source:MGI Symbol;Acc:MGI:1916851])

HSP 1 Score: 223.016 bits (567), Expect = 3.888e-59
Identity = 144/487 (29.57%), Postives = 249/487 (51.13%), Query Frame = 1
Query:  448 IIPIHHSLCFGKRFCYRIVTVGGPNEAKSIVFNSSNQTERDLCIKQIRCAXXXXXXXXXXXXNNLKISIQEAKNLTLKNKYYCEIKLDNLIYARTSVKEMKEILIWGEEFDLMSLPCIEMVSITLWRLPRSKEKHKECQIVSHFNIPIENIDQHCITEKWYSPSPVCLPHSGSKLAHNLTFSAACDIDELPKNNTRTLNQVTDSAPLLRAKSKYSPLKVLDAKYYMEFVEFIKENGINMLREMEAGIKAKYREVLVWSMIQLSISENWVEEFLSDLILKEAQSC--DIKIILRGNSMASKSIEFFLKLECQDYLRQILHSTIKDIIHKTNDLEIDQSQLIKRNESISASAMRKRNQRLEMIVDKVLNKIFSNVDIIPRRVRSIFSRIRCSLKNFGTIDLEFTQKVVSACFFLRLVCPAIMTPHLFDLLPEYSDNVNINRSFTLVAKCVQNIANFAGIDDTKESYMQSIALHCRDYYNQMSEFINSIS 1902
            I P+H S+  G+ +C+ + T  G     S  F+  +  ERD  ++ +R A+  +  +    E+ LK+ + EAK+L  K KY CE+ LD+++YART+ K   + + WGE F+  +LP +  V++ L+R    K+K +    +   ++P  ++      EKWY   PV  P+                    PK             P++R K++Y  + +L  + Y EF E I  + + +   +E  + AK +E +  +++ +  S   V++FL+DL++ E   C  +  +I R N++A+K+IE +LKL  Q YL+  L   IK +     + E+D S+        S++ + +    L+M  +    KI ++  + PR ++ +F+  R    + G  D+  +++++SA  FLR +CPAIM+P LF+LL EY D+    R+ TL+AK  QN+ANFA    +KE YM  +       +  M  F+  IS
Sbjct:  100 IKPVHSSI-LGQDYCFEVTTSSG-----SKCFSCRSAAERDKWMENLRRAVHPNKDNSRRVEHILKLWVIEAKDLPAKKKYLCELCLDDVLYARTTSKLKTDNVFWGEHFEFHNLPPLRTVTVHLYRETDKKKKKERNSYLGLVSLPAASVAGRQFVEKWY---PVVTPN--------------------PKGGK-------GPGPMIRIKARYQTVSILPMEMYKEFAEHITNHYLGLCAALEPILSAKTKEEMASALVHILQSTGKVKDFLTDLMMSEVDRCGDNEHLIFRENTLATKAIEEYLKLVGQKYLQDALGEFIKALYESDENCEVDPSK-------CSSADLPEHQGNLKMCCELAFCKIINSYCVFPRELKEVFASWRQECSSRGRPDI--SERLISASLFLRFLCPAIMSPSLFNLLQEYPDD-RTARTLTLIAKVTQNLANFAKF-GSKEEYMSFMNQFLEHEWTNMQRFLLEIS 539          
BLAST of DAB2 interacting protein b vs. Ensembl Mouse
Match: Dab2ip (disabled 2 interacting protein [Source:MGI Symbol;Acc:MGI:1916851])

HSP 1 Score: 222.631 bits (566), Expect = 4.905e-59
Identity = 144/487 (29.57%), Postives = 249/487 (51.13%), Query Frame = 1
Query:  448 IIPIHHSLCFGKRFCYRIVTVGGPNEAKSIVFNSSNQTERDLCIKQIRCAXXXXXXXXXXXXNNLKISIQEAKNLTLKNKYYCEIKLDNLIYARTSVKEMKEILIWGEEFDLMSLPCIEMVSITLWRLPRSKEKHKECQIVSHFNIPIENIDQHCITEKWYSPSPVCLPHSGSKLAHNLTFSAACDIDELPKNNTRTLNQVTDSAPLLRAKSKYSPLKVLDAKYYMEFVEFIKENGINMLREMEAGIKAKYREVLVWSMIQLSISENWVEEFLSDLILKEAQSC--DIKIILRGNSMASKSIEFFLKLECQDYLRQILHSTIKDIIHKTNDLEIDQSQLIKRNESISASAMRKRNQRLEMIVDKVLNKIFSNVDIIPRRVRSIFSRIRCSLKNFGTIDLEFTQKVVSACFFLRLVCPAIMTPHLFDLLPEYSDNVNINRSFTLVAKCVQNIANFAGIDDTKESYMQSIALHCRDYYNQMSEFINSIS 1902
            I P+H S+  G+ +C+ + T  G     S  F+  +  ERD  ++ +R A+  +  +    E+ LK+ + EAK+L  K KY CE+ LD+++YART+ K   + + WGE F+  +LP +  V++ L+R    K+K +    +   ++P  ++      EKWY   PV  P+                    PK             P++R K++Y  + +L  + Y EF E I  + + +   +E  + AK +E +  +++ +  S   V++FL+DL++ E   C  +  +I R N++A+K+IE +LKL  Q YL+  L   IK +     + E+D S+        S++ + +    L+M  +    KI ++  + PR ++ +F+  R    + G  D+  +++++SA  FLR +CPAIM+P LF+LL EY D+    R+ TL+AK  QN+ANFA    +KE YM  +       +  M  F+  IS
Sbjct:  129 IKPVHSSI-LGQDYCFEVTTSSG-----SKCFSCRSAAERDKWMENLRRAVHPNKDNSRRVEHILKLWVIEAKDLPAKKKYLCELCLDDVLYARTTSKLKTDNVFWGEHFEFHNLPPLRTVTVHLYRETDKKKKKERNSYLGLVSLPAASVAGRQFVEKWY---PVVTPN--------------------PKGGK-------GPGPMIRIKARYQTVSILPMEMYKEFAEHITNHYLGLCAALEPILSAKTKEEMASALVHILQSTGKVKDFLTDLMMSEVDRCGDNEHLIFRENTLATKAIEEYLKLVGQKYLQDALGEFIKALYESDENCEVDPSK-------CSSADLPEHQGNLKMCCELAFCKIINSYCVFPRELKEVFASWRQECSSRGRPDI--SERLISASLFLRFLCPAIMSPSLFNLLQEYPDD-RTARTLTLIAKVTQNLANFAKF-GSKEEYMSFMNQFLEHEWTNMQRFLLEIS 568          
BLAST of DAB2 interacting protein b vs. Ensembl Mouse
Match: Dab2ip (disabled 2 interacting protein [Source:MGI Symbol;Acc:MGI:1916851])

HSP 1 Score: 222.631 bits (566), Expect = 4.971e-59
Identity = 144/487 (29.57%), Postives = 249/487 (51.13%), Query Frame = 1
Query:  448 IIPIHHSLCFGKRFCYRIVTVGGPNEAKSIVFNSSNQTERDLCIKQIRCAXXXXXXXXXXXXNNLKISIQEAKNLTLKNKYYCEIKLDNLIYARTSVKEMKEILIWGEEFDLMSLPCIEMVSITLWRLPRSKEKHKECQIVSHFNIPIENIDQHCITEKWYSPSPVCLPHSGSKLAHNLTFSAACDIDELPKNNTRTLNQVTDSAPLLRAKSKYSPLKVLDAKYYMEFVEFIKENGINMLREMEAGIKAKYREVLVWSMIQLSISENWVEEFLSDLILKEAQSC--DIKIILRGNSMASKSIEFFLKLECQDYLRQILHSTIKDIIHKTNDLEIDQSQLIKRNESISASAMRKRNQRLEMIVDKVLNKIFSNVDIIPRRVRSIFSRIRCSLKNFGTIDLEFTQKVVSACFFLRLVCPAIMTPHLFDLLPEYSDNVNINRSFTLVAKCVQNIANFAGIDDTKESYMQSIALHCRDYYNQMSEFINSIS 1902
            I P+H S+  G+ +C+ + T  G     S  F+  +  ERD  ++ +R A+  +  +    E+ LK+ + EAK+L  K KY CE+ LD+++YART+ K   + + WGE F+  +LP +  V++ L+R    K+K +    +   ++P  ++      EKWY   PV  P+                    PK             P++R K++Y  + +L  + Y EF E I  + + +   +E  + AK +E +  +++ +  S   V++FL+DL++ E   C  +  +I R N++A+K+IE +LKL  Q YL+  L   IK +     + E+D S+        S++ + +    L+M  +    KI ++  + PR ++ +F+  R    + G  D+  +++++SA  FLR +CPAIM+P LF+LL EY D+    R+ TL+AK  QN+ANFA    +KE YM  +       +  M  F+  IS
Sbjct:  157 IKPVHSSI-LGQDYCFEVTTSSG-----SKCFSCRSAAERDKWMENLRRAVHPNKDNSRRVEHILKLWVIEAKDLPAKKKYLCELCLDDVLYARTTSKLKTDNVFWGEHFEFHNLPPLRTVTVHLYRETDKKKKKERNSYLGLVSLPAASVAGRQFVEKWY---PVVTPN--------------------PKGGK-------GPGPMIRIKARYQTVSILPMEMYKEFAEHITNHYLGLCAALEPILSAKTKEEMASALVHILQSTGKVKDFLTDLMMSEVDRCGDNEHLIFRENTLATKAIEEYLKLVGQKYLQDALGEFIKALYESDENCEVDPSK-------CSSADLPEHQGNLKMCCELAFCKIINSYCVFPRELKEVFASWRQECSSRGRPDI--SERLISASLFLRFLCPAIMSPSLFNLLQEYPDD-RTARTLTLIAKVTQNLANFAKF-GSKEEYMSFMNQFLEHEWTNMQRFLLEIS 596          
BLAST of DAB2 interacting protein b vs. Ensembl Mouse
Match: Dab2ip (disabled 2 interacting protein [Source:MGI Symbol;Acc:MGI:1916851])

HSP 1 Score: 222.246 bits (565), Expect = 4.985e-59
Identity = 144/487 (29.57%), Postives = 249/487 (51.13%), Query Frame = 1
Query:  448 IIPIHHSLCFGKRFCYRIVTVGGPNEAKSIVFNSSNQTERDLCIKQIRCAXXXXXXXXXXXXNNLKISIQEAKNLTLKNKYYCEIKLDNLIYARTSVKEMKEILIWGEEFDLMSLPCIEMVSITLWRLPRSKEKHKECQIVSHFNIPIENIDQHCITEKWYSPSPVCLPHSGSKLAHNLTFSAACDIDELPKNNTRTLNQVTDSAPLLRAKSKYSPLKVLDAKYYMEFVEFIKENGINMLREMEAGIKAKYREVLVWSMIQLSISENWVEEFLSDLILKEAQSC--DIKIILRGNSMASKSIEFFLKLECQDYLRQILHSTIKDIIHKTNDLEIDQSQLIKRNESISASAMRKRNQRLEMIVDKVLNKIFSNVDIIPRRVRSIFSRIRCSLKNFGTIDLEFTQKVVSACFFLRLVCPAIMTPHLFDLLPEYSDNVNINRSFTLVAKCVQNIANFAGIDDTKESYMQSIALHCRDYYNQMSEFINSIS 1902
            I P+H S+  G+ +C+ + T  G     S  F+  +  ERD  ++ +R A+  +  +    E+ LK+ + EAK+L  K KY CE+ LD+++YART+ K   + + WGE F+  +LP +  V++ L+R    K+K +    +   ++P  ++      EKWY   PV  P+                    PK             P++R K++Y  + +L  + Y EF E I  + + +   +E  + AK +E +  +++ +  S   V++FL+DL++ E   C  +  +I R N++A+K+IE +LKL  Q YL+  L   IK +     + E+D S+        S++ + +    L+M  +    KI ++  + PR ++ +F+  R    + G  D+  +++++SA  FLR +CPAIM+P LF+LL EY D+    R+ TL+AK  QN+ANFA    +KE YM  +       +  M  F+  IS
Sbjct:   51 IKPVHSSI-LGQDYCFEVTTSSG-----SKCFSCRSAAERDKWMENLRRAVHPNKDNSRRVEHILKLWVIEAKDLPAKKKYLCELCLDDVLYARTTSKLKTDNVFWGEHFEFHNLPPLRTVTVHLYRETDKKKKKERNSYLGLVSLPAASVAGRQFVEKWY---PVVTPN--------------------PKGGK-------GPGPMIRIKARYQTVSILPMEMYKEFAEHITNHYLGLCAALEPILSAKTKEEMASALVHILQSTGKVKDFLTDLMMSEVDRCGDNEHLIFRENTLATKAIEEYLKLVGQKYLQDALGEFIKALYESDENCEVDPSK-------CSSADLPEHQGNLKMCCELAFCKIINSYCVFPRELKEVFASWRQECSSRGRPDI--SERLISASLFLRFLCPAIMSPSLFNLLQEYPDD-RTARTLTLIAKVTQNLANFAKF-GSKEEYMSFMNQFLEHEWTNMQRFLLEIS 490          
BLAST of DAB2 interacting protein b vs. UniProt/SwissProt
Match: sp|Q8T498|GAP2_DROME (Ras GTPase-activating protein raskol OS=Drosophila melanogaster OX=7227 GN=raskol PE=1 SV=3)

HSP 1 Score: 231.876 bits (590), Expect = 9.012e-61
Identity = 144/499 (28.86%), Postives = 252/499 (50.50%), Query Frame = 1
Query:  448 IIPIHHSLCFGKRFCYRIVTVGGPNEAKSIVFNSSNQTERDLCIKQIRCAXXXXXXXXXXXXNNLKISIQEAKNLTLKNKYYCEIKLDNLIYARTSVKEMKEILIWGEEFDLMSLPCIEMVSITLWRLPRSKEKHKECQIVSHFNIPIENIDQHCITEKWYSPSPVCLPHSGSKLAHNLTFSAACDIDELPKNNTRTLNQVTDSAPLLRAKSKYSPLKVLDAKYYMEFVEFIKENGINMLREMEAGIKAKYREVLVWSMIQLSISENWVEEFLSDLI-LKEAQSCDIKIILRGNSMASKSIEFFLKLECQDYLRQILHSTIKDIIHKTNDLEIDQSQLIKRNESISASAMRKRNQRLEMIVDKVLNKIFSNVDIIPRRVRSIFSRIRCSLKNFGTIDLEFTQKVVSACFFLRLVCPAIMTPHLFDLLPEYSDNVNINRSFTLVAKCVQNIANFAGIDDTKESYMQSIALHCRDYYNQMSEFINSISTINEATFTTKVYD 1941
            + P+H S+  G+R C+++   GGP   +   ++  ++ ERDL I  +R +I+ +       +N+LK+ + EAKNL  K +Y+CE++LD  +Y RTSVK   ++L WGE FD   +P I ++++ ++R    K+K  + Q V    IP+ ++      E+WY   P+    +G  L        +   D+             +  P LR K ++    +L    Y  F+ ++KEN   +   +E  I  K +E +  +++ L  ++     FL+D++ L   +  D ++  RGNS+A+KS+E FLKL  + YL+  L + I ++I    D E+D +    +    SA +++++   L   V      IF +    P ++R+ F+  R  L+  G  D+     ++SA  FLR +CPAI++P LF++  E   +    R+ TLVAK +Q +ANF      KE++M+ +         +M +F+  IST  E      + D
Sbjct:  245 VAPVHQSV-LGRRHCFQVR--GGPRGER--YYSCGSRQERDLWIYSLRKSIAPNAEHTRRTDNSLKMWVYEAKNLPPKKRYFCELQLDKTLYGRTSVKLQTDLLFWGEHFDFPDIPEINVITVNVFREVDKKKKRDKYQFVGSVKIPVHDVTSRLPCEQWY---PILSDKAGDSLGRTSGGGGSGSKDK-------------EQLPTLRIKCRFQSTDILPINVYGNFLTYLKENYKRVCETLEPVIGVKAKEDIGQALVLLMHAQGLAGAFLTDVVALDLLRVGDQRLTFRGNSLATKSMEAFLKLTGEQYLQDTLSAPINELIQSERDCEVDPT----KTSGSSAGSLQRQQAALRGAVRGAWQCIFESHKHFPAQLRNCFATFRERLQQLGRQDM--ADNLISASIFLRFLCPAILSPSLFNITSELP-SARATRNLTLVAKTLQTLANFTRFQG-KENFMEFLNDFLEQEAARMQQFLEIISTRPEHPAPDSILD 714          
BLAST of DAB2 interacting protein b vs. UniProt/SwissProt
Match: sp|Q5VWQ8|DAB2P_HUMAN (Disabled homolog 2-interacting protein OS=Homo sapiens OX=9606 GN=DAB2IP PE=1 SV=2)

HSP 1 Score: 223.787 bits (569), Expect = 1.630e-58
Identity = 145/487 (29.77%), Postives = 249/487 (51.13%), Query Frame = 1
Query:  448 IIPIHHSLCFGKRFCYRIVTVGGPNEAKSIVFNSSNQTERDLCIKQIRCAXXXXXXXXXXXXNNLKISIQEAKNLTLKNKYYCEIKLDNLIYARTSVKEMKEILIWGEEFDLMSLPCIEMVSITLWRLPRSKEKHKECQIVSHFNIPIENIDQHCITEKWYSPSPVCLPHSGSKLAHNLTFSAACDIDELPKNNTRTLNQVTDSAPLLRAKSKYSPLKVLDAKYYMEFVEFIKENGINMLREMEAGIKAKYREVLVWSMIQLSISENWVEEFLSDLILKEAQSC--DIKIILRGNSMASKSIEFFLKLECQDYLRQILHSTIKDIIHKTNDLEIDQSQLIKRNESISASAMRKRNQRLEMIVDKVLNKIFSNVDIIPRRVRSIFSRIRCSLKNFGTIDLEFTQKVVSACFFLRLVCPAIMTPHLFDLLPEYSDNVNINRSFTLVAKCVQNIANFAGIDDTKESYMQSIALHCRDYYNQMSEFINSIS 1902
            I P+H S+  G+ +C+ + T  G     S  F+  +  ERD  ++ +R A+  +  +    E+ LK+ + EAK+L  K KY CE+ LD+++YART+ K   + + WGE F+  +LP +  V++ L+R    K+K +    +   ++P  ++      EKWY   PV  P+                    PK             P++R K++Y  + +L  + Y EF E I  + + +   +E  + AK +E +  +++ +  S   V++FL+DL++ E   C  +  +I R N++A+K+IE +LKL  Q YL+  L   IK +     + E+D S+        SA+ + +    L+M  +    KI ++  + PR ++ +F+  R    + G  D+  +++++SA  FLR +CPAIM+P LF+LL EY D+    R+ TL+AK  QN+ANFA    +KE YM  +       +  M  F+  IS
Sbjct:  157 IKPVHSSI-LGQDYCFEVTTSSG-----SKCFSCRSAAERDKWMENLRRAVHPNKDNSRRVEHILKLWVIEAKDLPAKKKYLCELCLDDVLYARTTGKLKTDNVFWGEHFEFHNLPPLRTVTVHLYRETDKKKKKERNSYLGLVSLPAASVAGRQFVEKWY---PVVTPN--------------------PKGGK-------GPGPMIRIKARYQTITILPMEMYKEFAEHITNHYLGLCAALEPILSAKTKEEMASALVHILQSTGKVKDFLTDLMMSEVDRCGDNEHLIFRENTLATKAIEEYLKLVGQKYLQDALGEFIKALYESDENCEVDPSK-------CSAADLPEHQGNLKMCCELAFCKIINSYCVFPRELKEVFASWRQECSSRGRPDI--SERLISASLFLRFLCPAIMSPSLFNLLQEYPDD-RTARTLTLIAKVTQNLANFAKF-GSKEEYMSFMNQFLEHEWTNMQRFLLEIS 596          
BLAST of DAB2 interacting protein b vs. UniProt/SwissProt
Match: sp|Q3UHC7|DAB2P_MOUSE (Disabled homolog 2-interacting protein OS=Mus musculus OX=10090 GN=Dab2ip PE=1 SV=1)

HSP 1 Score: 223.016 bits (567), Expect = 3.534e-58
Identity = 144/487 (29.57%), Postives = 249/487 (51.13%), Query Frame = 1
Query:  448 IIPIHHSLCFGKRFCYRIVTVGGPNEAKSIVFNSSNQTERDLCIKQIRCAXXXXXXXXXXXXNNLKISIQEAKNLTLKNKYYCEIKLDNLIYARTSVKEMKEILIWGEEFDLMSLPCIEMVSITLWRLPRSKEKHKECQIVSHFNIPIENIDQHCITEKWYSPSPVCLPHSGSKLAHNLTFSAACDIDELPKNNTRTLNQVTDSAPLLRAKSKYSPLKVLDAKYYMEFVEFIKENGINMLREMEAGIKAKYREVLVWSMIQLSISENWVEEFLSDLILKEAQSC--DIKIILRGNSMASKSIEFFLKLECQDYLRQILHSTIKDIIHKTNDLEIDQSQLIKRNESISASAMRKRNQRLEMIVDKVLNKIFSNVDIIPRRVRSIFSRIRCSLKNFGTIDLEFTQKVVSACFFLRLVCPAIMTPHLFDLLPEYSDNVNINRSFTLVAKCVQNIANFAGIDDTKESYMQSIALHCRDYYNQMSEFINSIS 1902
            I P+H S+  G+ +C+ + T  G     S  F+  +  ERD  ++ +R A+  +  +    E+ LK+ + EAK+L  K KY CE+ LD+++YART+ K   + + WGE F+  +LP +  V++ L+R    K+K +    +   ++P  ++      EKWY   PV  P+                    PK             P++R K++Y  + +L  + Y EF E I  + + +   +E  + AK +E +  +++ +  S   V++FL+DL++ E   C  +  +I R N++A+K+IE +LKL  Q YL+  L   IK +     + E+D S+        S++ + +    L+M  +    KI ++  + PR ++ +F+  R    + G  D+  +++++SA  FLR +CPAIM+P LF+LL EY D+    R+ TL+AK  QN+ANFA    +KE YM  +       +  M  F+  IS
Sbjct:  157 IKPVHSSI-LGQDYCFEVTTSSG-----SKCFSCRSAAERDKWMENLRRAVHPNKDNSRRVEHILKLWVIEAKDLPAKKKYLCELCLDDVLYARTTSKLKTDNVFWGEHFEFHNLPPLRTVTVHLYRETDKKKKKERNSYLGLVSLPAASVAGRQFVEKWY---PVVTPN--------------------PKGGK-------GPGPMIRIKARYQTVSILPMEMYKEFAEHITNHYLGLCAALEPILSAKTKEEMASALVHILQSTGKVKDFLTDLMMSEVDRCGDNEHLIFRENTLATKAIEEYLKLVGQKYLQDALGEFIKALYESDENCEVDPSK-------CSSADLPEHQGNLKMCCELAFCKIINSYCVFPRELKEVFASWRQECSSRGRPDI--SERLISASLFLRFLCPAIMSPSLFNLLQEYPDD-RTARTLTLIAKVTQNLANFAKF-GSKEEYMSFMNQFLEHEWTNMQRFLLEIS 596          
BLAST of DAB2 interacting protein b vs. UniProt/SwissProt
Match: sp|Q9UJF2|NGAP_HUMAN (Ras GTPase-activating protein nGAP OS=Homo sapiens OX=9606 GN=RASAL2 PE=1 SV=2)

HSP 1 Score: 216.083 bits (549), Expect = 4.828e-56
Identity = 145/488 (29.71%), Postives = 248/488 (50.82%), Query Frame = 1
Query:  448 IIPIHHSLCFGKRFCYRIVTVGGPNEAKSIVFNSSNQTERDLCIKQIRCAXXXXXXXXXXXXNNLKISIQEAKNLTLKNKYYCEIKLDNLIYARTSVKEMKEILIWGEEFDLMSLPCIEMVSITLWRLPRSKEKHKECQIVSHFNIPIENIDQHCITEKWYSPSPVCLPHSGSKLAHNLTFSAACDIDELPKNNTRTLNQVTDSAPLLRAKSKYSPLKVLDAKYYMEFVEFIKENGINMLREMEAGIKAKYREVLVWSMIQLSISENWVEEFLSDLILKEAQSC---DIKIILRGNSMASKSIEFFLKLECQDYLRQILHSTIKDIIHKTNDLEIDQSQLIKRNESISASAMRKRNQRLEMIVDKVLNKIFSNVDIIPRRVRSIFSRIRCSLKNFGTIDLEFTQKVVSACFFLRLVCPAIMTPHLFDLLPEYSDNVNINRSFTLVAKCVQNIANFAGIDDTKESYMQSIALHCRDYYNQMSEFINSIS 1902
            + P+H S+  G+ FC+ +  + G     S  F+ ++ +ERD  ++ +R  +  +  +    EN L++ I EAK+L  K KY+CE+ LD+ ++ART+ K   + + WGE F+  SLP +  +++ +++    K+K  +   V   NIP  ++      EKWY   PV  P                           T N+     P +R KS++  + +L  + Y EF EF+  N   +   +E  I  + +E L  +++ +  S    ++FL+DL++ E   C   D+ +I R N++A+KSIE +LKL  Q YL   L   IK +     + E+D S+        S+S +      L+M  +    KI ++  + PR ++ +F+  +    N G  D+  +++++SA  FLR +CPAIM+P LF+L+ EY D+   +R+ TL+AK +QN+ANFA   + KE YM  +       +  M  F+  IS
Sbjct:  113 VKPLHSSI-LGQDFCFEVTYLSG-----SKCFSCNSASERDKWMENLRRTVQPNKDNCRRAENVLRLWIIEAKDLAPKKKYFCELCLDDTLFARTTSKTKADNIFWGEHFEFFSLPPLHSITVHIYKDVEKKKKKDKNNYVGLVNIPTASVTGRQFVEKWY---PVSTP---------------------------TPNKGKTGGPSIRIKSRFQTITILPMEQYKEFAEFVTSNYTMLCSVLEPVISVRNKEELACALVHILQSTGRAKDFLTDLVMSEVDRCGEHDV-LIFRENTIATKSIEEYLKLVGQQYLHDALGEFIKALYESDENCEVDPSK-------CSSSELIDHQSNLKMCCELAFCKIINSYCVFPRELKEVFASWKQQCLNRGKQDI--SERLISASLFLRFLCPAIMSPSLFNLMQEYPDD-RTSRTLTLIAKVIQNLANFAKFGN-KEEYMAFMNDFLEHEWGGMKRFLLEIS 552          
BLAST of DAB2 interacting protein b vs. UniProt/SwissProt
Match: sp|Q8MLZ5|GAP2_CAEEL (Ras GTPase-activating protein gap-2 OS=Caenorhabditis elegans OX=6239 GN=gap-2 PE=2 SV=2)

HSP 1 Score: 215.312 bits (547), Expect = 9.146e-56
Identity = 146/491 (29.74%), Postives = 254/491 (51.73%), Query Frame = 1
Query:  445 KIIPIHHSLCFGKRFCYRIVTVGGPNEAKSIVFNSSNQTERDLCIKQIRCAXXXXXXXXXXXXNNLKISIQEAKNLTLKNKYYCEIKLDNLIYARTSVKEMKEILIWGEEFDLMSLPCIEMVSITLWRLPRSKEKHKECQIVSHFNIPIENIDQHCITEKWYSPSPVCLPHSG---SKLAHNLTFSAACDIDELPKNNTRTLNQVTDSAPLLRAKSKYSPLKVLDAKYYMEFVEFIKENGINMLREMEAGIKAKYREVLVWSMIQLSISENWVEEFLSDLILKEAQSCD-IKIILRGNSMASKSIEFFLKLECQDYLRQILHSTIKDIIHKTNDLEIDQSQLIKRNESISASAMRKRNQRLEMIVDKVLNKIFSNVDIIPRRVRSIFSRIRCSLKNFGTIDLEFTQKVVSACFFLRLVCPAIMTPHLFDLLPEYSDNVNINRSFTLVAKCVQNIANFAGIDDTKESYMQSIALHCRDYYNQMSEFINSIST 1905
            ++ P+H S+ F    C+R+          S  ++     ER   ++ +R  ++         EN++ I I EAK L  K KYYCE+ LD  +YA+TS K   + + WGE F+ M LP I+ V ++L+R   S  K K+  ++ +  I I+ +      E+WY+   V   HS    S++A  L   ++                 +  +P LR K+++  + +L  + Y   +E +  N + +  ++E  +  + +E L  S++++    N  +EFL DLI+KE +  D   ++ RGN++A+K++E F+KL   DYL   L   IK ++   +  E+D  +L     ++S S++ K    L   V+    KI +NV  +P+ +R +FS +RC L+      L  T  ++S+  FLR +CPAI++P LF+L+ EY    N  R+ TL+AK +QN+ANF+     KE +M+ +       +++M +F+  IS+
Sbjct:  341 RLHPVHPSI-FEVPNCFRLA---------STYYSCRTPLERAKWMENLRKTMNPRRDQQRRTENSMLIWILEAKGLPAKRKYYCEMTLDKTLYAKTSSKARTDNVFWGENFEFMMLPKIDEVCVSLFR--ESDSKKKKDTLIGYVTIGIDQLSSRSPVERWYT---VNTSHSDSGTSRIASALGGKSS-----------------SQESPSLRIKARWQSVHILPLRAYDNLLETLCYNYLPLCEQLEPVLNVRDKEDLATSLVRVMYKHNLAKEFLCDLIMKEVEKLDNDHLMFRGNTLATKAMESFMKLVADDYLDSTLSDFIKTVLQCEDSCEVDPQKL----GNVSNSSLEKNRALLMRYVEVAWTKILNNVHQLPKNLRDVFSALRCRLEAQNREALADT--LISSSIFLRFLCPAILSPSLFNLVSEYPSPTNA-RNLTLIAKTLQNLANFSKFGG-KEPHMEFMNEFVDREWHRMKDFLLRISS 791          
BLAST of DAB2 interacting protein b vs. TrEMBL
Match: A0A3Q1GA50 (Uncharacterized protein OS=Acanthochromis polyacanthus OX=80966 PE=4 SV=1)

HSP 1 Score: 238.81 bits (608), Expect = 7.211e-63
Identity = 150/487 (30.80%), Postives = 247/487 (50.72%), Query Frame = 1
Query:  448 IIPIHHSLCFGKRFCYRIVTVGGPNEAKSIVFNSSNQTERDLCIKQIRCAXXXXXXXXXXXXNNLKISIQEAKNLTLKNKYYCEIKLDNLIYARTSVKEMKEILIWGEEFDLMSLPCIEMVSITLWRLPRSKEKHKECQIVSHFNIPIENIDQHCITEKWYSPSPVCLPHSGSKLAHNLTFSAACDIDELPKNNTRTLNQVTDSAPLLRAKSKYSPLKVLDAKYYMEFVEFIKENGINMLREMEAGIKAKYREVLVWSMIQLSISENWVEEFLSDLILKEAQSC--DIKIILRGNSMASKSIEFFLKLECQDYLRQILHSTIKDIIHKTNDLEIDQSQLIKRNESISASAMRKRNQRLEMIVDKVLNKIFSNVDIIPRRVRSIFSRIRCSLKNFGTIDLEFTQKVVSACFFLRLVCPAIMTPHLFDLLPEYSDNVNINRSFTLVAKCVQNIANFAGIDDTKESYMQSIALHCRDYYNQMSEFINSIS 1902
            I P+H SL  G+ +C+ + T  G     +  F+  +  ERD  ++ +R A+  +  +    EN L + + EAK+L  K +Y+CE+ LD+ +YARTS K   + + WGE FD  SLP +  V++ L++    K K  +   V   NIP+  +    + EKWYS S                              T + ++   S P +R K++Y  + +L  + Y EF E+I  N + +   +EA I  + +E L  +++ +  S    ++FL+DL++ E   C  + ++I R N++A+KSIE +LKL  Q YL+  L   IK +     + E+D S+        S S + +    L M  +    KI  +  + PR ++ +F+  R    N G  D+  +++++SA  FLR +CPA+M+P LFDL+ EY D     R+ TL+AK +QN+ANF+    TKE YM  +       ++ M  F+  IS
Sbjct:   57 IKPVHSSL-LGQDYCFEVTTSTG-----TKCFSCRSAAERDKWMENLRRAVHPNKDNSRRLENVLTVWVIEAKDLPAKKRYFCELCLDDSLYARTSCKLRTDNVFWGERFDFSSLPSVSSVTLHLYKDTDRKRKKDKSSYVGLVNIPVATVTGRQLVEKWYSVS------------------------------TPSTSRGKSSVPTVRVKARYQSIVILPMEQYKEFAEYISSNYLLLCSTLEASISLRAKEELAAALVHILHSTGKAKDFLTDLMMSEVDRCRDNDQLIFRENTLATKSIEEYLKLIGQKYLQDALGEFIKALYESDENCEVDPSR-------CSTSDLLEHQANLRMCCELAFCKILDSYRVFPRELKEVFASWRQECGNRGRPDI--SERLISASLFLRFLCPAVMSPSLFDLMQEYPDE-RTARTLTLIAKVIQNLANFSKF-GTKEEYMLFMNDFVERQWSSMQRFLQEIS 496          
BLAST of DAB2 interacting protein b vs. TrEMBL
Match: A0A3Q1EUP4 (Uncharacterized protein OS=Acanthochromis polyacanthus OX=80966 PE=4 SV=1)

HSP 1 Score: 236.113 bits (601), Expect = 1.490e-62
Identity = 150/489 (30.67%), Postives = 248/489 (50.72%), Query Frame = 1
Query:  448 IIPIHHSLCFGKRFCYRIVTVGGPNEAKSIVFNSSNQTERDLCIKQIRCAXXXXXXXXXXXXNNLKISIQEAKNLTLKNKYYCEIKLDNLIYARTSVKEMKEILIWGEEFDLMSLPCIEMVSITLWRLPRSKEKHKECQIVSHFNIPIENIDQHCITEKWYSPSPVCLPHSGSKLAHNLTFSAACDIDELPKNNTRTLNQVTDSAPLLRAKSKYSPLKVLDAKYYMEFVEFIKENGINMLREMEAGIKAKYREVLVWSMIQLSISENWVEEFLSDLILKEAQSC--DIKIILRGNSMASKSIEFFLKLECQDYLRQILHSTIKDIIHKTND--LEIDQSQLIKRNESISASAMRKRNQRLEMIVDKVLNKIFSNVDIIPRRVRSIFSRIRCSLKNFGTIDLEFTQKVVSACFFLRLVCPAIMTPHLFDLLPEYSDNVNINRSFTLVAKCVQNIANFAGIDDTKESYMQSIALHCRDYYNQMSEFINSIS 1902
            I P+H SL  G+ +C+ + T  G        F+  +  ERD  ++ +R A+  +  +    EN L + + EAK+L  K +Y+CE+ LD+ +YARTS K   + + WGE FD  SLP +  V++ L++    K K  +   V   NIP+  +    + EKWYS S                              T + ++   S P +R K++Y  + +L  + Y EF E+I  N + +   +EA I  + +E L  +++ +  S    ++FL+DL++ E   C  + ++I R N++A+KSIE +LKL  Q YL+  L +    + H ++D   E+D S+        S S + +    L M  +    KI  +  + PR ++ +F+  R    N G  D+  +++++SA  FLR +CPA+M+P LFDL+ EY D     R+ TL+AK +QN+ANF+    TKE YM  +       ++ M  F+  IS
Sbjct:   63 IKPVHSSL-LGQDYCFEVTTSTGTK-----CFSCRSAAERDKWMENLRRAVHPNKDNSRRLENVLTVWVIEAKDLPAKKRYFCELCLDDSLYARTSCKLRTDNVFWGERFDFSSLPSVSSVTLHLYKDTDRKRKKDKSSYVGLVNIPVATVTGRQLVEKWYSVS------------------------------TPSTSRGKSSVPTVRVKARYQSIVILPMEQYKEFAEYISSNYLLLCSTLEASISLRAKEELAAALVHILHSTGKAKDFLTDLMMSEVDRCRDNDQLIFRENTLATKSIEEYLKLIGQKYLQDALGTAETHLTHTSSDENCEVDPSR-------CSTSDLLEHQANLRMCCELAFCKILDSYRVFPRELKEVFASWRQECGNRGRPDI--SERLISASLFLRFLCPAVMSPSLFDLMQEYPDE-RTARTLTLIAKVIQNLANFSKF-GTKEEYMLFMNDFVERQWSSMQRFLQEIS 504          
BLAST of DAB2 interacting protein b vs. TrEMBL
Match: A0A3Q1ER52 (Uncharacterized protein OS=Acanthochromis polyacanthus OX=80966 PE=4 SV=1)

HSP 1 Score: 236.884 bits (603), Expect = 1.771e-62
Identity = 150/487 (30.80%), Postives = 245/487 (50.31%), Query Frame = 1
Query:  448 IIPIHHSLCFGKRFCYRIVTVGGPNEAKSIVFNSSNQTERDLCIKQIRCAXXXXXXXXXXXXNNLKISIQEAKNLTLKNKYYCEIKLDNLIYARTSVKEMKEILIWGEEFDLMSLPCIEMVSITLWRLPRSKEKHKECQIVSHFNIPIENIDQHCITEKWYSPSPVCLPHSGSKLAHNLTFSAACDIDELPKNNTRTLNQVTDSAPLLRAKSKYSPLKVLDAKYYMEFVEFIKENGINMLREMEAGIKAKYREVLVWSMIQLSISENWVEEFLSDLILKEAQSC--DIKIILRGNSMASKSIEFFLKLECQDYLRQILHSTIKDIIHKTNDLEIDQSQLIKRNESISASAMRKRNQRLEMIVDKVLNKIFSNVDIIPRRVRSIFSRIRCSLKNFGTIDLEFTQKVVSACFFLRLVCPAIMTPHLFDLLPEYSDNVNINRSFTLVAKCVQNIANFAGIDDTKESYMQSIALHCRDYYNQMSEFINSIS 1902
            I P+H SL  G+ +C+ + T  G     +  F+  +  ERD  ++ +R A+  +  +    EN L + + EAK+L  K +Y+CE+ LD+ +YARTS K   + + WGE FD  SLP +  V++ L++    K K  +   V   NIP+  +    + EKWYS S                                T +    S P +R K++Y  + +L  + Y EF E+I  N + +   +EA I  + +E L  +++ +  S    ++FL+DL++ E   C  + ++I R N++A+KSIE +LKL  Q YL+  L   IK +     + E+D S+        S S + +    L M  +    KI  +  + PR ++ +F+  R    N G  D+  +++++SA  FLR +CPA+M+P LFDL+ EY D     R+ TL+AK +QN+ANF+    TKE YM  +       ++ M  F+  IS
Sbjct:   60 IKPVHSSL-LGQDYCFEVTTSTG-----TKCFSCRSAAERDKWMENLRRAVHPNKDNSRRLENVLTVWVIEAKDLPAKKRYFCELCLDDSLYARTSCKLRTDNVFWGERFDFSSLPSVSSVTLHLYKDTDRKRKKDKSSYVGLVNIPVATVTGRQLVEKWYSVS--------------------------------TPSTRKSSVPTVRVKARYQSIVILPMEQYKEFAEYISSNYLLLCSTLEASISLRAKEELAAALVHILHSTGKAKDFLTDLMMSEVDRCRDNDQLIFRENTLATKSIEEYLKLIGQKYLQDALGEFIKALYESDENCEVDPSR-------CSTSDLLEHQANLRMCCELAFCKILDSYRVFPRELKEVFASWRQECGNRGRPDI--SERLISASLFLRFLCPAVMSPSLFDLMQEYPDE-RTARTLTLIAKVIQNLANFSKF-GTKEEYMLFMNDFVERQWSSMQRFLQEIS 497          
BLAST of DAB2 interacting protein b vs. TrEMBL
Match: A0A4W6FB02 (Uncharacterized protein OS=Lates calcarifer OX=8187 PE=4 SV=1)

HSP 1 Score: 238.424 bits (607), Expect = 1.230e-61
Identity = 151/487 (31.01%), Postives = 247/487 (50.72%), Query Frame = 1
Query:  448 IIPIHHSLCFGKRFCYRIVTVGGPNEAKSIVFNSSNQTERDLCIKQIRCAXXXXXXXXXXXXNNLKISIQEAKNLTLKNKYYCEIKLDNLIYARTSVKEMKEILIWGEEFDLMSLPCIEMVSITLWRLPRSKEKHKECQIVSHFNIPIENIDQHCITEKWYSPSPVCLPHSGSKLAHNLTFSAACDIDELPKNNTRTLNQVTDSAPLLRAKSKYSPLKVLDAKYYMEFVEFIKENGINMLREMEAGIKAKYREVLVWSMIQLSISENWVEEFLSDLILKEAQSC--DIKIILRGNSMASKSIEFFLKLECQDYLRQILHSTIKDIIHKTNDLEIDQSQLIKRNESISASAMRKRNQRLEMIVDKVLNKIFSNVDIIPRRVRSIFSRIRCSLKNFGTIDLEFTQKVVSACFFLRLVCPAIMTPHLFDLLPEYSDNVNINRSFTLVAKCVQNIANFAGIDDTKESYMQSIALHCRDYYNQMSEFINSIS 1902
            I P+H SL  G+ +C+ + T  G     +  F+  +  ERD  ++ +R A+  +  +    EN L + + EAK+L  K +Y+CE+ LD+ +YARTS K   + + WGE FD  SLP I  V++ L++    K K  +   V   NIP+  +    + EKWYS S                              T + ++   S P +R K++Y  + +L  + Y EF E+I  N + +   +EA I  + +E L  +++ +  S    ++FL+DL++ E   C  + ++I R N++A+KSIE +LKL  Q YL+  L   IK +     + E+D S+        S S + +    L M  +    KI  +  + PR ++ +F+  R    N G  D+  +++++SA  FLR +CPA+M+P LFDL+ EY D     R+ TL+AK +QN+ANF+    TKE YM  +       ++ M  F+  IS
Sbjct:   31 IKPVHSSL-LGQDYCFEVTTSTG-----TKCFSCRSAAERDKWMENLRRAVHPNKDNSRRLENVLTVWVIEAKDLPAKKRYFCELCLDDSLYARTSCKLKTDNIFWGERFDFSSLPSISAVTLHLYKDTDRKRKKDKSSYVGLVNIPVAMVTGRQLVEKWYSVS------------------------------TPSTSRGKSSVPTVRIKARYQSIVILPMEQYKEFAEYISSNYLLLCNTLEASISLRAKEELAAALVHILHSTGKAKDFLTDLMMSEVDRCRDNDQLIFRENTLATKSIEEYLKLIGQKYLQDALGEFIKALYESDENCEVDPSR-------CSTSDLAEHQANLRMCCELAFCKILDSYRVFPRELKEVFASWRQECSNRGRPDI--SERLISASLFLRFLCPAVMSPSLFDLMQEYPDE-RTARTLTLIAKVIQNLANFSKF-GTKEEYMLFMNDFVERQWSSMQRFLQEIS 470          
BLAST of DAB2 interacting protein b vs. TrEMBL
Match: A0A3B4X0R4 (Uncharacterized protein OS=Seriola lalandi dorsalis OX=1841481 PE=4 SV=1)

HSP 1 Score: 239.58 bits (610), Expect = 1.703e-61
Identity = 151/487 (31.01%), Postives = 247/487 (50.72%), Query Frame = 1
Query:  448 IIPIHHSLCFGKRFCYRIVTVGGPNEAKSIVFNSSNQTERDLCIKQIRCAXXXXXXXXXXXXNNLKISIQEAKNLTLKNKYYCEIKLDNLIYARTSVKEMKEILIWGEEFDLMSLPCIEMVSITLWRLPRSKEKHKECQIVSHFNIPIENIDQHCITEKWYSPSPVCLPHSGSKLAHNLTFSAACDIDELPKNNTRTLNQVTDSAPLLRAKSKYSPLKVLDAKYYMEFVEFIKENGINMLREMEAGIKAKYREVLVWSMIQLSISENWVEEFLSDLILKEAQSC--DIKIILRGNSMASKSIEFFLKLECQDYLRQILHSTIKDIIHKTNDLEIDQSQLIKRNESISASAMRKRNQRLEMIVDKVLNKIFSNVDIIPRRVRSIFSRIRCSLKNFGTIDLEFTQKVVSACFFLRLVCPAIMTPHLFDLLPEYSDNVNINRSFTLVAKCVQNIANFAGIDDTKESYMQSIALHCRDYYNQMSEFINSIS 1902
            I P+H SL  G+ +C+ + T  G     +  F+  +  ERD  ++ +R A+  +  +    EN L + + EAK+L  K +Y+CE+ LD+ +YARTS K   + + WGE FD  SLP I  V++ L++    K K  +   V   NIP+  +    + EKWYS S                              T + ++   S P +R K++Y  + +L  + Y EF E+I  N + +   +EA I  + +E L  +++ +  S    ++FL+DL++ E   C  + ++I R N++A+KSIE +LKL  Q YL+  L   IK +     + E+D S+        S S + +    L M  +    KI  +  + PR ++ +F+  R    N G  D+  +++++SA  FLR +CPA+M+P LFDL+ EY D     R+ TL+AK +QN+ANF+    TKE YM  +       ++ M  F+  IS
Sbjct:   61 IKPVHSSL-LGQDYCFEVTTTTG-----TKCFSCRSAAERDKWMENLRRAVHPNKDNSRRLENVLTVWVIEAKDLPAKKRYFCELCLDDSLYARTSCKLKTDNIFWGERFDFSSLPSISAVTLHLYKDTDRKRKKDKSSYVGLVNIPVAMVTSRQLVEKWYSVS------------------------------TPSTSRGKSSVPTVRIKARYQSIVILPMEQYKEFAEYISSNYLLLCNTLEATISLRAKEELAAALVHILHSTGKAKDFLTDLMMSEVDRCRDNDQLIFRENTLATKSIEEYLKLIGQKYLQDALGEFIKALYESDENCEVDPSR-------CSTSDLAEHQANLRMCCELAFCKILDSYRVFPRELKEVFASWRQECGNRGRPDI--SERLISASLFLRFLCPAVMSPSLFDLMQEYPDE-RTARTLTLIAKVIQNLANFSKF-GTKEEYMLFMNDFVERQWSSMQRFLQEIS 500          
BLAST of DAB2 interacting protein b vs. Ensembl Cavefish
Match: rasal2 (ras GTPase-activating protein nGAP [Source:NCBI gene;Acc:103044896])

HSP 1 Score: 229.18 bits (583), Expect = 2.708e-61
Identity = 143/490 (29.18%), Postives = 258/490 (52.65%), Query Frame = 1
Query:  448 IIPIHHSLCFGKRFCYRIVTVGGPNEAKSIVFNSSNQTERDLCIKQIRCAXXXXXXXXXXXXNNLKISIQEAKNLTLKNKYYCEIKLDNLIYARTSVKEMKEILIWGEEFDLMSLPCIEMVSITLWRLPRSKEKHKECQIVSHFNIPIENIDQHCITEKWYSPSPVCLPHSGSKLAHNLTFSAACDIDELPKNNTRTLNQVTDSAPLLRAKSKYSPLKVLDAKYYMEFVEFIKENGINMLREMEAGIKAKYREVLVWSMIQLSISENWVEEFLSDLILKEAQSC---DIKIILRGNSMASKSIEFFLKLECQDYLRQILHSTIKDIIHKTNDLEIDQSQLIKRNESISASAMRKRNQRLEMIVDKVLNKIFSNVDIIPRRVRSIFSRIRCSLKNFGTIDLEFTQKVVSACFFLRLVCPAIMTPHLFDLLPEYSDNVNINRSFTLVAKCVQNIANFAGIDDTKESYMQSIALHCRDYYNQMSEFINSISTI 1908
            I P+H S+  G+ FC+ +  +GG     S  F+ ++ +ERD  ++ +R  +  +  +    EN L++ I EAK+L  K KY+CE+ LD+++YART+ K+  + L WGE+F+   LP +  +++ ++R    K+K  +   V   NIP+ ++      EKWY   PV  P                           T+++    +P +R K+++  + +L  + Y EF EF+  N   +   +E  I  + +E +  +++ +  S    ++FL+DL++ E   C   D+ +I R N++A+K+IE +LKL  Q YL   L   IK +     + E+D S+        S+S + ++   L+M  +    KI ++  + PR ++ +F+  +   ++ G  D+  +Q+++SA  FLR +CPAIM+P LF+L+ EY D+   +R+ TL+AK +Q++ANF    + KE YM  +       +  M+ F+  IS +
Sbjct:  117 IKPLHSSV-LGQEFCFEVTYLGG-----SKCFSCTSASERDKWMENLRRTVQPNKDNCRRAENVLRLWIIEAKDLPPKKKYFCELCLDDVLYARTTSKQRSDCLFWGEQFEFAGLPTVNSITVHIYRDADKKKKKDKNNYVGLVNIPVHSVSGRQFMEKWY---PVSTP---------------------------TISKAKGGSPSIRLKTRFQTMSILPMEQYKEFAEFVTSNYTMLCSILEPVISVRNKEEMASALVHILQSTGKAKDFLTDLVMSEIDRCADHDV-LIFRENTLATKAIEEYLKLVGQKYLHDALGEFIKALYESDENCEVDPSK-------CSSSELPEQQSNLKMCCELAFCKIINSYCVFPRELKEVFAAWKQQCQSRGKQDI--SQRLISASLFLRFLCPAIMSPSLFNLMQEYPDD-RTSRTLTLIAKVIQSLANFTKFGN-KEEYMAFMNDFLEHEWAGMTRFLLEISNL 558          
BLAST of DAB2 interacting protein b vs. Ensembl Cavefish
Match: rasal2 (ras GTPase-activating protein nGAP [Source:NCBI gene;Acc:103044896])

HSP 1 Score: 228.794 bits (582), Expect = 6.004e-61
Identity = 143/490 (29.18%), Postives = 258/490 (52.65%), Query Frame = 1
Query:  448 IIPIHHSLCFGKRFCYRIVTVGGPNEAKSIVFNSSNQTERDLCIKQIRCAXXXXXXXXXXXXNNLKISIQEAKNLTLKNKYYCEIKLDNLIYARTSVKEMKEILIWGEEFDLMSLPCIEMVSITLWRLPRSKEKHKECQIVSHFNIPIENIDQHCITEKWYSPSPVCLPHSGSKLAHNLTFSAACDIDELPKNNTRTLNQVTDSAPLLRAKSKYSPLKVLDAKYYMEFVEFIKENGINMLREMEAGIKAKYREVLVWSMIQLSISENWVEEFLSDLILKEAQSC---DIKIILRGNSMASKSIEFFLKLECQDYLRQILHSTIKDIIHKTNDLEIDQSQLIKRNESISASAMRKRNQRLEMIVDKVLNKIFSNVDIIPRRVRSIFSRIRCSLKNFGTIDLEFTQKVVSACFFLRLVCPAIMTPHLFDLLPEYSDNVNINRSFTLVAKCVQNIANFAGIDDTKESYMQSIALHCRDYYNQMSEFINSISTI 1908
            I P+H S+  G+ FC+ +  +GG     S  F+ ++ +ERD  ++ +R  +  +  +    EN L++ I EAK+L  K KY+CE+ LD+++YART+ K+  + L WGE+F+   LP +  +++ ++R    K+K  +   V   NIP+ ++      EKWY   PV  P                           T+++    +P +R K+++  + +L  + Y EF EF+  N   +   +E  I  + +E +  +++ +  S    ++FL+DL++ E   C   D+ +I R N++A+K+IE +LKL  Q YL   L   IK +     + E+D S+        S+S + ++   L+M  +    KI ++  + PR ++ +F+  +   ++ G  D+  +Q+++SA  FLR +CPAIM+P LF+L+ EY D+   +R+ TL+AK +Q++ANF    + KE YM  +       +  M+ F+  IS +
Sbjct:  251 IKPLHSSV-LGQEFCFEVTYLGG-----SKCFSCTSASERDKWMENLRRTVQPNKDNCRRAENVLRLWIIEAKDLPPKKKYFCELCLDDVLYARTTSKQRSDCLFWGEQFEFAGLPTVNSITVHIYRDADKKKKKDKNNYVGLVNIPVHSVSGRQFMEKWY---PVSTP---------------------------TISKAKGGSPSIRLKTRFQTMSILPMEQYKEFAEFVTSNYTMLCSILEPVISVRNKEEMASALVHILQSTGKAKDFLTDLVMSEIDRCADHDV-LIFRENTLATKAIEEYLKLVGQKYLHDALGEFIKALYESDENCEVDPSK-------CSSSELPEQQSNLKMCCELAFCKIINSYCVFPRELKEVFAAWKQQCQSRGKQDI--SQRLISASLFLRFLCPAIMSPSLFNLMQEYPDD-RTSRTLTLIAKVIQSLANFTKFGN-KEEYMAFMNDFLEHEWAGMTRFLLEISNL 692          
BLAST of DAB2 interacting protein b vs. Ensembl Cavefish
Match: rasal2 (ras GTPase-activating protein nGAP [Source:NCBI gene;Acc:103044896])

HSP 1 Score: 228.409 bits (581), Expect = 8.770e-61
Identity = 143/490 (29.18%), Postives = 258/490 (52.65%), Query Frame = 1
Query:  448 IIPIHHSLCFGKRFCYRIVTVGGPNEAKSIVFNSSNQTERDLCIKQIRCAXXXXXXXXXXXXNNLKISIQEAKNLTLKNKYYCEIKLDNLIYARTSVKEMKEILIWGEEFDLMSLPCIEMVSITLWRLPRSKEKHKECQIVSHFNIPIENIDQHCITEKWYSPSPVCLPHSGSKLAHNLTFSAACDIDELPKNNTRTLNQVTDSAPLLRAKSKYSPLKVLDAKYYMEFVEFIKENGINMLREMEAGIKAKYREVLVWSMIQLSISENWVEEFLSDLILKEAQSC---DIKIILRGNSMASKSIEFFLKLECQDYLRQILHSTIKDIIHKTNDLEIDQSQLIKRNESISASAMRKRNQRLEMIVDKVLNKIFSNVDIIPRRVRSIFSRIRCSLKNFGTIDLEFTQKVVSACFFLRLVCPAIMTPHLFDLLPEYSDNVNINRSFTLVAKCVQNIANFAGIDDTKESYMQSIALHCRDYYNQMSEFINSISTI 1908
            I P+H S+  G+ FC+ +  +GG     S  F+ ++ +ERD  ++ +R  +  +  +    EN L++ I EAK+L  K KY+CE+ LD+++YART+ K+  + L WGE+F+   LP +  +++ ++R    K+K  +   V   NIP+ ++      EKWY   PV  P                           T+++    +P +R K+++  + +L  + Y EF EF+  N   +   +E  I  + +E +  +++ +  S    ++FL+DL++ E   C   D+ +I R N++A+K+IE +LKL  Q YL   L   IK +     + E+D S+        S+S + ++   L+M  +    KI ++  + PR ++ +F+  +   ++ G  D+  +Q+++SA  FLR +CPAIM+P LF+L+ EY D+   +R+ TL+AK +Q++ANF    + KE YM  +       +  M+ F+  IS +
Sbjct:  363 IKPLHSSV-LGQEFCFEVTYLGG-----SKCFSCTSASERDKWMENLRRTVQPNKDNCRRAENVLRLWIIEAKDLPPKKKYFCELCLDDVLYARTTSKQRSDCLFWGEQFEFAGLPTVNSITVHIYRDADKKKKKDKNNYVGLVNIPVHSVSGRQFMEKWY---PVSTP---------------------------TISKAKGGSPSIRLKTRFQTMSILPMEQYKEFAEFVTSNYTMLCSILEPVISVRNKEEMASALVHILQSTGKAKDFLTDLVMSEIDRCADHDV-LIFRENTLATKAIEEYLKLVGQKYLHDALGEFIKALYESDENCEVDPSK-------CSSSELPEQQSNLKMCCELAFCKIINSYCVFPRELKEVFAAWKQQCQSRGKQDI--SQRLISASLFLRFLCPAIMSPSLFNLMQEYPDD-RTSRTLTLIAKVIQSLANFTKFGN-KEEYMAFMNDFLEHEWAGMTRFLLEISNL 804          
BLAST of DAB2 interacting protein b vs. Ensembl Cavefish
Match: rasal2 (ras GTPase-activating protein nGAP [Source:NCBI gene;Acc:103044896])

HSP 1 Score: 228.409 bits (581), Expect = 9.073e-61
Identity = 143/490 (29.18%), Postives = 258/490 (52.65%), Query Frame = 1
Query:  448 IIPIHHSLCFGKRFCYRIVTVGGPNEAKSIVFNSSNQTERDLCIKQIRCAXXXXXXXXXXXXNNLKISIQEAKNLTLKNKYYCEIKLDNLIYARTSVKEMKEILIWGEEFDLMSLPCIEMVSITLWRLPRSKEKHKECQIVSHFNIPIENIDQHCITEKWYSPSPVCLPHSGSKLAHNLTFSAACDIDELPKNNTRTLNQVTDSAPLLRAKSKYSPLKVLDAKYYMEFVEFIKENGINMLREMEAGIKAKYREVLVWSMIQLSISENWVEEFLSDLILKEAQSC---DIKIILRGNSMASKSIEFFLKLECQDYLRQILHSTIKDIIHKTNDLEIDQSQLIKRNESISASAMRKRNQRLEMIVDKVLNKIFSNVDIIPRRVRSIFSRIRCSLKNFGTIDLEFTQKVVSACFFLRLVCPAIMTPHLFDLLPEYSDNVNINRSFTLVAKCVQNIANFAGIDDTKESYMQSIALHCRDYYNQMSEFINSISTI 1908
            I P+H S+  G+ FC+ +  +GG     S  F+ ++ +ERD  ++ +R  +  +  +    EN L++ I EAK+L  K KY+CE+ LD+++YART+ K+  + L WGE+F+   LP +  +++ ++R    K+K  +   V   NIP+ ++      EKWY   PV  P                           T+++    +P +R K+++  + +L  + Y EF EF+  N   +   +E  I  + +E +  +++ +  S    ++FL+DL++ E   C   D+ +I R N++A+K+IE +LKL  Q YL   L   IK +     + E+D S+        S+S + ++   L+M  +    KI ++  + PR ++ +F+  +   ++ G  D+  +Q+++SA  FLR +CPAIM+P LF+L+ EY D+   +R+ TL+AK +Q++ANF    + KE YM  +       +  M+ F+  IS +
Sbjct:  363 IKPLHSSV-LGQEFCFEVTYLGG-----SKCFSCTSASERDKWMENLRRTVQPNKDNCRRAENVLRLWIIEAKDLPPKKKYFCELCLDDVLYARTTSKQRSDCLFWGEQFEFAGLPTVNSITVHIYRDADKKKKKDKNNYVGLVNIPVHSVSGRQFMEKWY---PVSTP---------------------------TISKAKGGSPSIRLKTRFQTMSILPMEQYKEFAEFVTSNYTMLCSILEPVISVRNKEEMASALVHILQSTGKAKDFLTDLVMSEIDRCADHDV-LIFRENTLATKAIEEYLKLVGQKYLHDALGEFIKALYESDENCEVDPSK-------CSSSELPEQQSNLKMCCELAFCKIINSYCVFPRELKEVFAAWKQQCQSRGKQDI--SQRLISASLFLRFLCPAIMSPSLFNLMQEYPDD-RTSRTLTLIAKVIQSLANFTKFGN-KEEYMAFMNDFLEHEWAGMTRFLLEISNL 804          
BLAST of DAB2 interacting protein b vs. Ensembl Cavefish
Match: dab2ipb (DAB2 interacting protein [Source:NCBI gene;Acc:103023248])

HSP 1 Score: 223.016 bits (567), Expect = 2.424e-59
Identity = 145/487 (29.77%), Postives = 247/487 (50.72%), Query Frame = 1
Query:  448 IIPIHHSLCFGKRFCYRIVTVGGPNEAKSIVFNSSNQTERDLCIKQIRCAXXXXXXXXXXXXNNLKISIQEAKNLTLKNKYYCEIKLDNLIYARTSVKEMKEILIWGEEFDLMSLPCIEMVSITLWRLPRSKEKHKECQIVSHFNIPIENIDQHCITEKWYSPSPVCLPHSGSKLAHNLTFSAACDIDELPKNNTRTLNQVTDSAPLLRAKSKYSPLKVLDAKYYMEFVEFIKENGINMLREMEAGIKAKYREVLVWSMIQLSISENWVEEFLSDLILKEAQSC--DIKIILRGNSMASKSIEFFLKLECQDYLRQILHSTIKDIIHKTNDLEIDQSQLIKRNESISASAMRKRNQRLEMIVDKVLNKIFSNVDIIPRRVRSIFSRIRCSLKNFGTIDLEFTQKVVSACFFLRLVCPAIMTPHLFDLLPEYSDNVNINRSFTLVAKCVQNIANFAGIDDTKESYMQSIALHCRDYYNQMSEFINSIS 1902
            I P+H S+  G+ FC+ + T  G     S  F+  +  ERD  ++ +R A+  +  +    EN L++ + EAK+L  K KY+CE+ LD+ +YART+ K   + + WGE F+  +LP ++ +++ L+R    K+K  +   V   +IP+E +    + EKWY   PV  P+                     K  T        + P++R K++Y  + +L  + Y EF E+   N + +   +E  I  K +E +  +++ +  S    ++FL+DL++ E   C  +  +I R N++ +K+IE +LKL  Q YL+  L   IK +     + E+D S+        S + + +    L+M  +    KI S+  + PR ++ +F+  R    N G  D+  +++++SA  FLR +CPAIM+P LF+L  EY D+    R+ TL+AK  QN+ANF    + KE YM  +       +  M  F+  IS
Sbjct:  126 IKPVHSSI-LGQDFCFEVSTSTG-----SKCFSCRSSAERDKWMENLRRAVHPNKDNSRRVENMLRLWVIEAKDLPAKKKYFCELCLDDSLYARTTCKLKADNIFWGEHFEFSNLPAVQNITVHLYRDSEKKKKKDKNNYVGLVSIPVETVTSRQLVEKWY---PVSTPNPS-------------------KGKT--------AGPMIRIKARYQSMNILPMEMYKEFAEYTTNNYMLLCSVLEPAISVKNKEEMACALVHILQSTGKAKDFLTDLMMSEVDRCGENEHLIFRENTLGTKAIEEYLKLVGQKYLQDALGEFIKALYESDENCEVDPSK-------CSPNDLPEHQSNLKMCCELAFCKIISSYCVFPRELKEVFASWRQECGNRGRPDI--SERLISASLFLRFLCPAIMSPSLFNLTQEYPDD-RTARTLTLIAKVTQNLANFTKFGN-KEEYMSFMNQFLEHEWTNMQRFLLEIS 565          
BLAST of DAB2 interacting protein b vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000945.1 (pep scaffold:Pmarinus_7.0:GL477254:323984:383899:1 gene:ENSPMAG00000000852.1 transcript:ENSPMAT00000000945.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 180.259 bits (456), Expect = 2.177e-46
Identity = 136/472 (28.81%), Postives = 233/472 (49.36%), Query Frame = 1
Query:  487 FCYRIVTVGGPNEAKSIVFNSSNQTERDLCIKQIRCAXXXXXXXXXXXXNNLKISIQEAKNLTLKNKYYCEIKLDNLIYARTSVKEMKEILIWGEEFDLMSLPCIEMVSITLWRLPRSKEKHKECQIVSHFNIPIEN-IDQHCITEKWYSPSPVCLPHSGSKLAHNLTFSAACDIDELPKNNTRTLNQVTDSAPLLRAKSKYSPLKVLDAKYYMEFVEFIKENGINMLREMEAGIKAKYREVLVWSMIQLSISENWVEEFLSDLILKEAQSC--DIKIILRGNSMASKSIEFFLKLECQDYLRQILHSTIKDIIHKTNDLEIDQSQLIKRNESISASAMRKRNQRLEMIVDKVLNKIFSNVDIIPRRVRSIFSRIRCSLKNFGTIDLEFTQKVVSACFFLRLVCPAIMTPHLFDLLPEYSDNVNINRSFTLVAKCVQNIANFAGIDDTKESYMQSIALHCRDYYNQMSEFIN 1893
            F  +++T  G     S  F+  +  E+D  ++ +R  +  +  +I   EN+LK+ I EAK L  K KY+CEI LD+ +YART+ K   + L WGE F+  +LP ++ + + L++    K+K ++   V   NI +E         EKWY   P+  P+ G                           +   + P +R K ++  L +L  + Y EF EF+  + + +   +E  +  K +E L  ++++   +   V+EFL++L++ E   C  +  ++ R N++A+K+IE +LK+  Q YL   L       ++ +     D++  ++ ++  SA     RN  L M  +    KI S+  + P  +R +FS  R   +  G    E +++++SA  FLR +CPAIM+P LF L  EY D     R+ TL+AK VQN+ANF    + KE YM  +       + +M +F+ 
Sbjct:    1 FRAQVITSSG-----SKCFSCRSAAEQDKWMENLRRIVQPNKDNIQRVENDLKVWIIEAKELPAKKKYFCEICLDDTLYARTASKAKVDNLFWGEHFEFSNLPAVKHIMVHLYKDTDKKKKKEKSSYVGLVNISVEGGTSGRQFVEKWY---PLSTPNPG---------------------------KGKGAVPTVRIKWRHQQLSILPMERYKEFAEFLSASCLPLCLLLEPVLGVKSKEELARALVRFLHTTGRVKEFLAELVIAEVTRCSENEHLLFRENTLATKAIEEYLKMVGQWYLHDALEGEFVRALYDS-----DENCEVELSKCSSAELADHRNN-LRMCCELAFCKILSSCCVFPAELRDVFSSWRRLCEARGRA--EISERLISASLFLRFLCPAIMSPSLFGLSQEYPDE-RTARTLTLIAKVVQNLANFTKFGN-KEDYMTFMNGFLEQEWGRMKQFLG 427          
BLAST of DAB2 interacting protein b vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010290.1 (pep scaffold:Pmarinus_7.0:GL476446:218476:334684:-1 gene:ENSPMAG00000009276.1 transcript:ENSPMAT00000010290.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 50.447 bits (119), Expect = 2.769e-6
Identity = 60/257 (23.35%), Postives = 109/257 (42.41%), Query Frame = 1
Query: 1240 SENWVEEFLSDLILKEAQSCDIKI-------ILRGNSMASKSI-EFFLKLECQDYLRQILHSTIKDIIH------KTNDLEIDQSQL----------------IKRNESISASAMRKRN----QRLEMIVDKVLNKIFSNVDIIPRRVRSIFSRIRCSLK-NFGTIDLEFTQKVVSACFFLRLVCPAIMTPHLFDLLPEYSDNV---NINRSFTLVAKCVQNIANFAGIDDTKESYMQSIALHCRDYYNQMSEFINS 1896
            + N  EE+L   + K A   +IK        I+ GN    K +  F   +  Q+ ++ +L   +K+II        TN +EI ++ +                +   +++    +RKR     Q L    DKVL+ I + +D IP  +R I   ++ SL+  F     +   K+V    + R + PAI+ P  FD+L   +         RS   VA+ +Q+ A     ++   S+M +++ +    + +  +F  S
Sbjct: 1017 ASNQREEYLLLKLFKSALEEEIKSKVDHLQEIVTGNPTVIKMVVTFHRGVRGQNAMQTLLGPLVKEIIEDKSFNVNTNPVEIYKAWVNQMESQTGEMSNLPYDVTSEQALVHEEVRKRLEISLQSLRTATDKVLSSIIAALDKIPYGMRFIAKVLKNSLQEKFPDATEDDLFKIVGNLLYYRYMNPAIVAPDAFDVLELGAGETLRPEQRRSLAFVARMLQSAAANQRFEEGDASHMGTLSEYTTQAFAKFKKFFQS 1273          
BLAST of DAB2 interacting protein b vs. Ensembl Yeast
Match: BUD2 (GTPase activating factor for Rsr1p/Bud1p; plays a role in spindle position checkpoint distinct from its role in bud site selection; required for both axial and bipolar budding patterns; mutants exhibit random budding in all cell types; contains two PH-like domains [Source:SGD;Acc:S000001575])

HSP 1 Score: 75.8702 bits (185), Expect = 2.769e-14
Identity = 57/230 (24.78%), Postives = 115/230 (50.00%), Query Frame = 1
Query: 1312 ILRGNSMASKSIEFFLKLECQDYLRQILHSTIKDIIHKTNDLEIDQSQLIKRNESISASAMRKRNQRLEMIVDKVLNKIFSNVDIIPRRVRSIFSRIRCSLKNFGTID-LEFTQKVVSACFFLRLVCPAIMTPHLFDLLPEYSDNVN--INRSFTLVAKCVQNIANFAGIDDTKESYMQSIALHCRDYYNQMSEFINSISTINEATFTTKVYDKHTS---PRLAIDSARL 1983
            + RGNS+ +KSIE +      +YL + L + +K+II      E+D +++ +++E      +    +RL   V K+  ++++  + +P  +R++    R  L+     D L+     +S   FLR  CP I+ P LF  +   S N+N    R+ TL++K + N++      + KE ++  +       +N + ++I+ + T  +  F +K+ +  ++   P+LAI+   L
Sbjct:  559 LFRGNSILTKSIEQYFFRVGNEYLSKALSAILKEIIESNKSCELDPARVKEKDEVKKRKIIADNYKRLYSWVTKIWKRLYATSNDLPIEIRNVLKIFRQKLEIICIDDTLQIILNGISGLLFLRFFCPVILNPKLFKYV---SQNLNETARRNLTLISKVLLNLSTLTQFAN-KEPWLMKMNNFIDKRHNDLLDYIDKM-TQKKLDFNSKILNLSSTISRPKLAIEQTML 783          
BLAST of DAB2 interacting protein b vs. Ensembl Yeast
Match: IRA1 (GTPase-activating protein; negatively regulates RAS by converting it from GTP- to the GDP-bound inactive form, required for reducing cAMP levels under nutrient limiting conditions, mediates membrane association of adenylate cyclase; mutations cause catalase T deficiency, defective glycogen synthesis and defective trehalose accumulation; IRA1 has a paralog, IRA2, that arose from the whole genome duplication; defects in human homolog NF1 are associated with neurofibromatosis [Source:SGD;Acc:S000000344])

HSP 1 Score: 48.521 bits (114), Expect = 5.997e-6
Identity = 47/191 (24.61%), Postives = 87/191 (45.55%), Query Frame = 1
Query: 1252 VEEFLSDLILKEAQSCDIKIILRGNSMASKSIEFFLKLECQDYLRQILHSTIKDIIHKTNDLEIDQSQLIKRNESISASAMRKRNQRLEMIVDKVLNKIFSNVDIIPRRVRSIFSRIRC-SLKNFGTIDL-EFTQKVVSACFFLRLVCPAIMTPHLFDLLPEYSDNVNI------NRSFTLVAKCVQNIAN 1800
            V E L   I + A+S DI   LR NS A++++  + +     YL + L   ++ I+      EID+ +    N         K     E  + ++++ I S++D  P  +  I     C ++ N  +++  E+    V +  FLR + PA+++P         S+N+ I       + F  +AK +Q++AN
Sbjct: 1731 VTELLKQEIKRAARSDDI---LRRNSCATRALSLYTRSRGNKYLIKTLRPVLQGIVDNKESFEIDKMKPGSENS-------EKMLDLFEKYMTRLIDAITSSIDDFPIELVDI-----CKTIYNAASVNFPEYAYIAVGSFVFLRFIGPALVSPD--------SENIIIVTHAHDRKPFITLAKVIQSLAN 1898          
BLAST of DAB2 interacting protein b vs. Ensembl Nematostella
Match: EDO35799 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKG2])

HSP 1 Score: 176.022 bits (445), Expect = 6.761e-45
Identity = 130/491 (26.48%), Postives = 245/491 (49.90%), Query Frame = 1
Query:  448 IIPIHHSLCFGKRFCYRIVTVGGPNEAKSIVFNSSNQTERDLCIKQIRCAXXXXXXXXXXXXNNLKISIQEAKNL--TLKNKYYCEIKLDNLIYARTSVKEMKEILIWGEEFDLMSLPCIEMVSITLWRLPRSKEKHKECQIVSHFNIPIENIDQHCITEKWYSPSPVCLPHSGSKLAHNLTFSAACDIDELPKNNTRTLNQVTDSAPLLRAKSKYSPLKVLDAKYYMEFVEFIKENGINMLREMEAGIKAKYREVLVWSMIQLSISENWVEEFLSDLILKEAQ---SCDIKIILRGNSMASKSIEFFLKLECQDYLRQILHSTIKDIIHKTNDLEIDQSQLIKRNESISASAMRKRNQRLEMIVDKVLNKIFSNVDIIPRRVRSIFSRIRCSLKNFGTIDLEFTQKVVSACFFLRLVCPAIMTPHLFDLLPEYSDNVNINRSFTLVAKCVQNIANFAGIDDTKESYMQSIALHCRDYYNQMSEFINSIST 1905
            + PIH S+   ++ C+++ +   P E K   F+  +  E +  +  I+ +I  +       + +L + + EAK    T K +Y+CE+ LD ++YART+ K   + L WGE F    L  +  +++ +++   +K K ++ ++V   NIP+ ++D     EKW+   PV +   G+                             DS  + R K KY  + +L    Y E + ++  N +++   +E+ + +K ++ +   ++++       +EFL D+++ E     S D  ++ RGNS A+K+++ ++K+  +    + L   ++ +   + D E+D ++ +  N SI ++      + L+   +K  N I  +  I P  ++  F   R    N G+ DL  + K++SA  FLR +CPAIM+P LF L+ EY  N  I R+ TL+AK +QN+ANF      KE YM  +    ++ +++M EF+ +IS+
Sbjct:    9 VRPIHPSILH-RQHCFQVTS---PTEVK--YFSCRSAQELNKWVNSIKKSIQPARDQQNRMDISLSVWVCEAKGAMTTPKKRYFCELLLDKMLYARTTSKTKVDTLFWGENFSFDDLLDLSTITVNIYKDLEAKNKKEKRKLVGTVNIPVRDLDSSQEVEKWF---PVDMTTKGN----------------------------ADSGSI-RLKIKYQKIHILPLTTYNEMLSYLSNNYMHLCGTLESAVSSKVKDEIAGVILRVLQPVGKAQEFLVDIVMDEVNRLGSADENLVFRGNSFATKAMDTYMKMVGES---ETLGDFVQSVYAMSEDCEVDPAKSV--NGSIQSN-----QENLKAFAEKAWNHILCSSCIFPCDLQDTFHEFRQRSIN-GSRDL--SNKLISASIFLRFLCPAIMSPSLFHLVQEYP-NERILRTLTLIAKVIQNLANFTKFGG-KEDYMGFMNDFVQNEFDKMREFVATISS 446          
BLAST of DAB2 interacting protein b vs. Ensembl Nematostella
Match: EDO36190 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJB4])

HSP 1 Score: 91.2781 bits (225), Expect = 1.027e-18
Identity = 105/436 (24.08%), Postives = 191/436 (43.81%), Query Frame = 1
Query:  637 NLKISIQEAKNLTLKNKY---YCEIKLDNLIYARTSVKEMKEILIWGEEFDLMSLPC-IEMVSITLWRLPRSKEKHKECQIVSHFNIPIENIDQHCITEKWYSPSPVCLPHSGSKLAHNLTFSAACDIDELPKNNTRTLNQVTDSAPLLRAKSKYSPLKVLDAKYYMEFVEFIKENGINMLREMEAGIKAKYREVLVWSMIQLSISENWVEEFLSDLILKEAQSCDIKIIL-RGNSMASKSIEFFLKLECQDYLRQILHSTIKDIIHKTNDLEIDQS-QLIKRNESISASAMRKRNQRLEMIVDKVLNKIFSNVDIIPRRVRSIFSRIRCSLKNFGTIDLEFTQKVVSACFFLRLVCPAIMTPHLFDLLPEYSDNVNINRSFTLVAKCVQNIANFAGIDDTKESYMQSIALHCRDYYNQMSEFINSISTINEATFT 1926
            +L++++ EA  L L NK    YC + L+ +   RT   E +  L W EEF    LP  +   +++L+    +K    +  ++ H  +P+  + +    + WY   P+     G     N+                             R + K++   ++  + Y    E + +  +  +  +  G   K R VL  +++++   E      L  +  +E +  D +  L RG S+A+  ++ ++K+    YL+     TIKD+I K   LE  QS +L        A  +    Q LE + + + + IF++ +  P+ +R +F  ++ ++K+    +     +VVS   FLRL CPAIM P   +L+ E   +    R+ TLVAKC+Q +AN       KES M  +    +    +M  F++ +S + E   T
Sbjct:  237 SLELNVIEAHKLPL-NKVSHPYCMVSLNEVKTCRTKTFEGQTPL-WNEEFKFNDLPSDVSSFTLSLY----NKSWRTKDVLIGHVLVPLNKLPKGQTVDDWY---PLAAASHGKAEVGNV-----------------------------RIRVKFTHEIIMPVEEYEALKEILLDEDLVAVTAL--GQVCKDRVVLASTLLKIFRHEKQEIFLLKTMNAREIEKQDEQATLFRGASLATSLMDQYMKMVAIPYLQH----TIKDVILKI--LECKQSCELNPAKMEKGADTVVNLKQLLEFLFEAI-DAIFTSAEECPKTLRYLFGCLQQNVKDKWADNQTVRTRVVSGFLFLRLFCPAIMNPKTCNLMSELP-SATAARTLTLVAKCLQKLANLVEF-GAKESCMTPVNPFMQKNRERMVSFMDELSDVRECPKT 623          
BLAST of DAB2 interacting protein b vs. Ensembl Nematostella
Match: EDO43446 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYE3])

HSP 1 Score: 81.6481 bits (200), Expect = 1.042e-15
Identity = 75/306 (24.51%), Postives = 136/306 (44.44%), Query Frame = 1
Query: 1018 PKNNTRTLNQVTDSAPLLRAKSKYSPLKVLDAKYYMEFVEFIKE-NGINMLREMEAGIKA---KYREVLVWSMIQLSISENWVEEFLSDLILKEAQS-CDIKIILRGNSMASKSIEFFLKLECQDYLRQILHSTIKDIIHKTNDLEIDQSQLIKRNESISASAMRKRNQRLEMIVDKVLNKIFSNVDIIPRRVRSIFSRIRCSLKNFGTIDLEFTQKVVSACFFLRLVCPAIMTPHLFDLLPEYSDNVNINRSFTLVAKCVQNIANFAG---IDDTKESYMQSIALHC--RDYYNQMSEFINSIST 1905
            P+    +  Q   S   LR K  Y+   V  + YY    E I E  G   +    A I +   K +     +++++    N V +F+  ++  E  +  D   + RGNS+ +K+I+ F+K     YL + + + + +I  +    EID S+L          ++ +    L+  V+K+   I  +    P  +  +F  IR S     + + +     VS   FLR   PAI+ P LF +  E+ D + + R+ TL +K +Q++ N          KE YM+S+      +D+   +  F+++IS+
Sbjct:  259 PREERDSPAQRQGSIGSLRLKVCYTEDYVFPSSYYEPLREAILEIEGHKDVTTTPAYILSEIVKDKLTAARALVRVFTHHNKVVDFIKAVVDHEVNTTADCNTLFRGNSLGTKAIDEFMKHAGMQYLHETIKTLVDEIYEERKCCEIDPSRL------RDGDSLPQNLANLQGYVNKLCAAITCSAMACPTAMSKVFVTIRESAVQRFSDEPDVRYTAVSGFVFLRFFAPAILNPKLFQMRNEHPDPL-VARTLTLASKAIQSLGNLVSSVICGQVKEPYMESLKAMILDQDHITAVKRFLDAISS 557          
BLAST of DAB2 interacting protein b vs. Ensembl Nematostella
Match: EDO40933 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5U4])

HSP 1 Score: 53.9138 bits (128), Expect = 3.110e-7
Identity = 60/259 (23.17%), Postives = 118/259 (45.56%), Query Frame = 1
Query: 1204 EVLVWSMIQLSISENWVEEFLSDLILKEAQSCDIKIILRGNSMASKSIEFFLKL-ECQDYLRQILHSTIKDIIHKTN-DLEI--------------DQSQLIKRNESISASAMRK---RNQRLEMIVDKVLNKIFSNVDIIPRRVRSIFSRIR-CSLKNFGTIDLEFTQKVVSACFFLRLVCPAIMTPHLFDLL---PEYSDNVNINRSFTLVAKCVQNIANFAGIDDT-KESYMQSIALHCRDYYNQMSEFINSISTI 1908
            E L+ SM +L++   +            A+S +   +LR N+  S+ +  + +    Q+YL+  L   + D++ + +  LEI              D+S L           M +   R ++L+ I    L  I S++  +P  ++ +   I+  +++ F     E    ++   F LR + PAI+TP  + L+   P Y+    + R+ TL+AK +Q++AN   +    KE YMQ +     ++ + M  F++ +S++
Sbjct:  133 EYLLLSMFELALKYEF------------AESENFNSLLRANTAISRMMTTYTRRGPGQEYLKCTLEEPLNDLMSQEDLVLEINPIKVYIELYGHPMDESSLTLERAMDDPEVMFRTKLRIKKLQDISSLFLGIIISSLSQVPYGIQWLCRAIKELAMEKFPEATPEQINAMIGGFFLLRFINPAIVTPTAYMLVNKQPTYT----MRRNLTLIAKILQSMANKNVVSSHFKEEYMQPLQPFAINHVDLMQSFLSDLSSV 375          
BLAST of DAB2 interacting protein b vs. Ensembl Medaka
Match: ENSORLT00000022035.2 (disabled homolog 2-interacting protein-like [Source:NCBI gene;Acc:101175325])

HSP 1 Score: 233.417 bits (594), Expect = 7.990e-63
Identity = 148/487 (30.39%), Postives = 246/487 (50.51%), Query Frame = 1
Query:  448 IIPIHHSLCFGKRFCYRIVTVGGPNEAKSIVFNSSNQTERDLCIKQIRCAXXXXXXXXXXXXNNLKISIQEAKNLTLKNKYYCEIKLDNLIYARTSVKEMKEILIWGEEFDLMSLPCIEMVSITLWRLPRSKEKHKECQIVSHFNIPIENIDQHCITEKWYSPSPVCLPHSGSKLAHNLTFSAACDIDELPKNNTRTLNQVTDSAPLLRAKSKYSPLKVLDAKYYMEFVEFIKENGINMLREMEAGIKAKYREVLVWSMIQLSISENWVEEFLSDLILKEAQSC--DIKIILRGNSMASKSIEFFLKLECQDYLRQILHSTIKDIIHKTNDLEIDQSQLIKRNESISASAMRKRNQRLEMIVDKVLNKIFSNVDIIPRRVRSIFSRIRCSLKNFGTIDLEFTQKVVSACFFLRLVCPAIMTPHLFDLLPEYSDNVNINRSFTLVAKCVQNIANFAGIDDTKESYMQSIALHCRDYYNQMSEFINSIS 1902
            I P+H SL  G+ +C+ + T  G     +  F+  +  ERD  ++ +R A+  +  +    EN L + + EAK+L  K +Y+CE+ LD+ +YARTS K   + + WGE FD  SLP +  +++ L++    K K  +   V   NIP+  +    + EKWYS S                              T +  +   S P +R K++Y  + +L  + Y EF E+I  N + +   +EA I  + +E L  +++ +  S    ++FL+DL++ E   C  + ++I R N++A+KSIE +LKL  Q YL+  L   IK +     + E+D ++        S S + +    L M  +    KI  +  + PR ++ +F+  R    N G  D+  +++++SA  FLR +CPA+M+P LFDL+ EY D     R+ TL+AK +QN+ANF+    TKE YM  +       ++ M  F+  IS
Sbjct:   31 IKPVHSSL-LGQDYCFEVTTSTG-----TKCFSCRSAAERDKWMENLRRAVHPNKDNSRRLENVLTVWVIEAKDLPAKKRYFCELCLDDSLYARTSCKLKTDNIFWGEHFDFCSLPSVNSITLHLYKDTDRKRKKDKSSYVGLVNIPVSTVTGRQLVEKWYSVS------------------------------TPSTIRGKSSIPNVRVKARYQSIIILPMEQYKEFAEYISSNYLLLCSTLEASISLRAKEELAAALVHILHSTGKAKDFLTDLMMSEVDRCRDNDQLIFRENTLATKSIEEYLKLIGQKYLQDALGEFIKALYESDENCEVDPAR-------CSTSDLAEHQANLRMCCELAFCKILDSYRVFPRELKEVFASWRQECSNRGRPDI--SERLISASLFLRFLCPAVMSPSLFDLMQEYPDE-RTARTLTLIAKVIQNLANFSKF-GTKEEYMLFMNDFVERQWSSMQRFLQEIS 470          
BLAST of DAB2 interacting protein b vs. Ensembl Medaka
Match: rasal2 (RAS protein activator like 2 [Source:NCBI gene;Acc:101155962])

HSP 1 Score: 227.254 bits (578), Expect = 1.192e-60
Identity = 149/488 (30.53%), Postives = 249/488 (51.02%), Query Frame = 1
Query:  448 IIPIHHSLCFGKRFCYRIVTVGGPNEAKSIVFNSSNQTERDLCIKQIRCAXXXXXXXXXXXXNNLKISIQEAKNLTLKNKYYCEIKLDNLIYARTSVKEMKEILIWGEEFDLMSLPCIEMVSITLWRLPRSKEKHKECQIVSHFNIPIENIDQHCITEKWYSPSPVCLPHSGSKLAHNLTFSAACDIDELPKNNTRTLNQVTDSAPLLRAKSKYSPLKVLDAKYYMEFVEFIKENGINMLREMEAGIKAKYREVLVWSMIQLSISENWVEEFLSDLILKEAQSC---DIKIILRGNSMASKSIEFFLKLECQDYLRQILHSTIKDIIHKTNDLEIDQSQLIKRNESISASAMRKRNQRLEMIVDKVLNKIFSNVDIIPRRVRSIFSRIRCSLKNFGTIDLEFTQKVVSACFFLRLVCPAIMTPHLFDLLPEYSDNVNINRSFTLVAKCVQNIANFAGIDDTKESYMQSIALHCRDYYNQMSEFINSIS 1902
            + P+H S+  G+ FC+ +   GG     S  F+ ++  ERD  ++ +R  I  +  +    EN L++ I EAK+L  K KY+CE+ LD+++YART+ K   + L WGE FD  SLP +  +++ ++R    K+K  +   V   NIP+ ++      EKWY   PV  P                           T+++V    P +R KS++  + +L  + Y EF EFI  N   +   +E  I  K +E +  +++ +  S    ++FL+DL++ E   C   D+ +I R N++A+K+IE +LKL  Q YL   L   IK +     D E+D S+        S S + +    L+M  +    KI ++  + PR ++ +F+  +      G +  + +++++SA  FLR +CPAIM+P LF L+ EY D+   +R+ TL+AK +QN+ANF    + KE YM  +       +  M  F++ IS
Sbjct:  100 VKPLHSSI-LGRDFCFEVTYSGG-----SKCFSCTSAAERDKWMENLRRTIQPNKDNRRRAENLLRLWIIEAKDLPPKKKYFCELCLDDILYARTTSKTRHDSLFWGEYFDFSSLPSVHSITVHIYRDVDKKKKKDKNNYVGLVNIPVSSMTGRQFVEKWY---PVSTP---------------------------TVSKVKGGGPSIRIKSRFQTISILPMEQYKEFAEFITNNYSMLCTVLEPVISVKNKEEMACALVHILQSTGRAKDFLTDLVMSEVDRCADHDV-LIFRENTLATKAIEEYLKLVGQKYLHDALGEFIKALYESDEDCEVDPSR-------CSGSDLTEHRSNLKMCCELAFCKIINSYCVFPRELKEVFASWKQQCVARGHVQ-DISKRLISASLFLRFLCPAIMSPSLFSLMQEYPDD-RTSRNLTLIAKVIQNLANFTKFGN-KEEYMAFMNDFLEHEWAGMMRFLSEIS 540          
BLAST of DAB2 interacting protein b vs. Ensembl Medaka
Match: rasal2 (RAS protein activator like 2 [Source:NCBI gene;Acc:101155962])

HSP 1 Score: 226.483 bits (576), Expect = 3.696e-60
Identity = 149/488 (30.53%), Postives = 249/488 (51.02%), Query Frame = 1
Query:  448 IIPIHHSLCFGKRFCYRIVTVGGPNEAKSIVFNSSNQTERDLCIKQIRCAXXXXXXXXXXXXNNLKISIQEAKNLTLKNKYYCEIKLDNLIYARTSVKEMKEILIWGEEFDLMSLPCIEMVSITLWRLPRSKEKHKECQIVSHFNIPIENIDQHCITEKWYSPSPVCLPHSGSKLAHNLTFSAACDIDELPKNNTRTLNQVTDSAPLLRAKSKYSPLKVLDAKYYMEFVEFIKENGINMLREMEAGIKAKYREVLVWSMIQLSISENWVEEFLSDLILKEAQSC---DIKIILRGNSMASKSIEFFLKLECQDYLRQILHSTIKDIIHKTNDLEIDQSQLIKRNESISASAMRKRNQRLEMIVDKVLNKIFSNVDIIPRRVRSIFSRIRCSLKNFGTIDLEFTQKVVSACFFLRLVCPAIMTPHLFDLLPEYSDNVNINRSFTLVAKCVQNIANFAGIDDTKESYMQSIALHCRDYYNQMSEFINSIS 1902
            + P+H S+  G+ FC+ +   GG     S  F+ ++  ERD  ++ +R  I  +  +    EN L++ I EAK+L  K KY+CE+ LD+++YART+ K   + L WGE FD  SLP +  +++ ++R    K+K  +   V   NIP+ ++      EKWY   PV  P                           T+++V    P +R KS++  + +L  + Y EF EFI  N   +   +E  I  K +E +  +++ +  S    ++FL+DL++ E   C   D+ +I R N++A+K+IE +LKL  Q YL   L   IK +     D E+D S+        S S + +    L+M  +    KI ++  + PR ++ +F+  +      G +  + +++++SA  FLR +CPAIM+P LF L+ EY D+   +R+ TL+AK +QN+ANF    + KE YM  +       +  M  F++ IS
Sbjct:  234 VKPLHSSI-LGRDFCFEVTYSGG-----SKCFSCTSAAERDKWMENLRRTIQPNKDNRRRAENLLRLWIIEAKDLPPKKKYFCELCLDDILYARTTSKTRHDSLFWGEYFDFSSLPSVHSITVHIYRDVDKKKKKDKNNYVGLVNIPVSSMTGRQFVEKWY---PVSTP---------------------------TVSKVKGGGPSIRIKSRFQTISILPMEQYKEFAEFITNNYSMLCTVLEPVISVKNKEEMACALVHILQSTGRAKDFLTDLVMSEVDRCADHDV-LIFRENTLATKAIEEYLKLVGQKYLHDALGEFIKALYESDEDCEVDPSR-------CSGSDLTEHRSNLKMCCELAFCKIINSYCVFPRELKEVFASWKQQCVARGHVQ-DISKRLISASLFLRFLCPAIMSPSLFSLMQEYPDD-RTSRNLTLIAKVIQNLANFTKFGN-KEEYMAFMNDFLEHEWAGMMRFLSEIS 674          
BLAST of DAB2 interacting protein b vs. Ensembl Medaka
Match: dab2ipb (DAB2 interacting protein [Source:NCBI gene;Acc:101160924])

HSP 1 Score: 216.468 bits (550), Expect = 4.114e-57
Identity = 145/487 (29.77%), Postives = 243/487 (49.90%), Query Frame = 1
Query:  448 IIPIHHSLCFGKRFCYRIVTVGGPNEAKSIVFNSSNQTERDLCIKQIRCAXXXXXXXXXXXXNNLKISIQEAKNLTLKNKYYCEIKLDNLIYARTSVKEMKEILIWGEEFDLMSLPCIEMVSITLWRLPRSKEKHKECQIVSHFNIPIENIDQHCITEKWYSPSPVCLPHSGSKLAHNLTFSAACDIDELPKNNTRTLNQVTDSAPLLRAKSKYSPLKVLDAKYYMEFVEFIKENGINMLREMEAGIKAKYREVLVWSMIQLSISENWVEEFLSDLILKEAQSC--DIKIILRGNSMASKSIEFFLKLECQDYLRQILHSTIKDIIHKTNDLEIDQSQLIKRNESISASAMRKRNQRLEMIVDKVLNKIFSNVDIIPRRVRSIFSRIRCSLKNFGTIDLEFTQKVVSACFFLRLVCPAIMTPHLFDLLPEYSDNVNINRSFTLVAKCVQNIANFAGIDDTKESYMQSIALHCRDYYNQMSEFINSIS 1902
            I P+H S+  G+ +C+ + T  G     S  F+  +  ERD  ++ +R A+  +  +    EN L++ I EAK+L  K KY+CE+ LD  +YART+ K   + + WGE F+  +LP +  ++  L++    K+K  +   +   NI +  +      EKWY   PV  P+                    PK  T        S P++R K++Y  + +L  + Y EF E+I  N + +   +E  I  K +E +  +++ +  S    ++FL+DL++ E   C  +  +I R N++A+K+IE +LKL  Q YL+  L   IK +     + E+D S+        S+S +      L+M  +    KI  +    PR ++ +F+  R    + G  D+  +++++SA  FLR +CPAIM+P LF+L  EY D+    R+ TL+AK  QN+ANF    + KE YM  +       ++ M  F+  IS
Sbjct:  101 IKPVHSSI-LGQDYCFEVTTSTG-----SKCFSCRSAAERDKWMENLRRAVQPNKDNSRRVENILRLWIIEAKDLPAKKKYFCELCLDESLYARTTCKLKTDNVFWGEHFEFSNLPAVRSITAHLYKDTDKKKKKDKNNYIGLVNISVAAVSGRQFMEKWY---PVSTPNP-------------------PKGKT--------SGPMIRIKARYQSMSILPMEMYKEFAEYITNNYMLLCSVLEPAISVKSKEEMACALVHILQSTGKAKDFLTDLMMSEVDRCGENEHLIFRENTLATKAIEEYLKLVGQKYLQDTLGEFIKALYESDENCEVDPSK-------CSSSDLPDHQSNLKMCCELAFCKIIKSYCFFPRELKEVFASWRQECSSRGRPDI--SERLISASLFLRFLCPAIMSPSLFNLTQEYPDD-RTARTLTLIAKVTQNLANFTNFGN-KEEYMSFMNQFLEHEWSDMQRFLLEIS 540          
BLAST of DAB2 interacting protein b vs. Ensembl Medaka
Match: dab2ipb (DAB2 interacting protein [Source:NCBI gene;Acc:101160924])

HSP 1 Score: 216.083 bits (549), Expect = 4.558e-57
Identity = 145/487 (29.77%), Postives = 243/487 (49.90%), Query Frame = 1
Query:  448 IIPIHHSLCFGKRFCYRIVTVGGPNEAKSIVFNSSNQTERDLCIKQIRCAXXXXXXXXXXXXNNLKISIQEAKNLTLKNKYYCEIKLDNLIYARTSVKEMKEILIWGEEFDLMSLPCIEMVSITLWRLPRSKEKHKECQIVSHFNIPIENIDQHCITEKWYSPSPVCLPHSGSKLAHNLTFSAACDIDELPKNNTRTLNQVTDSAPLLRAKSKYSPLKVLDAKYYMEFVEFIKENGINMLREMEAGIKAKYREVLVWSMIQLSISENWVEEFLSDLILKEAQSC--DIKIILRGNSMASKSIEFFLKLECQDYLRQILHSTIKDIIHKTNDLEIDQSQLIKRNESISASAMRKRNQRLEMIVDKVLNKIFSNVDIIPRRVRSIFSRIRCSLKNFGTIDLEFTQKVVSACFFLRLVCPAIMTPHLFDLLPEYSDNVNINRSFTLVAKCVQNIANFAGIDDTKESYMQSIALHCRDYYNQMSEFINSIS 1902
            I P+H S+  G+ +C+ + T  G     S  F+  +  ERD  ++ +R A+  +  +    EN L++ I EAK+L  K KY+CE+ LD  +YART+ K   + + WGE F+  +LP +  ++  L++    K+K  +   +   NI +  +      EKWY   PV  P+                    PK  T        S P++R K++Y  + +L  + Y EF E+I  N + +   +E  I  K +E +  +++ +  S    ++FL+DL++ E   C  +  +I R N++A+K+IE +LKL  Q YL+  L   IK +     + E+D S+        S+S +      L+M  +    KI  +    PR ++ +F+  R    + G  D+  +++++SA  FLR +CPAIM+P LF+L  EY D+    R+ TL+AK  QN+ANF    + KE YM  +       ++ M  F+  IS
Sbjct:   44 IKPVHSSI-LGQDYCFEVTTSTG-----SKCFSCRSAAERDKWMENLRRAVQPNKDNSRRVENILRLWIIEAKDLPAKKKYFCELCLDESLYARTTCKLKTDNVFWGEHFEFSNLPAVRSITAHLYKDTDKKKKKDKNNYIGLVNISVAAVSGRQFMEKWY---PVSTPNP-------------------PKGKT--------SGPMIRIKARYQSMSILPMEMYKEFAEYITNNYMLLCSVLEPAISVKSKEEMACALVHILQSTGKAKDFLTDLMMSEVDRCGENEHLIFRENTLATKAIEEYLKLVGQKYLQDTLGEFIKALYESDENCEVDPSK-------CSSSDLPDHQSNLKMCCELAFCKIIKSYCFFPRELKEVFASWRQECSSRGRPDI--SERLISASLFLRFLCPAIMSPSLFNLTQEYPDD-RTARTLTLIAKVTQNLANFTNFGN-KEEYMSFMNQFLEHEWSDMQRFLLEIS 483          
BLAST of DAB2 interacting protein b vs. Planmine SMEST
Match: SMESG000000171.1 (SMESG000000171.1)

HSP 1 Score: 1577.76 bits (4084), Expect = 0.000e+0
Identity = 865/868 (99.65%), Postives = 865/868 (99.65%), Query Frame = 1
Query:  109 MSRKAIKHLISIEPQSCTSEISSAXXXXXXXXXXXXXXXXXXXAHGFSYSLRDFSCSTDELLDISLKSTLLINEQYNIIYASNQNISREQKLISFRNGETKKMEAVNFISVSKIIPIHHSLCFGKRFCYRIVTVGGPNEAKSIVFNSSNQTERDLCIKQIRCAXXXXXXXXXXXXNNLKISIQEAKNLTLKNKYYCEIKLDNLIYARTSVKEMKEILIWGEEFDLMSLPCIEMVSITLWRLPRSKEKHKECQIVSHFNIPIENIDQHCITEKWYSPSPVCLPHSGSKLAHNLTFSAACDIDELPKNNTRTLNQVTDSAPLLRAKSKYSPLKVLDAKYYMEFVEFIKENGINMLREMEAGIKAKYREVLVWSMIQLSISENWVEEFLSDLILKEAQSCDIKIILRGNSMASKSIEFFLKLECQDYLRQILHSTIKDIIHKTNDLEIDQSQLIKRNESISASAMRKRNQRLEMIVDKVLNKIFSNVDIIPRRVRSIFSRIRCSLKNFGTIDLEFTQKVVSACFFLRLVCPAIMTPHLFDLLPEYSDNVNINRSFTLVAKCVQNIANFAGIDDTKESYMQSIALHCRDYYNQMSEFINSISTINEATFTTKVYDKHTSPRLAIDSARLSYNIEYHLSTLQTNKYTTLQLEVKEIIDRIKXXXXXXXXXXXXXXKMRQNYEYNDIGKTVVSTIESSGYFSTNGPYLGXXXXXXXXXXXXXXXXXXXXXXXXPQFLNKHTNMMPISCPSVSESHCNNTVMMDEDPISLRKIIIHEKKRIQLLKELVDNLQFTNAAEAETIDLSSKNLNINIEKVAESKSNVLKYIDFVXXXXXXXXXXXXXXXHDSLLKQFIKINAELQSILIKSSAENSNQQ 2712
            MSRKAIKHLISIEPQSCTSEISSASFFQKNNKYSKFSNKSKSNAHGFSYSLRDFSCSTDELLDISLKST LINEQYNIIYASNQNISREQKLISFRNGETKKMEAVNFISVSKIIPIHHSLCFGKRFCYRIVTVGGPNEAKSIVFNSSNQTERDLCIKQIRCAISESLSSIIFEENNLKISIQEAKNLTLKNKYYCEIKLDNLIYARTSVKEMKEILIWGEEFDLMSLPCIEMVSITLWRLPRSKEKHKECQIVSHFNIPIENIDQHCITEKWYSPSPVCLPHSGSKLAHNLTFSAACDIDELPKNNTRTLNQVTDSAPLLRAKSKYSPLKVLDAKYYMEFVEFIKENGINMLREMEAGIKAKYREVLVWSMIQLSISENWVEEFLSDLILKEAQSCDIKIILRGNSMASKSIEFFLKLECQDYLRQILHSTIKDIIHKTNDLEIDQSQLIKRNESISASAMRKRNQRLEMIVDKVLNKIFSNVDIIPRRVRSIFSRIRCSLKNFGTIDLEFTQKVVSACFFLRLVCPAIMTPHLFDLLPEYSDNVNINRSFTLVAKCVQNIANFAGIDDTKESYMQSIALHCRDYYNQMSEFINSISTINEATFTTKVYDKHTSPRLAIDSARLSYNIEYHLSTLQTNKYTTLQLEVKEIIDRIKENEINISEENDTIEKMRQNYEYNDIGKTVVSTIESSGYFSTNGPYLGSVNSNLNHSPSSSLSAISHLK  SPQFLNKHTNMMPISCPSVSESHCNNTVMMDEDPISLRKIIIHEKKRIQLLKELVDNLQFTNAAEAETIDLSSKNLNINIEKVAESKSNVLKYIDFVSNNLNSFQLSQNASSHDSLLKQFIKINAELQSILIKSSAENSNQQ
Sbjct:    1 MSRKAIKHLISIEPQSCTSEISSASFFQKNNKYSKFSNKSKSNAHGFSYSLRDFSCSTDELLDISLKSTRLINEQYNIIYASNQNISREQKLISFRNGETKKMEAVNFISVSKIIPIHHSLCFGKRFCYRIVTVGGPNEAKSIVFNSSNQTERDLCIKQIRCAISESLSSIIFEENNLKISIQEAKNLTLKNKYYCEIKLDNLIYARTSVKEMKEILIWGEEFDLMSLPCIEMVSITLWRLPRSKEKHKECQIVSHFNIPIENIDQHCITEKWYSPSPVCLPHSGSKLAHNLTFSAACDIDELPKNNTRTLNQVTDSAPLLRAKSKYSPLKVLDAKYYMEFVEFIKENGINMLREMEAGIKAKYREVLVWSMIQLSISENWVEEFLSDLILKEAQSCDIKIILRGNSMASKSIEFFLKLECQDYLRQILHSTIKDIIHKTNDLEIDQSQLIKRNESISASAMRKRNQRLEMIVDKVLNKIFSNVDIIPRRVRSIFSRIRCSLKNFGTIDLEFTQKVVSACFFLRLVCPAIMTPHLFDLLPEYSDNVNINRSFTLVAKCVQNIANFAGIDDTKESYMQSIALHCRDYYNQMSEFINSISTINEATFTTKVYDKHTSPRLAIDSARLSYNIEYHLSTLQTNKYTTLQLEVKEIIDRIKENEINISEENDTIEKMRQNYEYNDIGKTVVSTIESSGYFSTNGPYLGSVNSNLNHSPSSSLSAISHLKFSSPQFLNKHTNMMPISCPSVSESHCNNTVMMDEDPISLRKIIIHEKKRIQLLKELVDNLQFTNAAEAETIDLSSKNLNINIEKVAESKSNVLKYIDFVSNNLNSFQLSQNASSHDSLLKQFIKINAELQSILIKSSAENSNQQ 868          
BLAST of DAB2 interacting protein b vs. Planmine SMEST
Match: SMESG000000171.1 (SMESG000000171.1)

HSP 1 Score: 1514.98 bits (3921), Expect = 0.000e+0
Identity = 813/816 (99.63%), Postives = 813/816 (99.63%), Query Frame = 1
Query:  265 DFSCSTDELLDISLKSTLLINEQYNIIYASNQNISREQKLISFRNGETKKMEAVNFISVSKIIPIHHSLCFGKRFCYRIVTVGGPNEAKSIVFNSSNQTERDLCIKQIRCAXXXXXXXXXXXXNNLKISIQEAKNLTLKNKYYCEIKLDNLIYARTSVKEMKEILIWGEEFDLMSLPCIEMVSITLWRLPRSKEKHKECQIVSHFNIPIENIDQHCITEKWYSPSPVCLPHSGSKLAHNLTFSAACDIDELPKNNTRTLNQVTDSAPLLRAKSKYSPLKVLDAKYYMEFVEFIKENGINMLREMEAGIKAKYREVLVWSMIQLSISENWVEEFLSDLILKEAQSCDIKIILRGNSMASKSIEFFLKLECQDYLRQILHSTIKDIIHKTNDLEIDQSQLIKRNESISASAMRKRNQRLEMIVDKVLNKIFSNVDIIPRRVRSIFSRIRCSLKNFGTIDLEFTQKVVSACFFLRLVCPAIMTPHLFDLLPEYSDNVNINRSFTLVAKCVQNIANFAGIDDTKESYMQSIALHCRDYYNQMSEFINSISTINEATFTTKVYDKHTSPRLAIDSARLSYNIEYHLSTLQTNKYTTLQLEVKEIIDRIKXXXXXXXXXXXXXXKMRQNYEYNDIGKTVVSTIESSGYFSTNGPYLGXXXXXXXXXXXXXXXXXXXXXXXXPQFLNKHTNMMPISCPSVSESHCNNTVMMDEDPISLRKIIIHEKKRIQLLKELVDNLQFTNAAEAETIDLSSKNLNINIEKVAESKSNVLKYIDFVXXXXXXXXXXXXXXXHDSLLKQFIKINAELQSILIKSSAENSNQQ 2712
            DFSCSTDELLDISLKST LINEQYNIIYASNQNISREQKLISFRNGETKKMEAVNFISVSKIIPIHHSLCFGKRFCYRIVTVGGPNEAKSIVFNSSNQTERDLCIKQIRCAISESLSSIIFEENNLKISIQEAKNLTLKNKYYCEIKLDNLIYARTSVKEMKEILIWGEEFDLMSLPCIEMVSITLWRLPRSKEKHKECQIVSHFNIPIENIDQHCITEKWYSPSPVCLPHSGSKLAHNLTFSAACDIDELPKNNTRTLNQVTDSAPLLRAKSKYSPLKVLDAKYYMEFVEFIKENGINMLREMEAGIKAKYREVLVWSMIQLSISENWVEEFLSDLILKEAQSCDIKIILRGNSMASKSIEFFLKLECQDYLRQILHSTIKDIIHKTNDLEIDQSQLIKRNESISASAMRKRNQRLEMIVDKVLNKIFSNVDIIPRRVRSIFSRIRCSLKNFGTIDLEFTQKVVSACFFLRLVCPAIMTPHLFDLLPEYSDNVNINRSFTLVAKCVQNIANFAGIDDTKESYMQSIALHCRDYYNQMSEFINSISTINEATFTTKVYDKHTSPRLAIDSARLSYNIEYHLSTLQTNKYTTLQLEVKEIIDRIKENEINISEENDTIEKMRQNYEYNDIGKTVVSTIESSGYFSTNGPYLGSVNSNLNHSPSSSLSAISHLK  SPQFLNKHTNMMPISCPSVSESHCNNTVMMDEDPISLRKIIIHEKKRIQLLKELVDNLQFTNAAEAETIDLSSKNLNINIEKVAESKSNVLKYIDFVSNNLNSFQLSQNASSHDSLLKQFIKINAELQSILIKSSAENSNQQ
Sbjct:   17 DFSCSTDELLDISLKSTRLINEQYNIIYASNQNISREQKLISFRNGETKKMEAVNFISVSKIIPIHHSLCFGKRFCYRIVTVGGPNEAKSIVFNSSNQTERDLCIKQIRCAISESLSSIIFEENNLKISIQEAKNLTLKNKYYCEIKLDNLIYARTSVKEMKEILIWGEEFDLMSLPCIEMVSITLWRLPRSKEKHKECQIVSHFNIPIENIDQHCITEKWYSPSPVCLPHSGSKLAHNLTFSAACDIDELPKNNTRTLNQVTDSAPLLRAKSKYSPLKVLDAKYYMEFVEFIKENGINMLREMEAGIKAKYREVLVWSMIQLSISENWVEEFLSDLILKEAQSCDIKIILRGNSMASKSIEFFLKLECQDYLRQILHSTIKDIIHKTNDLEIDQSQLIKRNESISASAMRKRNQRLEMIVDKVLNKIFSNVDIIPRRVRSIFSRIRCSLKNFGTIDLEFTQKVVSACFFLRLVCPAIMTPHLFDLLPEYSDNVNINRSFTLVAKCVQNIANFAGIDDTKESYMQSIALHCRDYYNQMSEFINSISTINEATFTTKVYDKHTSPRLAIDSARLSYNIEYHLSTLQTNKYTTLQLEVKEIIDRIKENEINISEENDTIEKMRQNYEYNDIGKTVVSTIESSGYFSTNGPYLGSVNSNLNHSPSSSLSAISHLKFSSPQFLNKHTNMMPISCPSVSESHCNNTVMMDEDPISLRKIIIHEKKRIQLLKELVDNLQFTNAAEAETIDLSSKNLNINIEKVAESKSNVLKYIDFVSNNLNSFQLSQNASSHDSLLKQFIKINAELQSILIKSSAENSNQQ 832          
BLAST of DAB2 interacting protein b vs. Planmine SMEST
Match: SMESG000043888.1 (SMESG000043888.1)

HSP 1 Score: 273.092 bits (697), Expect = 1.379e-75
Identity = 165/501 (32.93%), Postives = 275/501 (54.89%), Query Frame = 1
Query:  640 LKISIQEAKNLTLKNKYYCEIKLDNLIYARTSVKEMKEILIWGEEFDLMSLPCIEMVSITLWRLPRSKEKHKECQIVSHFNIPIENIDQHCITEKWYSPSPVCLPHSGSKLAHN-LTFSAACDIDELPKNNTRTLNQVTDSAPLLRAKSKYSPLKVLDAKYYMEFVEFIKENGINMLREMEAGIKAKYREVLVWSMIQLSISENWVEEFLSDLILKEAQSCDIKIILRGNSMASKSIEFFLKLECQDYLRQILHSTIKDIIHKTNDLEIDQSQLIKRNESISASAMRKRNQRLEMIVDKVLNKIFSNVDIIPRRVRSIFSRIRCSL---KNFGTIDLEFTQKVVSACFFLRLVCPAIMTPHLFDLLPEYSDNVNINRSFTLVAKCVQNIANFAGIDDTKESYMQSIALHCRDYYNQMSEFINSISTINEATFTTKVYDKHT------------SPR-------LAIDSARLSYNIEYHLSTLQTNKYTTLQLEVKEIIDRI 2073
            L+I IQEAK L  K +YYCEIKLD ++Y RT++K + + + WGEEF+   L  I  ++I L+++  +K+KH+  ++V+   +P  ++      EKWYSP      +S  +L+ + LT S    +DEL KN         D AP++R K +Y PL++L  K+Y    +F+ +  I ++  +E+ +K K +E  V  ++ +  S++   +FL+DL+  E    +  +ILRGNS+ASK++E +LK+  + YL  +L   I ++I +  D E+D  +L   N S   S + +   +L  +V+ V +KI+ N  +IP  ++ +F++IR  L   K   +       +V+S+C FLR +CPAIM+P LF L  EY DNV+INR+FTL+AK +Q++ANF+    +KE+YM+ +        + M  F+  IS +N++     +  +              SP        +    A L + +  HL  +   +YT    E + II+ I
Sbjct:  280 LQIWIQEAKQLIQKKRYYCEIKLDEMLYGRTTIKTVTDTVFWGEEFEFRGLQNINKITICLYKMTDNKKKHERSELVAQIEVPCADLTDSSPCEKWYSPP---FQYSNLRLSQSELTNSQKVKLDELLKN-------AVDIAPMIRIKGRYRPLEILPNKFYDSLSDFLVKQSIPLVESLESHLKVKSKEDFVKILLVILKSKDCHIDFLADLVFIEVSKAEDNLILRGNSIASKAMECYLKMVGEKYLATLLKDLINEVIFEEIDCEVDPLRL---NNSKENSQIFENQNKLLRLVENVWSKIYHNAHLIPNELKLVFTKIREKLSETKRGSSYSSPMIYQVISSCLFLRFICPAIMSPFLFGLSNEYPDNVSINRTFTLIAKSIQSLANFSQFPQSKETYMEFMQNFINKNSSSMRSFLKLIS-LNKSNGAKSMESQDVLYLLLETDNINYSPTKDDRYIDIGYHLAELMFQLNIHLKDIPDKEYTPTLTEARTIIENI 766          
BLAST of DAB2 interacting protein b vs. Planmine SMEST
Match: SMESG000037132.1 (SMESG000037132.1)

HSP 1 Score: 262.307 bits (669), Expect = 6.265e-73
Identity = 169/527 (32.07%), Postives = 277/527 (52.56%), Query Frame = 1
Query:  640 LKISIQEAKNLTLKNKYYCEIKLDNLIYARTSVKEMKEILIWGEEFDLMSLPCIEMVSITLWRLP---RSKEKHKECQIVSHFNIPIENIDQHCITEKWYSPSPVCLPHSGSKLAH-NLTFS-----AACDIDELPKNNTRTLNQVT------DSAPLLRAKSKYSPLKVLDAKYYMEFVEFIKENGINMLREMEAGIKAKYREVLVWSMIQLSISENWVEEFLSDLILKEAQSCDIK-IILRGNSMASKSIEFFLKLECQDYLRQILHSTIKDIIHKTNDLEID---------------QSQLIKRNESISA--SAMRKRNQRLEMIVDKVLNKIFSNVDIIPRRVRSIFSRIRCSLKNFGTIDLEFT-------QKVVSACFFLRLVCPAIMTPHLFDLLPEYSDNVNINRSFTLVAKCVQNIANFAGIDDTKESYMQSIALHCRDYYNQMSEFINSISTINEATFTTKVYDKHT---------------SPRLAIDS-------ARLSYNIEYHLSTLQTNKYT 2034
            L + IQEAKN+ LK +Y+CEI LD  ++A+T+ K M ++L WGEEF+L  L  +  V+I LW+     R+K+K  +  ++   NI  ++I      E+WY P+      SG+++ H N++ S      +     L   ++  L+Q T      D  P++R K++Y  + VL    Y   +EF+K++ + +L+EM+A +K K +E L  S+I +   +    EFLSDL+ +E +  D + +ILRGN++ASK+IE +LKL  + YL  IL   +  I     D E+D               + Q ++  +  S     + +R + L M VD +  KI S+    PR ++S+F  +R  L+       +         +++VS+C FLR +CPAI+TP LF LLPEY DN  + R+FTLVAKC+Q++ANF+ +  +KESYM  +     + +  M  F+  IS+  +  ++   +++ +               S  L++DS       A+L    E +L  +   KYT
Sbjct:   91 LNLWIQEAKNVPLKKRYFCEIYLDETLHAKTTTKTMTDLLFWGEEFNLCHLEQVNTVTILLWKASSDNRAKKKKSQQHLICQVNIETKDISARNNVERWY-PASCSYNSSGTEIVHSNMSHSIISSTDSTPTSTLQSMHSTNLSQSTASLSNSDHLPMIRIKARYQNIDVLPINKYSHLLEFLKQHAVQLLQEMDAHLKVKNKEDLAISLINVLHKQGIAAEFLSDLLFQEIKKSDNENMILRGNTIASKAIEVYLKLIGEKYLSLILSDFVNRISQGDEDCEVDPQRSKCEFFSNSSLNECQSLQNGDKSSHFHPMLLQRQESLMMNVDMIWAKILSSSIYFPRELKSVFVSLRKRLEQMDRTANQMDNSQSNLYERIVSSCIFLRFICPAILTPSLFGLLPEYPDNPKVLRTFTLVAKCIQSLANFSDLTGSKESYMLFMNTFIENKFTTMQSFLKEISSSTDDDYSRSKWNEPSSVDASKENGGYWENLSSTLSLDSIDISLCLAKLHRQFEEYLQVIPVQKYT 616          
BLAST of DAB2 interacting protein b vs. Planmine SMEST
Match: SMESG000037132.1 (SMESG000037132.1)

HSP 1 Score: 262.307 bits (669), Expect = 3.047e-72
Identity = 177/567 (31.22%), Postives = 297/567 (52.38%), Query Frame = 1
Query:  520 NEAKSIVFNSSNQTERDLCIKQIRCAXXXXXXXXXXXXNNLKISIQEAKNLTLKNKYYCEIKLDNLIYARTSVKEMKEILIWGEEFDLMSLPCIEMVSITLWRLP---RSKEKHKECQIVSHFNIPIENIDQHCITEKWYSPSPVCLPHSGSKLAH-NLTFS-----AACDIDELPKNNTRTLNQVT------DSAPLLRAKSKYSPLKVLDAKYYMEFVEFIKENGINMLREMEAGIKAKYREVLVWSMIQLSISENWVEEFLSDLILKEAQSCDIK-IILRGNSMASKSIEFFLKLECQDYLRQILHSTIKDIIHKTNDLEID---------------QSQLIKRNESISA--SAMRKRNQRLEMIVDKVLNKIFSNVDIIPRRVRSIFSRIRCSLKNFGTIDLEFT-------QKVVSACFFLRLVCPAIMTPHLFDLLPEYSDNVNINRSFTLVAKCVQNIANFAGIDDTKESYMQSIALHCRDYYNQMSEFINSISTINEATFTTKVYDKHT---------------SPRLAIDS-------ARLSYNIEYHLSTLQTNKYT 2034
            N   + VF+ S+++ER   +  +   +  +L +   +E +L + IQEAKN+ LK +Y+CEI LD  ++A+T+ K M ++L WGEEF+L  L  +  V+I LW+     R+K+K  +  ++   NI  ++I      E+WY P+      SG+++ H N++ S      +     L   ++  L+Q T      D  P++R K++Y  + VL    Y   +EF+K++ + +L+EM+A +K K +E L  S+I +   +    EFLSDL+ +E +  D + +ILRGN++ASK+IE +LKL  + YL  IL   +  I     D E+D               + Q ++  +  S     + +R + L M VD +  KI S+    PR ++S+F  +R  L+       +         +++VS+C FLR +CPAI+TP LF LLPEY DN  + R+FTLVAKC+Q++ANF+ +  +KESYM  +     + +  M  F+  IS+  +  ++   +++ +               S  L++DS       A+L    E +L  +   KYT
Sbjct:  239 NHLLAYVFSCSSESERKKWMSVLTRVVRPNLQNERRQEISLNLWIQEAKNVPLKKRYFCEIYLDETLHAKTTTKTMTDLLFWGEEFNLCHLEQVNTVTILLWKASSDNRAKKKKSQQHLICQVNIETKDISARNNVERWY-PASCSYNSSGTEIVHSNMSHSIISSTDSTPTSTLQSMHSTNLSQSTASLSNSDHLPMIRIKARYQNIDVLPINKYSHLLEFLKQHAVQLLQEMDAHLKVKNKEDLAISLINVLHKQGIAAEFLSDLLFQEIKKSDNENMILRGNTIASKAIEVYLKLIGEKYLSLILSDFVNRISQGDEDCEVDPQRSKCEFFSNSSLNECQSLQNGDKSSHFHPMLLQRQESLMMNVDMIWAKILSSSIYFPRELKSVFVSLRKRLEQMDRTANQMDNSQSNLYERIVSSCIFLRFICPAILTPSLFGLLPEYPDNPKVLRTFTLVAKCIQSLANFSDLTGSKESYMLFMNTFIENKFTTMQSFLKEISSSTDDDYSRSKWNEPSSVDASKENGGYWENLSSTLSLDSIDISLCLAKLHRQFEEYLQVIPVQKYT 804          
The following BLAST results are available for this feature:
BLAST of DAB2 interacting protein b vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DAB2IP1.647e-5929.77DAB2 interacting protein [Source:HGNC Symbol;Acc:H... [more]
DAB2IP1.891e-5929.77DAB2 interacting protein [Source:HGNC Symbol;Acc:H... [more]
DAB2IP2.467e-5929.77DAB2 interacting protein [Source:HGNC Symbol;Acc:H... [more]
DAB2IP3.176e-5929.77DAB2 interacting protein [Source:HGNC Symbol;Acc:H... [more]
DAB2IP3.395e-5929.77DAB2 interacting protein [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of DAB2 interacting protein b vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gap-21.776e-5729.74Ras GTPase-activating protein gap-2 [Source:UniPr... [more]
gap-22.360e-5729.74Ras GTPase-activating protein gap-2 [Source:UniPr... [more]
gap-23.536e-5729.74Ras GTPase-activating protein gap-2 [Source:UniPr... [more]
gap-24.581e-5729.74Ras GTPase-activating protein gap-2 [Source:UniPr... [more]
gap-26.143e-5729.74Ras GTPase-activating protein gap-2 [Source:UniPr... [more]
back to top
BLAST of DAB2 interacting protein b vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
raskol6.941e-6228.86gene:FBgn0261570 transcript:FBtr0302834[more]
raskol7.056e-6228.86gene:FBgn0261570 transcript:FBtr0340630[more]
raskol7.561e-6228.86gene:FBgn0261570 transcript:FBtr0340631[more]
raskol8.990e-6228.86gene:FBgn0261570 transcript:FBtr0302835[more]
raskol9.143e-6228.86gene:FBgn0261570 transcript:FBtr0340629[more]
back to top
BLAST of DAB2 interacting protein b vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dab2ipa2.845e-6030.39DAB2 interacting protein a [Source:ZFIN;Acc:ZDB-GE... [more]
dab2ipa3.666e-6030.39DAB2 interacting protein a [Source:ZFIN;Acc:ZDB-GE... [more]
rasal25.165e-6030.00RAS protein activator like 2 [Source:ZFIN;Acc:ZDB-... [more]
rasal25.482e-6030.00RAS protein activator like 2 [Source:ZFIN;Acc:ZDB-... [more]
dab2ipb1.600e-5829.03DAB2 interacting protein b [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of DAB2 interacting protein b vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DAB2IP2.602e-5829.77DAB2 interacting protein [Source:NCBI gene;Acc:100... [more]
DAB2IP3.003e-5829.77DAB2 interacting protein [Source:NCBI gene;Acc:100... [more]
DAB2IP3.174e-5829.77DAB2 interacting protein [Source:NCBI gene;Acc:100... [more]
DAB2IP3.364e-5829.77DAB2 interacting protein [Source:NCBI gene;Acc:100... [more]
DAB2IP3.502e-5829.77DAB2 interacting protein [Source:NCBI gene;Acc:100... [more]
back to top
BLAST of DAB2 interacting protein b vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dab2ip2.733e-5929.57disabled 2 interacting protein [Source:MGI Symbol;... [more]
Dab2ip3.888e-5929.57disabled 2 interacting protein [Source:MGI Symbol;... [more]
Dab2ip4.905e-5929.57disabled 2 interacting protein [Source:MGI Symbol;... [more]
Dab2ip4.971e-5929.57disabled 2 interacting protein [Source:MGI Symbol;... [more]
Dab2ip4.985e-5929.57disabled 2 interacting protein [Source:MGI Symbol;... [more]
back to top
BLAST of DAB2 interacting protein b vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8T498|GAP2_DROME9.012e-6128.86Ras GTPase-activating protein raskol OS=Drosophila... [more]
sp|Q5VWQ8|DAB2P_HUMAN1.630e-5829.77Disabled homolog 2-interacting protein OS=Homo sap... [more]
sp|Q3UHC7|DAB2P_MOUSE3.534e-5829.57Disabled homolog 2-interacting protein OS=Mus musc... [more]
sp|Q9UJF2|NGAP_HUMAN4.828e-5629.71Ras GTPase-activating protein nGAP OS=Homo sapiens... [more]
sp|Q8MLZ5|GAP2_CAEEL9.146e-5629.74Ras GTPase-activating protein gap-2 OS=Caenorhabdi... [more]
back to top
BLAST of DAB2 interacting protein b vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3Q1GA507.211e-6330.80Uncharacterized protein OS=Acanthochromis polyacan... [more]
A0A3Q1EUP41.490e-6230.67Uncharacterized protein OS=Acanthochromis polyacan... [more]
A0A3Q1ER521.771e-6230.80Uncharacterized protein OS=Acanthochromis polyacan... [more]
A0A4W6FB021.230e-6131.01Uncharacterized protein OS=Lates calcarifer OX=818... [more]
A0A3B4X0R41.703e-6131.01Uncharacterized protein OS=Seriola lalandi dorsali... [more]
back to top
BLAST of DAB2 interacting protein b vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rasal22.708e-6129.18ras GTPase-activating protein nGAP [Source:NCBI ge... [more]
rasal26.004e-6129.18ras GTPase-activating protein nGAP [Source:NCBI ge... [more]
rasal28.770e-6129.18ras GTPase-activating protein nGAP [Source:NCBI ge... [more]
rasal29.073e-6129.18ras GTPase-activating protein nGAP [Source:NCBI ge... [more]
dab2ipb2.424e-5929.77DAB2 interacting protein [Source:NCBI gene;Acc:103... [more]
back to top
BLAST of DAB2 interacting protein b vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000000945.12.177e-4628.81pep scaffold:Pmarinus_7.0:GL477254:323984:383899:1... [more]
ENSPMAT00000010290.12.769e-623.35pep scaffold:Pmarinus_7.0:GL476446:218476:334684:-... [more]
back to top
BLAST of DAB2 interacting protein b vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
BUD22.769e-1424.78GTPase activating factor for Rsr1p/Bud1p; plays a ... [more]
IRA15.997e-624.61GTPase-activating protein; negatively regulates RA... [more]
back to top
BLAST of DAB2 interacting protein b vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO357996.761e-4526.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO361901.027e-1824.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO434461.042e-1524.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO409333.110e-723.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of DAB2 interacting protein b vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000022035.27.990e-6330.39disabled homolog 2-interacting protein-like [Sourc... [more]
rasal21.192e-6030.53RAS protein activator like 2 [Source:NCBI gene;Acc... [more]
rasal23.696e-6030.53RAS protein activator like 2 [Source:NCBI gene;Acc... [more]
dab2ipb4.114e-5729.77DAB2 interacting protein [Source:NCBI gene;Acc:101... [more]
dab2ipb4.558e-5729.77DAB2 interacting protein [Source:NCBI gene;Acc:101... [more]
back to top
BLAST of DAB2 interacting protein b vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000000171.10.000e+099.65SMESG000000171.1[more]
SMESG000000171.10.000e+099.63SMESG000000171.1[more]
SMESG000043888.11.379e-7532.93SMESG000043888.1[more]
SMESG000037132.16.265e-7332.07SMESG000037132.1[more]
SMESG000037132.13.047e-7231.22SMESG000037132.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028071 ID=SMED30028071|Name=DAB2 interacting protein b|organism=Schmidtea mediterranea sexual|type=transcript|length=3236bp
TGTTGTTGTTGTTGTTGTTGTTTGTTCCTTCTCTAATATGAGGCTGTAAA
TATGAATTATTGCAAATAATTTTTGGTTTTCTCCCTCTTTACATTTCGGC
TAATAAGAATGTCGAGAAAAGCAATAAAGCATTTAATCAGTATCGAACCT
CAGTCTTGCACCAGTGAGATTTCCAGTGCCAGTTTTTTTCAAAAGAATAA
TAAATATTCGAAATTCTCAAATAAATCAAAATCAAACGCTCACGGATTCA
GTTACTCATTAAGAGATTTTTCGTGCTCCACCGATGAGTTACTGGACATT
TCCCTGAAATCTACTCTACTTATCAATGAGCAATACAATATTATCTATGC
CAGCAATCAGAACATAAGCCGGGAACAAAAACTCATATCGTTTCGAAATG
GCGAAACGAAAAAAATGGAGGCAGTAAATTTCATATCGGTTTCGAAAATT
ATTCCAATTCATCATTCTCTATGTTTTGGTAAACGGTTTTGTTATCGGAT
TGTCACTGTCGGGGGTCCCAATGAAGCTAAATCAATCGTTTTCAATTCTT
CTAACCAGACTGAAAGAGATCTTTGCATCAAGCAAATTCGATGTGCAATA
TCCGAATCTTTGAGTTCGATAATTTTTGAAGAGAATAATCTAAAAATTTC
GATTCAAGAAGCCAAAAATTTGACTCTGAAAAACAAATATTATTGCGAAA
TTAAACTTGATAATCTGATTTATGCTCGGACTTCTGTAAAGGAAATGAAA
GAAATATTAATTTGGGGTGAAGAATTCGATTTGATGAGTCTTCCGTGTAT
TGAGATGGTTTCCATAACCCTTTGGAGATTGCCGCGATCTAAAGAAAAAC
ATAAAGAGTGTCAAATAGTTTCTCATTTCAATATTCCCATTGAAAATATT
GACCAGCATTGCATTACTGAAAAATGGTATTCTCCTTCACCAGTTTGCCT
GCCACATTCAGGTTCCAAACTTGCTCACAATTTAACATTCTCTGCTGCCT
GTGACATTGATGAGTTACCTAAAAACAACACGCGAACTCTTAATCAAGTC
ACTGACTCAGCTCCTCTTTTAAGAGCAAAATCTAAATATTCCCCATTAAA
AGTTTTGGATGCCAAATATTACATGGAATTTGTAGAGTTTATCAAAGAAA
ATGGTATTAATATGCTAAGGGAAATGGAAGCCGGCATCAAAGCTAAATAT
AGAGAAGTTCTAGTATGGTCAATGATTCAATTGTCAATTTCAGAAAACTG
GGTGGAGGAATTTCTGTCAGATTTAATATTAAAAGAAGCTCAGTCCTGTG
ATATCAAAATTATTCTTCGTGGTAATAGTATGGCATCGAAATCTATAGAA
TTTTTTCTAAAATTAGAATGTCAAGATTATTTACGCCAAATTCTCCACAG
CACAATCAAAGATATTATTCACAAAACCAACGACCTAGAAATCGACCAGT
CACAGTTGATCAAGAGAAATGAATCTATTTCTGCCAGTGCAATGAGAAAA
CGTAATCAACGTTTGGAAATGATTGTTGATAAAGTTTTAAATAAAATATT
CAGCAATGTCGACATTATTCCAAGACGCGTTCGATCAATTTTTAGCCGAA
TTCGATGTAGCTTAAAAAATTTCGGAACTATTGACTTGGAATTTACTCAA
AAGGTCGTATCGGCTTGTTTCTTTCTGCGACTAGTTTGTCCGGCCATTAT
GACCCCCCATTTATTCGATTTATTGCCAGAATATTCCGACAATGTCAACA
TCAATAGGTCTTTCACATTGGTGGCGAAATGCGTTCAAAACATTGCGAAT
TTTGCCGGCATTGATGATACCAAAGAGTCATATATGCAATCTATTGCTCT
TCATTGTCGAGATTATTATAACCAAATGTCAGAATTCATTAATTCCATTT
CAACAATAAACGAAGCGACCTTTACCACCAAAGTCTACGACAAACATACC
AGTCCAAGATTAGCTATCGACTCTGCCAGATTGTCCTATAATATCGAATA
CCACCTCAGCACTTTACAGACCAATAAATATACAACTCTGCAGTTAGAGG
TAAAAGAAATAATAGATAGAATTAAAGAAAATGAAATCAACATTTCAGAG
GAAAACGACACAATTGAAAAGATGCGTCAGAATTATGAGTATAATGATAT
CGGGAAGACCGTAGTAAGCACTATTGAGTCGTCCGGGTATTTCTCTACCA
ACGGGCCGTATCTGGGTAGCGTGAATTCCAATTTAAACCATTCCCCTTCT
TCCTCTTTATCTGCAATAAGTCATCTGAAAATTCTCTCGCCGCAATTCCT
TAACAAGCACACAAATATGATGCCCATATCCTGCCCTTCGGTTTCAGAAT
CACACTGTAATAATACAGTCATGATGGATGAAGATCCTATCTCTCTCAGA
AAAATTATCATTCACGAGAAGAAAAGAATACAACTATTGAAAGAATTAGT
GGACAACCTTCAGTTCACGAACGCAGCTGAAGCAGAAACGATTGATCTTT
CTTCTAAGAATCTCAACATTAATATCGAGAAAGTCGCCGAATCTAAATCG
AATGTTTTAAAATATATTGATTTCGTCAGTAATAATCTCAATTCATTCCA
ACTCTCTCAGAATGCCAGTTCACATGATAGTCTTCTCAAACAGTTCATAA
AGATTAATGCCGAATTGCAGTCTATTTTAATTAAATCTTCGGCCGAAAAC
AGCAATCAGCAGTAGCCAATCAAATTTCAATAAATCAACGATGCGCGCTG
TGTCTTGATCAATGATATTTGCTCATTTTCTTTATTTTCTAAACTGAAAA
AGCGACTGGAACATCTCGAGTCAAATATTGTATATTGACTAGTGAAATAT
TGTGATTATTGGATTGATTTTCTATATTGAATACAAATTATTTTGTAAAT
TAATATCCTATTGAATTTGAGTTGAATTTCCACATTCATCGGTCTGTAGA
TTTTTTTTTGATTAAATTTTTATGTGATAAATCAATATTATGATTATGGC
ACAGTGGATAGTTAGAAAACTGTTTTCAAACTATTATTTTGTTGGAAATA
TTATTTATTGATCAATTTAAACAAATCAACCATAACTAATATTGACAGTT
ATAGTCACCTCAGTGTATCAATCAGATGTTTTCGATGAGTTTCGTAAGAA
TATATTTCTTTCAGAAATCAACTTTTTATTTCATTTCAAATGAAGCTTCA
TTCGGTTTTCTTTTTTTTTTCTTTTGATGTTTCGAT
back to top

protein sequence of SMED30028071-orf-1

>SMED30028071-orf-1 ID=SMED30028071-orf-1|Name=SMED30028071-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=869bp
MSRKAIKHLISIEPQSCTSEISSASFFQKNNKYSKFSNKSKSNAHGFSYS
LRDFSCSTDELLDISLKSTLLINEQYNIIYASNQNISREQKLISFRNGET
KKMEAVNFISVSKIIPIHHSLCFGKRFCYRIVTVGGPNEAKSIVFNSSNQ
TERDLCIKQIRCAISESLSSIIFEENNLKISIQEAKNLTLKNKYYCEIKL
DNLIYARTSVKEMKEILIWGEEFDLMSLPCIEMVSITLWRLPRSKEKHKE
CQIVSHFNIPIENIDQHCITEKWYSPSPVCLPHSGSKLAHNLTFSAACDI
DELPKNNTRTLNQVTDSAPLLRAKSKYSPLKVLDAKYYMEFVEFIKENGI
NMLREMEAGIKAKYREVLVWSMIQLSISENWVEEFLSDLILKEAQSCDIK
IILRGNSMASKSIEFFLKLECQDYLRQILHSTIKDIIHKTNDLEIDQSQL
IKRNESISASAMRKRNQRLEMIVDKVLNKIFSNVDIIPRRVRSIFSRIRC
SLKNFGTIDLEFTQKVVSACFFLRLVCPAIMTPHLFDLLPEYSDNVNINR
SFTLVAKCVQNIANFAGIDDTKESYMQSIALHCRDYYNQMSEFINSISTI
NEATFTTKVYDKHTSPRLAIDSARLSYNIEYHLSTLQTNKYTTLQLEVKE
IIDRIKENEINISEENDTIEKMRQNYEYNDIGKTVVSTIESSGYFSTNGP
YLGSVNSNLNHSPSSSLSAISHLKILSPQFLNKHTNMMPISCPSVSESHC
NNTVMMDEDPISLRKIIIHEKKRIQLLKELVDNLQFTNAAEAETIDLSSK
NLNINIEKVAESKSNVLKYIDFVSNNLNSFQLSQNASSHDSLLKQFIKIN
AELQSILIKSSAENSNQQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0008285negative regulation of cell proliferation
GO:0016525negative regulation of angiogenesis
GO:0030948negative regulation of vascular endothelial growth factor receptor signaling pathway
GO:0038026reelin-mediated signaling pathway
GO:0043065positive regulation of apoptotic process
GO:0043087regulation of GTPase activity
GO:0007165signal transduction
GO:0000165MAPK cascade
GO:0043547positive regulation of GTPase activity
GO:0046580negative regulation of Ras protein signal transduction
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR039360Ras_GTPase
IPR001936RasGAP_dom
IPR000008C2_dom
IPR023152RasGAP_CS
IPR008936Rho_GTPase_activation_prot
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0005096GTPase activator activity
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005829cytosol
GO:0031235intrinsic component of the cytoplasmic side of the plasma membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 655..675
NoneNo IPR availableGENE3DG3DSA:1.10.506.10coord: 383..613
e-value: 1.0E-60
score: 207.7
NoneNo IPR availableGENE3DG3DSA:1.10.506.20coord: 335..657
e-value: 1.0E-60
score: 207.7
NoneNo IPR availablePANTHERPTHR10194:SF125RAS GTPASE-ACTIVATING PROTEIN-RELATEDcoord: 105..844
NoneNo IPR availableSUPERFAMILYSSF49562C2 domain (Calcium/lipid-binding domain, CaLB)coord: 177..278
IPR001936Ras GTPase-activating domainSMARTSM00323RasGAP_2coord: 313..655
e-value: 9.9E-30
score: 114.8
IPR001936Ras GTPase-activating domainPFAMPF00616RasGAPcoord: 385..564
e-value: 6.1E-22
score: 78.4
IPR001936Ras GTPase-activating domainPROSITEPS50018RAS_GTPASE_ACTIV_2coord: 364..564
score: 34.983
IPR000008C2 domainPFAMPF00168C2coord: 177..275
e-value: 2.8E-4
score: 21.1
IPR039360Ras GTPase-activating proteinPANTHERPTHR10194RAS GTPASE-ACTIVATING PROTEINScoord: 105..844
IPR023152Ras GTPase-activating protein, conserved sitePROSITEPS00509RAS_GTPASE_ACTIV_1coord: 519..533
IPR008936Rho GTPase activation proteinSUPERFAMILYSSF48350GTPase activation domain, GAPcoord: 337..628