SMED30028069

Overview
NameSMED30028069
Smed IDSMED30028069
Length (bp)707
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30028069 (SMED30028069) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30028069 (SMED30028069) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30028069 (SMED30028069) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30028069 (SMED30028069) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028069

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30028069SMESG000059907.1 dd_Smed_v4_5497_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30028069SMESG000059907.1 dd_Smed_v4_5497_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
pharynxSMED30028069SMESG000059907.1 dd_Smed_v6_5497_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30028069SMESG000059907.1 dd_Smed_v6_5497_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30028069SMESG000059907.1 dd_Smed_v6_5497_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30028069SMESG000059907.1 dd_Smed_v4_5497_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30028069SMESG000059907.1 dd_Smed_v4_5497_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30028069 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.014495:12575..18873 -3460
v31.026449:4371..5113 -3315
Homology
BLAST of SMED30028069 vs. Planmine SMEST
Match: SMESG000059907.1 (SMESG000059907.1)

HSP 1 Score: 342.428 bits (877), Expect = 3.903e-108
Identity = 224/229 (97.82%), Postives = 226/229 (98.69%), Query Frame = 3
Query:   21 MSQEKKKGVFGNILGYFKPSITVNINKDEKEDKSEKQVELISVNAGAKTNIPDLGFKAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGEFKAKATIGGNAKISGEAGHNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIGNRSIERKVDKPKIDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
            MSQEKKKGVFGNILGYFKPSITVNINKDEKEDKSEKQVELISVNAGAKTNIPDLGFKASVKKDKRSHSSSSSSSSSSSSSSDADKKKKKPKSSEKGEFKAKATIGGNAKISGEA HNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIGNRSIERKVDKPKID+NVDKKKPKADL LKSHGDLDVDVDLEEKK KHGGI+LGFNM
Sbjct:    1 MSQEKKKGVFGNILGYFKPSITVNINKDEKEDKSEKQVELISVNAGAKTNIPDLGFKASVKKDKRSHSSSSSSSSSSSSSSDADKKKKKPKSSEKGEFKAKATIGGNAKISGEAEHNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIGNRSIERKVDKPKIDINVDKKKPKADLELKSHGDLDVDVDLEEKKKKHGGIDLGFNM 229          

HSP 2 Score: 82.4185 bits (202), Expect = 8.938e-18
Identity = 61/129 (47.29%), Postives = 69/129 (53.49%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIG--NRSIERKVDKPK-----------IDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++ K +IKKP  DL LK  G                V  DI  D   KK   ID+G    S   KV KPK           ID NVD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct:  248 GGPNIDAKVDIKKPKADLDLKGHG---------------DVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 361          

HSP 3 Score: 82.4185 bits (202), Expect = 8.938e-18
Identity = 61/129 (47.29%), Postives = 69/129 (53.49%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIG--NRSIERKVDKPK-----------IDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++ K +IKKP  DL LK  G                V  DI  D   KK   ID+G    S   KV KPK           ID NVD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct:  446 GGPNIDAKVDIKKPKADLDLKGHG---------------DVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 559          

HSP 4 Score: 82.4185 bits (202), Expect = 8.938e-18
Identity = 61/129 (47.29%), Postives = 69/129 (53.49%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIG--NRSIERKVDKPK-----------IDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++ K +IKKP  DL LK  G                V  DI  D   KK   ID+G    S   KV KPK           ID NVD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct:  776 GGPNIDAKVDIKKPKADLDLKGHG---------------DVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 889          

HSP 5 Score: 82.4185 bits (202), Expect = 8.938e-18
Identity = 61/129 (47.29%), Postives = 69/129 (53.49%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIG--NRSIERKVDKPK-----------IDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++ K +IKKP  DL LK  G                V  DI  D   KK   ID+G    S   KV KPK           ID NVD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct: 1399 GGPNIDAKVDIKKPKADLDLKGHG---------------DVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 1512          

HSP 6 Score: 80.4925 bits (197), Expect = 3.633e-17
Identity = 60/129 (46.51%), Postives = 68/129 (52.71%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIG--NRSIERKVDKPK-----------IDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++   +IKKP  DL LK  G                V  DI  D   KK   ID+G    S   KV KPK           ID NVD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct:  314 GGPNIDANVDIKKPKADLDLKGHG---------------DVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 427          

HSP 7 Score: 80.4925 bits (197), Expect = 3.633e-17
Identity = 60/129 (46.51%), Postives = 68/129 (52.71%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIG--NRSIERKVDKPK-----------IDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++   +IKKP  DL LK  G                V  DI  D   KK   ID+G    S   KV KPK           ID NVD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct:  512 GGPNIDANVDIKKPKADLDLKGHG---------------DVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 625          

HSP 8 Score: 80.4925 bits (197), Expect = 3.633e-17
Identity = 60/129 (46.51%), Postives = 68/129 (52.71%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIG--NRSIERKVDKPK-----------IDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++   +IKKP  DL LK  G                V  DI  D   KK   ID+G    S   KV KPK           ID NVD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct:  578 GGPNIDANVDIKKPKADLDLKGHG---------------DVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 691          

HSP 9 Score: 79.7221 bits (195), Expect = 6.474e-17
Identity = 60/129 (46.51%), Postives = 68/129 (52.71%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIG--NRSIERKVDKPK-----------IDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++ K +IKKP  DL LK  G                V  DI  D   KK   ID+G    S   KV KPK           ID  VD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct: 1836 GGPNIDAKVDIKKPKADLDLKGHG---------------DVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 1949          

HSP 10 Score: 79.7221 bits (195), Expect = 6.474e-17
Identity = 60/129 (46.51%), Postives = 68/129 (52.71%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIG--NRSIERKVDKPK-----------IDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++ K +IKKP  DL LK  G                V  DI  D   KK   ID+G    S   KV KPK           ID  VD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct: 1902 GGPNIDAKVDIKKPKADLDLKGHG---------------DVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 2015          

HSP 11 Score: 79.7221 bits (195), Expect = 6.474e-17
Identity = 60/129 (46.51%), Postives = 68/129 (52.71%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIG--NRSIERKVDKPK-----------IDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++ K +IKKP  DL LK  G                V  DI  D   KK   ID+G    S   KV KPK           ID  VD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct: 1968 GGPNIDAKVDIKKPKADLDLKGHG---------------DVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 2081          

HSP 12 Score: 79.7221 bits (195), Expect = 6.474e-17
Identity = 60/129 (46.51%), Postives = 68/129 (52.71%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIG--NRSIERKVDKPK-----------IDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++ K +IKKP  DL LK  G                V  DI  D   KK   ID+G    S   KV KPK           ID  VD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct: 2034 GGPNIDAKVDIKKPKADLDLKGHG---------------DVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 2147          

HSP 13 Score: 79.7221 bits (195), Expect = 6.474e-17
Identity = 60/129 (46.51%), Postives = 68/129 (52.71%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIG--NRSIERKVDKPK-----------IDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++ K +IKKP  DL LK  G                V  DI  D   KK   ID+G    S   KV KPK           ID  VD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct: 2215 GGPNIDAKVDIKKPKADLDLKGHG---------------DVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 2328          

HSP 14 Score: 78.9518 bits (193), Expect = 1.420e-16
Identity = 56/129 (43.41%), Postives = 66/129 (51.16%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIG-------------NRSIERKVDKPKIDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++ K +IKKP  DL LK  G                V  DI  D   KK   ID+G                I+  +  P ID  VD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct:  710 GGPNIDAKVDIKKPKADLDLKGHG---------------DVDVDIDLDGKKKKHGGIDLGFNMPLFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 823          

HSP 15 Score: 78.9518 bits (193), Expect = 1.461e-16
Identity = 58/126 (46.03%), Postives = 68/126 (53.97%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPF--------KDKDQGNIDI--RSPKVQTDIKYDIDAKKSCEIDIGNRSIERKVDKPKIDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++   +IKKP  DL LK  G          K K QG ID+    P     +K     K   +IDIG          P ID  VD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct: 2501 GGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKQGGIDLGFNMPSFGGKVKK---PKGEIDIDIGG---------PNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 2614          

HSP 16 Score: 78.5666 bits (192), Expect = 1.637e-16
Identity = 68/156 (43.59%), Postives = 79/156 (50.64%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPF--------KDKDQGNIDI---------RSPKVQTDIK------YDIDA----KKSCEIDIG--NRSIERKVDKPK-----------IDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++ K +IKKP  DL LK  G          K K  G ID+         + PK   D+K       DID     KK   ID+G    S   KV KPK           ID  VD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct: 1157 GGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 1312          

HSP 17 Score: 78.1814 bits (191), Expect = 2.236e-16
Identity = 58/128 (45.31%), Postives = 68/128 (53.12%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPF----------KDKDQGNIDI--RSPKVQTDIKYDIDAKKSCEIDIGNRSIERKVDKPKIDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++   +IKKP  DL LK  G            K K  G ID+    P     +K     K   +IDIG          P ID NVD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct: 1023 GGPNIDANVDIKKPKADLDLKGHGDVDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKK---PKGEIDIDIGG---------PNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 1138          

HSP 18 Score: 78.1814 bits (191), Expect = 2.626e-16
Identity = 59/129 (45.74%), Postives = 67/129 (51.94%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIG--NRSIERKVDKPK-----------IDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++   +IKKP  DL LK  G                V  DI  D   KK   ID+G    S   KV KPK           ID  VD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct:  380 GGPNIDANVDIKKPKADLDLKGHG---------------DVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 493          

HSP 19 Score: 78.1814 bits (191), Expect = 2.626e-16
Identity = 59/129 (45.74%), Postives = 67/129 (51.94%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIG--NRSIERKVDKPK-----------IDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++   +IKKP  DL LK  G                V  DI  D   KK   ID+G    S   KV KPK           ID  VD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct:  644 GGPNIDANVDIKKPKADLDLKGHG---------------DVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 757          

HSP 20 Score: 78.1814 bits (191), Expect = 2.626e-16
Identity = 59/129 (45.74%), Postives = 67/129 (51.94%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIG--NRSIERKVDKPK-----------IDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++   +IKKP  DL LK  G                V  DI  D   KK   ID+G    S   KV KPK           ID  VD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct:  842 GGPNIDANVDIKKPKADLDLKGHG---------------DVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 955          

HSP 21 Score: 78.1814 bits (191), Expect = 2.626e-16
Identity = 59/129 (45.74%), Postives = 67/129 (51.94%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIG--NRSIERKVDKPK-----------IDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++   +IKKP  DL LK  G                V  DI  D   KK   ID+G    S   KV KPK           ID  VD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct: 1091 GGPNIDANVDIKKPKADLDLKGHG---------------DVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 1204          

HSP 22 Score: 78.1814 bits (191), Expect = 2.626e-16
Identity = 59/129 (45.74%), Postives = 67/129 (51.94%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIG--NRSIERKVDKPK-----------IDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++   +IKKP  DL LK  G                V  DI  D   KK   ID+G    S   KV KPK           ID  VD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct: 1632 GGPNIDANVDIKKPKADLDLKGHG---------------DVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 1745          

HSP 23 Score: 77.411 bits (189), Expect = 3.981e-16
Identity = 58/128 (45.31%), Postives = 68/128 (53.12%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPF----------KDKDQGNIDI--RSPKVQTDIKYDIDAKKSCEIDIGNRSIERKVDKPKIDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++ K +IKKP  DL LK  G            K K  G ID+    P     +K     K   +IDIG          P ID  VD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct: 1331 GGPNIDAKVDIKKPKADLDLKGHGDVDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKK---PKGEIDIDIGG---------PNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 1446          

HSP 24 Score: 77.0258 bits (188), Expect = 6.758e-16
Identity = 62/135 (45.93%), Postives = 69/135 (51.11%), Query Frame = 3
Query:  360 AGHNVNIKSE------IKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIG--NRSIERKVDKPK-----------IDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++ KSE      IKKP  DL LK  G                V  DI  D   KK   ID+G    S   KV KPK           ID  VD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct: 1764 GGPNIDAKSEYRRKVDIKKPKADLDLKGHG---------------DVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 1883          

HSP 25 Score: 75.485 bits (184), Expect = 1.892e-15
Identity = 67/163 (41.10%), Postives = 77/163 (47.24%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPF--------KDKDQGNID-----------IRSPK---------------VQTDIKYDIDAKKSCEIDIG--NRSIERKVDKPK-----------IDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++ K +IKKP  DL LK  G          K K  G ID           ++ PK               V  DI  D   KK   ID+G    S   KV KPK           ID  VD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct: 2100 GGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 2262          

HSP 26 Score: 75.485 bits (184), Expect = 1.892e-15
Identity = 67/163 (41.10%), Postives = 77/163 (47.24%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPF--------KDKDQGNID-----------IRSPK---------------VQTDIKYDIDAKKSCEIDIG--NRSIERKVDKPK-----------IDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++ K +IKKP  DL LK  G          K K  G ID           ++ PK               V  DI  D   KK   ID+G    S   KV KPK           ID  VD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct: 2281 GGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 2443          

HSP 27 Score: 73.9442 bits (180), Expect = 6.038e-15
Identity = 61/149 (40.94%), Postives = 73/149 (48.99%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPF--------KDKDQGNID-----------IRSPKVQTDI---KYDIDAKKSCEIDIGNRSIERKVDKPK-----------IDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++ K +IKKP  DL LK  G          K K  G ID           ++ PK + DI             ++     S   KV KPK           ID NVD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct: 1531 CGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 1679          

HSP 28 Score: 71.633 bits (174), Expect = 4.050e-14
Identity = 55/126 (43.65%), Postives = 67/126 (53.17%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPF--------KDKDQGNIDI--RSPKVQTDIKYDIDAKKSCEIDIGNRSIERKVDKPKIDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++   +IKKP  DL LK  G          K K  G ID+    P     +K     K   +IDI   +I+ K         VD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct: 1465 GGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKK---PKGEIDIDICGPNIDAK---------VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 1578          

HSP 29 Score: 67.3958 bits (163), Expect = 1.055e-12
Identity = 49/111 (44.14%), Postives = 63/111 (56.76%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIGNRSIERKVDKPKIDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIE 692
             G N++ K +IKKP  DL LK  G        ++DI   + + ++K     K   +IDIG          P ID NVD KKPKADL LK HGD+DVD+DL+ KK KH GI+
Sbjct: 2633 GGPNIDAKVDIKKPKADLDLKGHGDV------DVDIDLDERKRNMK----PKGEIDIDIGG---------PNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHSGID 2724          

HSP 30 Score: 66.2402 bits (160), Expect = 2.823e-12
Identity = 51/119 (42.86%), Postives = 64/119 (53.78%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIG--NRSIERKVDKPKIDVNVDKKKPKADLG-LKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++ K +IKKP  DL LK  G                V  DI  D   KK   ID+G    S   KV KPK ++++D       +G LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct:  908 GGPNIDAKVDIKKPKADLDLKGHG---------------DVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDID-------IGDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 1004          

HSP 31 Score: 61.2326 bits (147), Expect = 1.218e-10
Identity = 59/168 (35.12%), Postives = 67/168 (39.88%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIG--NRSIERKVDKPKI--------------------------------------------------DVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++ K +IKKP  DL LK  G                V  DI  D   KK   ID+G    S   KV KPK                                                   D NVD KKPKADL LK HGD+DVD+DL+ KK K GGI+LGFNM
Sbjct: 2396 GGPNIDAKVDIKKPKADLDLKGHG---------------DVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKKKKHGGIDLGFTMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKQGGIDLGFNM 2548          

HSP 32 Score: 57.3806 bits (137), Expect = 2.764e-9
Identity = 60/131 (45.80%), Postives = 68/131 (51.91%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIG--NRSIERKVDKPK-----------IDVNVDKKKPKADLGLKSHGDLDVDVDLEE--KKNKHGGIELGFNM 707
             G N++ K +IKKP  DL LK  G                V  DI  D   KK   ID+G    S   KV KPK           ID  VD KKPKADL LK HGD+DVDVD++   KK KHGGI+LGFNM
Sbjct: 1265 GGPNIDAKVDIKKPKADLDLKGHG---------------DVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDVDIDLDGKKKKHGGIDLGFNM 1380          
BLAST of SMED30028069 vs. Planmine SMEST
Match: SMESG000059907.1 (SMESG000059907.1)

HSP 1 Score: 342.043 bits (876), Expect = 4.690e-108
Identity = 224/229 (97.82%), Postives = 226/229 (98.69%), Query Frame = 3
Query:   21 MSQEKKKGVFGNILGYFKPSITVNINKDEKEDKSEKQVELISVNAGAKTNIPDLGFKAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGEFKAKATIGGNAKISGEAGHNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIGNRSIERKVDKPKIDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
            MSQEKKKGVFGNILGYFKPSITVNINKDEKEDKSEKQVELISVNAGAKTNIPDLGFKASVKKDKRSHSSSSSSSSSSSSSSDADKKKKKPKSSEKGEFKAKATIGGNAKISGEA HNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIGNRSIERKVDKPKID+NVDKKKPKADL LKSHGDLDVDVDLEEKK KHGGI+LGFNM
Sbjct:    1 MSQEKKKGVFGNILGYFKPSITVNINKDEKEDKSEKQVELISVNAGAKTNIPDLGFKASVKKDKRSHSSSSSSSSSSSSSSDADKKKKKPKSSEKGEFKAKATIGGNAKISGEAEHNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIGNRSIERKVDKPKIDINVDKKKPKADLELKSHGDLDVDVDLEEKKKKHGGIDLGFNM 229          

HSP 2 Score: 82.4185 bits (202), Expect = 9.371e-18
Identity = 61/129 (47.29%), Postives = 69/129 (53.49%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIG--NRSIERKVDKPK-----------IDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++ K +IKKP  DL LK  G                V  DI  D   KK   ID+G    S   KV KPK           ID NVD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct:  248 GGPNIDAKVDIKKPKADLDLKGHG---------------DVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 361          

HSP 3 Score: 82.4185 bits (202), Expect = 9.371e-18
Identity = 61/129 (47.29%), Postives = 69/129 (53.49%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIG--NRSIERKVDKPK-----------IDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++ K +IKKP  DL LK  G                V  DI  D   KK   ID+G    S   KV KPK           ID NVD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct:  446 GGPNIDAKVDIKKPKADLDLKGHG---------------DVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 559          

HSP 4 Score: 82.4185 bits (202), Expect = 9.371e-18
Identity = 61/129 (47.29%), Postives = 69/129 (53.49%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIG--NRSIERKVDKPK-----------IDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++ K +IKKP  DL LK  G                V  DI  D   KK   ID+G    S   KV KPK           ID NVD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct:  776 GGPNIDAKVDIKKPKADLDLKGHG---------------DVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 889          

HSP 5 Score: 82.4185 bits (202), Expect = 9.371e-18
Identity = 61/129 (47.29%), Postives = 69/129 (53.49%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIG--NRSIERKVDKPK-----------IDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++ K +IKKP  DL LK  G                V  DI  D   KK   ID+G    S   KV KPK           ID NVD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct: 1399 GGPNIDAKVDIKKPKADLDLKGHG---------------DVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 1512          

HSP 6 Score: 80.4925 bits (197), Expect = 3.809e-17
Identity = 60/129 (46.51%), Postives = 68/129 (52.71%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIG--NRSIERKVDKPK-----------IDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++   +IKKP  DL LK  G                V  DI  D   KK   ID+G    S   KV KPK           ID NVD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct:  314 GGPNIDANVDIKKPKADLDLKGHG---------------DVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 427          

HSP 7 Score: 80.4925 bits (197), Expect = 3.809e-17
Identity = 60/129 (46.51%), Postives = 68/129 (52.71%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIG--NRSIERKVDKPK-----------IDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++   +IKKP  DL LK  G                V  DI  D   KK   ID+G    S   KV KPK           ID NVD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct:  512 GGPNIDANVDIKKPKADLDLKGHG---------------DVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 625          

HSP 8 Score: 80.4925 bits (197), Expect = 3.809e-17
Identity = 60/129 (46.51%), Postives = 68/129 (52.71%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIG--NRSIERKVDKPK-----------IDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++   +IKKP  DL LK  G                V  DI  D   KK   ID+G    S   KV KPK           ID NVD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct:  578 GGPNIDANVDIKKPKADLDLKGHG---------------DVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 691          

HSP 9 Score: 79.7221 bits (195), Expect = 6.787e-17
Identity = 60/129 (46.51%), Postives = 68/129 (52.71%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIG--NRSIERKVDKPK-----------IDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++ K +IKKP  DL LK  G                V  DI  D   KK   ID+G    S   KV KPK           ID  VD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct: 1832 GGPNIDAKVDIKKPKADLDLKGHG---------------DVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 1945          

HSP 10 Score: 79.7221 bits (195), Expect = 6.787e-17
Identity = 60/129 (46.51%), Postives = 68/129 (52.71%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIG--NRSIERKVDKPK-----------IDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++ K +IKKP  DL LK  G                V  DI  D   KK   ID+G    S   KV KPK           ID  VD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct: 1898 GGPNIDAKVDIKKPKADLDLKGHG---------------DVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 2011          

HSP 11 Score: 79.7221 bits (195), Expect = 6.787e-17
Identity = 60/129 (46.51%), Postives = 68/129 (52.71%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIG--NRSIERKVDKPK-----------IDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++ K +IKKP  DL LK  G                V  DI  D   KK   ID+G    S   KV KPK           ID  VD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct: 1964 GGPNIDAKVDIKKPKADLDLKGHG---------------DVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 2077          

HSP 12 Score: 79.7221 bits (195), Expect = 6.787e-17
Identity = 60/129 (46.51%), Postives = 68/129 (52.71%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIG--NRSIERKVDKPK-----------IDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++ K +IKKP  DL LK  G                V  DI  D   KK   ID+G    S   KV KPK           ID  VD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct: 2030 GGPNIDAKVDIKKPKADLDLKGHG---------------DVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 2143          

HSP 13 Score: 79.7221 bits (195), Expect = 6.787e-17
Identity = 60/129 (46.51%), Postives = 68/129 (52.71%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIG--NRSIERKVDKPK-----------IDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++ K +IKKP  DL LK  G                V  DI  D   KK   ID+G    S   KV KPK           ID  VD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct: 2211 GGPNIDAKVDIKKPKADLDLKGHG---------------DVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 2324          

HSP 14 Score: 78.9518 bits (193), Expect = 1.517e-16
Identity = 56/129 (43.41%), Postives = 66/129 (51.16%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIG-------------NRSIERKVDKPKIDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++ K +IKKP  DL LK  G                V  DI  D   KK   ID+G                I+  +  P ID  VD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct:  710 GGPNIDAKVDIKKPKADLDLKGHG---------------DVDVDIDLDGKKKKHGGIDLGFNMPLFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 823          

HSP 15 Score: 78.9518 bits (193), Expect = 1.532e-16
Identity = 58/126 (46.03%), Postives = 68/126 (53.97%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPF--------KDKDQGNIDI--RSPKVQTDIKYDIDAKKSCEIDIGNRSIERKVDKPKIDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++   +IKKP  DL LK  G          K K QG ID+    P     +K     K   +IDIG          P ID  VD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct: 2497 GGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKQGGIDLGFNMPSFGGKVKK---PKGEIDIDIGG---------PNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 2610          

HSP 16 Score: 78.5666 bits (192), Expect = 1.716e-16
Identity = 68/156 (43.59%), Postives = 79/156 (50.64%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPF--------KDKDQGNIDI---------RSPKVQTDIK------YDIDA----KKSCEIDIG--NRSIERKVDKPK-----------IDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++ K +IKKP  DL LK  G          K K  G ID+         + PK   D+K       DID     KK   ID+G    S   KV KPK           ID  VD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct: 1157 GGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 1312          

HSP 17 Score: 78.1814 bits (191), Expect = 2.344e-16
Identity = 58/128 (45.31%), Postives = 68/128 (53.12%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPF----------KDKDQGNIDI--RSPKVQTDIKYDIDAKKSCEIDIGNRSIERKVDKPKIDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++   +IKKP  DL LK  G            K K  G ID+    P     +K     K   +IDIG          P ID NVD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct: 1023 GGPNIDANVDIKKPKADLDLKGHGDVDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKK---PKGEIDIDIGG---------PNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 1138          

HSP 18 Score: 78.1814 bits (191), Expect = 2.753e-16
Identity = 59/129 (45.74%), Postives = 67/129 (51.94%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIG--NRSIERKVDKPK-----------IDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++   +IKKP  DL LK  G                V  DI  D   KK   ID+G    S   KV KPK           ID  VD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct:  380 GGPNIDANVDIKKPKADLDLKGHG---------------DVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 493          

HSP 19 Score: 78.1814 bits (191), Expect = 2.753e-16
Identity = 59/129 (45.74%), Postives = 67/129 (51.94%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIG--NRSIERKVDKPK-----------IDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++   +IKKP  DL LK  G                V  DI  D   KK   ID+G    S   KV KPK           ID  VD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct:  644 GGPNIDANVDIKKPKADLDLKGHG---------------DVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 757          

HSP 20 Score: 78.1814 bits (191), Expect = 2.753e-16
Identity = 59/129 (45.74%), Postives = 67/129 (51.94%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIG--NRSIERKVDKPK-----------IDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++   +IKKP  DL LK  G                V  DI  D   KK   ID+G    S   KV KPK           ID  VD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct:  842 GGPNIDANVDIKKPKADLDLKGHG---------------DVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 955          

HSP 21 Score: 78.1814 bits (191), Expect = 2.753e-16
Identity = 59/129 (45.74%), Postives = 67/129 (51.94%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIG--NRSIERKVDKPK-----------IDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++   +IKKP  DL LK  G                V  DI  D   KK   ID+G    S   KV KPK           ID  VD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct: 1091 GGPNIDANVDIKKPKADLDLKGHG---------------DVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 1204          

HSP 22 Score: 78.1814 bits (191), Expect = 2.753e-16
Identity = 59/129 (45.74%), Postives = 67/129 (51.94%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIG--NRSIERKVDKPK-----------IDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++   +IKKP  DL LK  G                V  DI  D   KK   ID+G    S   KV KPK           ID  VD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct: 1632 GGPNIDANVDIKKPKADLDLKGHG---------------DVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 1745          

HSP 23 Score: 77.411 bits (189), Expect = 4.173e-16
Identity = 58/128 (45.31%), Postives = 68/128 (53.12%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPF----------KDKDQGNIDI--RSPKVQTDIKYDIDAKKSCEIDIGNRSIERKVDKPKIDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++ K +IKKP  DL LK  G            K K  G ID+    P     +K     K   +IDIG          P ID  VD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct: 1331 GGPNIDAKVDIKKPKADLDLKGHGDVDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKK---PKGEIDIDIGG---------PNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 1446          

HSP 24 Score: 75.485 bits (184), Expect = 2.002e-15
Identity = 67/163 (41.10%), Postives = 77/163 (47.24%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPF--------KDKDQGNID-----------IRSPK---------------VQTDIKYDIDAKKSCEIDIG--NRSIERKVDKPK-----------IDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++ K +IKKP  DL LK  G          K K  G ID           ++ PK               V  DI  D   KK   ID+G    S   KV KPK           ID  VD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct: 2096 GGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 2258          

HSP 25 Score: 75.485 bits (184), Expect = 2.002e-15
Identity = 67/163 (41.10%), Postives = 77/163 (47.24%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPF--------KDKDQGNID-----------IRSPK---------------VQTDIKYDIDAKKSCEIDIG--NRSIERKVDKPK-----------IDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++ K +IKKP  DL LK  G          K K  G ID           ++ PK               V  DI  D   KK   ID+G    S   KV KPK           ID  VD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct: 2277 GGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 2439          

HSP 26 Score: 75.0998 bits (183), Expect = 2.583e-15
Identity = 60/131 (45.80%), Postives = 68/131 (51.91%), Query Frame = 3
Query:  360 AGHNVNIKS--EIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIG--NRSIERKVDKPK-----------IDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++ K   +IKKP  DL LK  G                V  DI  D   KK   ID+G    S   KV KPK           ID  VD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct: 1764 GGPNIDAKRKVDIKKPKADLDLKGHG---------------DVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 1879          

HSP 27 Score: 73.9442 bits (180), Expect = 6.270e-15
Identity = 61/149 (40.94%), Postives = 73/149 (48.99%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPF--------KDKDQGNID-----------IRSPKVQTDI---KYDIDAKKSCEIDIGNRSIERKVDKPK-----------IDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++ K +IKKP  DL LK  G          K K  G ID           ++ PK + DI             ++     S   KV KPK           ID NVD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct: 1531 CGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 1679          

HSP 28 Score: 71.633 bits (174), Expect = 4.165e-14
Identity = 55/126 (43.65%), Postives = 67/126 (53.17%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPF--------KDKDQGNIDI--RSPKVQTDIKYDIDAKKSCEIDIGNRSIERKVDKPKIDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++   +IKKP  DL LK  G          K K  G ID+    P     +K     K   +IDI   +I+ K         VD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct: 1465 GGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKK---PKGEIDIDICGPNIDAK---------VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 1578          

HSP 29 Score: 67.3958 bits (163), Expect = 1.127e-12
Identity = 49/111 (44.14%), Postives = 63/111 (56.76%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIGNRSIERKVDKPKIDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIE 692
             G N++ K +IKKP  DL LK  G        ++DI   + + ++K     K   +IDIG          P ID NVD KKPKADL LK HGD+DVD+DL+ KK KH GI+
Sbjct: 2629 GGPNIDAKVDIKKPKADLDLKGHGDV------DVDIDLDERKRNMK----PKGEIDIDIGG---------PNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHSGID 2720          

HSP 30 Score: 66.2402 bits (160), Expect = 2.958e-12
Identity = 51/119 (42.86%), Postives = 64/119 (53.78%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIG--NRSIERKVDKPKIDVNVDKKKPKADLG-LKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++ K +IKKP  DL LK  G                V  DI  D   KK   ID+G    S   KV KPK ++++D       +G LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct:  908 GGPNIDAKVDIKKPKADLDLKGHG---------------DVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDID-------IGDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 1004          

HSP 31 Score: 61.2326 bits (147), Expect = 1.264e-10
Identity = 59/168 (35.12%), Postives = 67/168 (39.88%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIG--NRSIERKVDKPKI--------------------------------------------------DVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++ K +IKKP  DL LK  G                V  DI  D   KK   ID+G    S   KV KPK                                                   D NVD KKPKADL LK HGD+DVD+DL+ KK K GGI+LGFNM
Sbjct: 2392 GGPNIDAKVDIKKPKADLDLKGHG---------------DVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKKKKHGGIDLGFTMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKQGGIDLGFNM 2544          

HSP 32 Score: 57.3806 bits (137), Expect = 2.842e-9
Identity = 60/131 (45.80%), Postives = 68/131 (51.91%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIG--NRSIERKVDKPK-----------IDVNVDKKKPKADLGLKSHGDLDVDVDLEE--KKNKHGGIELGFNM 707
             G N++ K +IKKP  DL LK  G                V  DI  D   KK   ID+G    S   KV KPK           ID  VD KKPKADL LK HGD+DVDVD++   KK KHGGI+LGFNM
Sbjct: 1265 GGPNIDAKVDIKKPKADLDLKGHG---------------DVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDVDIDLDGKKKKHGGIDLGFNM 1380          
BLAST of SMED30028069 vs. Planmine SMEST
Match: SMESG000059907.1 (SMESG000059907.1)

HSP 1 Score: 342.043 bits (876), Expect = 4.877e-108
Identity = 224/229 (97.82%), Postives = 226/229 (98.69%), Query Frame = 3
Query:   21 MSQEKKKGVFGNILGYFKPSITVNINKDEKEDKSEKQVELISVNAGAKTNIPDLGFKAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGEFKAKATIGGNAKISGEAGHNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIGNRSIERKVDKPKIDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
            MSQEKKKGVFGNILGYFKPSITVNINKDEKEDKSEKQVELISVNAGAKTNIPDLGFKASVKKDKRSHSSSSSSSSSSSSSSDADKKKKKPKSSEKGEFKAKATIGGNAKISGEA HNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIGNRSIERKVDKPKID+NVDKKKPKADL LKSHGDLDVDVDLEEKK KHGGI+LGFNM
Sbjct:    1 MSQEKKKGVFGNILGYFKPSITVNINKDEKEDKSEKQVELISVNAGAKTNIPDLGFKASVKKDKRSHSSSSSSSSSSSSSSDADKKKKKPKSSEKGEFKAKATIGGNAKISGEAEHNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIGNRSIERKVDKPKIDINVDKKKPKADLELKSHGDLDVDVDLEEKKKKHGGIDLGFNM 229          

HSP 2 Score: 82.4185 bits (202), Expect = 9.199e-18
Identity = 61/129 (47.29%), Postives = 69/129 (53.49%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIG--NRSIERKVDKPK-----------IDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++ K +IKKP  DL LK  G                V  DI  D   KK   ID+G    S   KV KPK           ID NVD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct:  248 GGPNIDAKVDIKKPKADLDLKGHG---------------DVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 361          

HSP 3 Score: 82.4185 bits (202), Expect = 9.199e-18
Identity = 61/129 (47.29%), Postives = 69/129 (53.49%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIG--NRSIERKVDKPK-----------IDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++ K +IKKP  DL LK  G                V  DI  D   KK   ID+G    S   KV KPK           ID NVD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct:  446 GGPNIDAKVDIKKPKADLDLKGHG---------------DVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 559          

HSP 4 Score: 82.4185 bits (202), Expect = 9.199e-18
Identity = 61/129 (47.29%), Postives = 69/129 (53.49%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIG--NRSIERKVDKPK-----------IDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++ K +IKKP  DL LK  G                V  DI  D   KK   ID+G    S   KV KPK           ID NVD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct:  776 GGPNIDAKVDIKKPKADLDLKGHG---------------DVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 889          

HSP 5 Score: 82.4185 bits (202), Expect = 9.199e-18
Identity = 61/129 (47.29%), Postives = 69/129 (53.49%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIG--NRSIERKVDKPK-----------IDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++ K +IKKP  DL LK  G                V  DI  D   KK   ID+G    S   KV KPK           ID NVD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct: 1399 GGPNIDAKVDIKKPKADLDLKGHG---------------DVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 1512          

HSP 6 Score: 80.4925 bits (197), Expect = 3.739e-17
Identity = 60/129 (46.51%), Postives = 68/129 (52.71%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIG--NRSIERKVDKPK-----------IDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++   +IKKP  DL LK  G                V  DI  D   KK   ID+G    S   KV KPK           ID NVD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct:  314 GGPNIDANVDIKKPKADLDLKGHG---------------DVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 427          

HSP 7 Score: 80.4925 bits (197), Expect = 3.739e-17
Identity = 60/129 (46.51%), Postives = 68/129 (52.71%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIG--NRSIERKVDKPK-----------IDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++   +IKKP  DL LK  G                V  DI  D   KK   ID+G    S   KV KPK           ID NVD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct:  512 GGPNIDANVDIKKPKADLDLKGHG---------------DVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 625          

HSP 8 Score: 80.4925 bits (197), Expect = 3.739e-17
Identity = 60/129 (46.51%), Postives = 68/129 (52.71%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIG--NRSIERKVDKPK-----------IDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++   +IKKP  DL LK  G                V  DI  D   KK   ID+G    S   KV KPK           ID NVD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct:  578 GGPNIDANVDIKKPKADLDLKGHG---------------DVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 691          

HSP 9 Score: 79.7221 bits (195), Expect = 6.662e-17
Identity = 60/129 (46.51%), Postives = 68/129 (52.71%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIG--NRSIERKVDKPK-----------IDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++ K +IKKP  DL LK  G                V  DI  D   KK   ID+G    S   KV KPK           ID  VD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct: 1862 GGPNIDAKVDIKKPKADLDLKGHG---------------DVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 1975          

HSP 10 Score: 79.7221 bits (195), Expect = 6.662e-17
Identity = 60/129 (46.51%), Postives = 68/129 (52.71%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIG--NRSIERKVDKPK-----------IDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++ K +IKKP  DL LK  G                V  DI  D   KK   ID+G    S   KV KPK           ID  VD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct: 1928 GGPNIDAKVDIKKPKADLDLKGHG---------------DVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 2041          

HSP 11 Score: 79.7221 bits (195), Expect = 6.662e-17
Identity = 60/129 (46.51%), Postives = 68/129 (52.71%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIG--NRSIERKVDKPK-----------IDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++ K +IKKP  DL LK  G                V  DI  D   KK   ID+G    S   KV KPK           ID  VD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct: 1994 GGPNIDAKVDIKKPKADLDLKGHG---------------DVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 2107          

HSP 12 Score: 79.7221 bits (195), Expect = 6.662e-17
Identity = 60/129 (46.51%), Postives = 68/129 (52.71%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIG--NRSIERKVDKPK-----------IDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++ K +IKKP  DL LK  G                V  DI  D   KK   ID+G    S   KV KPK           ID  VD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct: 2060 GGPNIDAKVDIKKPKADLDLKGHG---------------DVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 2173          

HSP 13 Score: 79.7221 bits (195), Expect = 6.662e-17
Identity = 60/129 (46.51%), Postives = 68/129 (52.71%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIG--NRSIERKVDKPK-----------IDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++ K +IKKP  DL LK  G                V  DI  D   KK   ID+G    S   KV KPK           ID  VD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct: 2241 GGPNIDAKVDIKKPKADLDLKGHG---------------DVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 2354          

HSP 14 Score: 78.9518 bits (193), Expect = 1.461e-16
Identity = 56/129 (43.41%), Postives = 66/129 (51.16%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIG-------------NRSIERKVDKPKIDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++ K +IKKP  DL LK  G                V  DI  D   KK   ID+G                I+  +  P ID  VD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct:  710 GGPNIDAKVDIKKPKADLDLKGHG---------------DVDVDIDLDGKKKKHGGIDLGFNMPLFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 823          

HSP 15 Score: 78.5666 bits (192), Expect = 1.591e-16
Identity = 58/126 (46.03%), Postives = 68/126 (53.97%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPF--------KDKDQGNIDI--RSPKVQTDIKYDIDAKKSCEIDIGNRSIERKVDKPKIDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++   +IKKP  DL LK  G          K K QG ID+    P     +K     K   +IDIG          P ID  VD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct: 2527 GGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKQGGIDLGFNMPSFGGKVKK---PKGEIDIDIGG---------PNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 2640          

HSP 16 Score: 78.5666 bits (192), Expect = 1.700e-16
Identity = 68/156 (43.59%), Postives = 79/156 (50.64%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPF--------KDKDQGNIDI---------RSPKVQTDIK------YDIDA----KKSCEIDIG--NRSIERKVDKPK-----------IDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++ K +IKKP  DL LK  G          K K  G ID+         + PK   D+K       DID     KK   ID+G    S   KV KPK           ID  VD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct: 1157 GGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 1312          

HSP 17 Score: 78.1814 bits (191), Expect = 2.413e-16
Identity = 58/128 (45.31%), Postives = 68/128 (53.12%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPF----------KDKDQGNIDI--RSPKVQTDIKYDIDAKKSCEIDIGNRSIERKVDKPKIDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++   +IKKP  DL LK  G            K K  G ID+    P     +K     K   +IDIG          P ID NVD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct: 1023 GGPNIDANVDIKKPKADLDLKGHGDVDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKK---PKGEIDIDIGG---------PNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 1138          

HSP 18 Score: 78.1814 bits (191), Expect = 2.702e-16
Identity = 59/129 (45.74%), Postives = 67/129 (51.94%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIG--NRSIERKVDKPK-----------IDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++   +IKKP  DL LK  G                V  DI  D   KK   ID+G    S   KV KPK           ID  VD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct:  380 GGPNIDANVDIKKPKADLDLKGHG---------------DVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 493          

HSP 19 Score: 78.1814 bits (191), Expect = 2.702e-16
Identity = 59/129 (45.74%), Postives = 67/129 (51.94%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIG--NRSIERKVDKPK-----------IDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++   +IKKP  DL LK  G                V  DI  D   KK   ID+G    S   KV KPK           ID  VD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct:  644 GGPNIDANVDIKKPKADLDLKGHG---------------DVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 757          

HSP 20 Score: 78.1814 bits (191), Expect = 2.702e-16
Identity = 59/129 (45.74%), Postives = 67/129 (51.94%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIG--NRSIERKVDKPK-----------IDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++   +IKKP  DL LK  G                V  DI  D   KK   ID+G    S   KV KPK           ID  VD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct:  842 GGPNIDANVDIKKPKADLDLKGHG---------------DVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 955          

HSP 21 Score: 78.1814 bits (191), Expect = 2.702e-16
Identity = 59/129 (45.74%), Postives = 67/129 (51.94%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIG--NRSIERKVDKPK-----------IDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++   +IKKP  DL LK  G                V  DI  D   KK   ID+G    S   KV KPK           ID  VD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct: 1091 GGPNIDANVDIKKPKADLDLKGHG---------------DVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 1204          

HSP 22 Score: 78.1814 bits (191), Expect = 2.702e-16
Identity = 59/129 (45.74%), Postives = 67/129 (51.94%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIG--NRSIERKVDKPK-----------IDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++   +IKKP  DL LK  G                V  DI  D   KK   ID+G    S   KV KPK           ID  VD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct: 1632 GGPNIDANVDIKKPKADLDLKGHG---------------DVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 1745          

HSP 23 Score: 77.411 bits (189), Expect = 4.295e-16
Identity = 58/128 (45.31%), Postives = 68/128 (53.12%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPF----------KDKDQGNIDI--RSPKVQTDIKYDIDAKKSCEIDIGNRSIERKVDKPKIDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++ K +IKKP  DL LK  G            K K  G ID+    P     +K     K   +IDIG          P ID  VD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct: 1331 GGPNIDAKVDIKKPKADLDLKGHGDVDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKK---PKGEIDIDIGG---------PNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 1446          

HSP 24 Score: 75.485 bits (184), Expect = 1.947e-15
Identity = 67/163 (41.10%), Postives = 77/163 (47.24%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPF--------KDKDQGNID-----------IRSPK---------------VQTDIKYDIDAKKSCEIDIG--NRSIERKVDKPK-----------IDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++ K +IKKP  DL LK  G          K K  G ID           ++ PK               V  DI  D   KK   ID+G    S   KV KPK           ID  VD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct: 2126 GGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 2288          

HSP 25 Score: 75.485 bits (184), Expect = 1.947e-15
Identity = 67/163 (41.10%), Postives = 77/163 (47.24%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPF--------KDKDQGNID-----------IRSPK---------------VQTDIKYDIDAKKSCEIDIG--NRSIERKVDKPK-----------IDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++ K +IKKP  DL LK  G          K K  G ID           ++ PK               V  DI  D   KK   ID+G    S   KV KPK           ID  VD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct: 2307 GGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 2469          

HSP 26 Score: 73.9442 bits (180), Expect = 6.214e-15
Identity = 61/149 (40.94%), Postives = 73/149 (48.99%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPF--------KDKDQGNID-----------IRSPKVQTDI---KYDIDAKKSCEIDIGNRSIERKVDKPK-----------IDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++ K +IKKP  DL LK  G          K K  G ID           ++ PK + DI             ++     S   KV KPK           ID NVD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct: 1531 CGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 1679          

HSP 27 Score: 72.7886 bits (177), Expect = 1.907e-14
Identity = 52/101 (51.49%), Postives = 59/101 (58.42%), Query Frame = 3
Query:  456 NIDIRSPKVQTDIKYDIDA----KKSCEIDIG--NRSIERKVDKPK-----------IDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
            +IDI   K   D+  DID     KK   ID+G    S   KV KPK           ID  VD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct: 1809 DIDIGDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 1909          

HSP 28 Score: 71.633 bits (174), Expect = 4.327e-14
Identity = 55/126 (43.65%), Postives = 67/126 (53.17%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPF--------KDKDQGNIDI--RSPKVQTDIKYDIDAKKSCEIDIGNRSIERKVDKPKIDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++   +IKKP  DL LK  G          K K  G ID+    P     +K     K   +IDI   +I+ K         VD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct: 1465 GGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKK---PKGEIDIDICGPNIDAK---------VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 1578          

HSP 29 Score: 67.3958 bits (163), Expect = 1.065e-12
Identity = 63/148 (42.57%), Postives = 75/148 (50.68%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPF--------KDKDQGNID-----------IRSPKVQTDIKY---DIDAKK--SCEIDIG--NRSIERKVDKPK-----------IDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIE 692
             G N++ K +IKKP  DL LK  G          K K  G ID           ++ PK + DI     +IDAKK     ID+G    S   KV KPK           ID NVD KKPKADL LK HGD+DVD+DL+ KK KH GI+
Sbjct: 2593 GGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHSGID 2740          

HSP 30 Score: 66.2402 bits (160), Expect = 2.877e-12
Identity = 51/119 (42.86%), Postives = 64/119 (53.78%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIG--NRSIERKVDKPKIDVNVDKKKPKADLG-LKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++ K +IKKP  DL LK  G                V  DI  D   KK   ID+G    S   KV KPK ++++D       +G LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct:  908 GGPNIDAKVDIKKPKADLDLKGHG---------------DVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDID-------IGDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 1004          

HSP 31 Score: 61.2326 bits (147), Expect = 1.241e-10
Identity = 59/168 (35.12%), Postives = 67/168 (39.88%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIG--NRSIERKVDKPKI--------------------------------------------------DVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++ K +IKKP  DL LK  G                V  DI  D   KK   ID+G    S   KV KPK                                                   D NVD KKPKADL LK HGD+DVD+DL+ KK K GGI+LGFNM
Sbjct: 2422 GGPNIDAKVDIKKPKADLDLKGHG---------------DVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKKKKHGGIDLGFTMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKQGGIDLGFNM 2574          

HSP 32 Score: 57.3806 bits (137), Expect = 2.816e-9
Identity = 60/131 (45.80%), Postives = 68/131 (51.91%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIG--NRSIERKVDKPK-----------IDVNVDKKKPKADLGLKSHGDLDVDVDLEE--KKNKHGGIELGFNM 707
             G N++ K +IKKP  DL LK  G                V  DI  D   KK   ID+G    S   KV KPK           ID  VD KKPKADL LK HGD+DVDVD++   KK KHGGI+LGFNM
Sbjct: 1265 GGPNIDAKVDIKKPKADLDLKGHG---------------DVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDVDIDLDGKKKKHGGIDLGFNM 1380          
BLAST of SMED30028069 vs. Planmine SMEST
Match: SMESG000059907.1 (SMESG000059907.1)

HSP 1 Score: 342.043 bits (876), Expect = 4.877e-108
Identity = 224/229 (97.82%), Postives = 226/229 (98.69%), Query Frame = 3
Query:   21 MSQEKKKGVFGNILGYFKPSITVNINKDEKEDKSEKQVELISVNAGAKTNIPDLGFKAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGEFKAKATIGGNAKISGEAGHNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIGNRSIERKVDKPKIDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
            MSQEKKKGVFGNILGYFKPSITVNINKDEKEDKSEKQVELISVNAGAKTNIPDLGFKASVKKDKRSHSSSSSSSSSSSSSSDADKKKKKPKSSEKGEFKAKATIGGNAKISGEA HNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIGNRSIERKVDKPKID+NVDKKKPKADL LKSHGDLDVDVDLEEKK KHGGI+LGFNM
Sbjct:    1 MSQEKKKGVFGNILGYFKPSITVNINKDEKEDKSEKQVELISVNAGAKTNIPDLGFKASVKKDKRSHSSSSSSSSSSSSSSDADKKKKKPKSSEKGEFKAKATIGGNAKISGEAEHNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIGNRSIERKVDKPKIDINVDKKKPKADLELKSHGDLDVDVDLEEKKKKHGGIDLGFNM 229          

HSP 2 Score: 82.4185 bits (202), Expect = 9.287e-18
Identity = 61/129 (47.29%), Postives = 69/129 (53.49%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIG--NRSIERKVDKPK-----------IDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++ K +IKKP  DL LK  G                V  DI  D   KK   ID+G    S   KV KPK           ID NVD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct:  248 GGPNIDAKVDIKKPKADLDLKGHG---------------DVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 361          

HSP 3 Score: 82.4185 bits (202), Expect = 9.287e-18
Identity = 61/129 (47.29%), Postives = 69/129 (53.49%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIG--NRSIERKVDKPK-----------IDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++ K +IKKP  DL LK  G                V  DI  D   KK   ID+G    S   KV KPK           ID NVD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct:  446 GGPNIDAKVDIKKPKADLDLKGHG---------------DVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 559          

HSP 4 Score: 82.4185 bits (202), Expect = 9.287e-18
Identity = 61/129 (47.29%), Postives = 69/129 (53.49%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIG--NRSIERKVDKPK-----------IDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++ K +IKKP  DL LK  G                V  DI  D   KK   ID+G    S   KV KPK           ID NVD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct:  776 GGPNIDAKVDIKKPKADLDLKGHG---------------DVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 889          

HSP 5 Score: 82.4185 bits (202), Expect = 9.287e-18
Identity = 61/129 (47.29%), Postives = 69/129 (53.49%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIG--NRSIERKVDKPK-----------IDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++ K +IKKP  DL LK  G                V  DI  D   KK   ID+G    S   KV KPK           ID NVD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct: 1399 GGPNIDAKVDIKKPKADLDLKGHG---------------DVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 1512          

HSP 6 Score: 80.4925 bits (197), Expect = 3.740e-17
Identity = 60/129 (46.51%), Postives = 68/129 (52.71%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIG--NRSIERKVDKPK-----------IDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++   +IKKP  DL LK  G                V  DI  D   KK   ID+G    S   KV KPK           ID NVD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct:  314 GGPNIDANVDIKKPKADLDLKGHG---------------DVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 427          

HSP 7 Score: 80.4925 bits (197), Expect = 3.740e-17
Identity = 60/129 (46.51%), Postives = 68/129 (52.71%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIG--NRSIERKVDKPK-----------IDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++   +IKKP  DL LK  G                V  DI  D   KK   ID+G    S   KV KPK           ID NVD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct:  512 GGPNIDANVDIKKPKADLDLKGHG---------------DVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 625          

HSP 8 Score: 80.4925 bits (197), Expect = 3.740e-17
Identity = 60/129 (46.51%), Postives = 68/129 (52.71%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIG--NRSIERKVDKPK-----------IDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++   +IKKP  DL LK  G                V  DI  D   KK   ID+G    S   KV KPK           ID NVD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct:  578 GGPNIDANVDIKKPKADLDLKGHG---------------DVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 691          

HSP 9 Score: 79.7221 bits (195), Expect = 6.726e-17
Identity = 60/129 (46.51%), Postives = 68/129 (52.71%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIG--NRSIERKVDKPK-----------IDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++ K +IKKP  DL LK  G                V  DI  D   KK   ID+G    S   KV KPK           ID  VD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct: 1862 GGPNIDAKVDIKKPKADLDLKGHG---------------DVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 1975          

HSP 10 Score: 79.7221 bits (195), Expect = 6.726e-17
Identity = 60/129 (46.51%), Postives = 68/129 (52.71%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIG--NRSIERKVDKPK-----------IDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++ K +IKKP  DL LK  G                V  DI  D   KK   ID+G    S   KV KPK           ID  VD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct: 1928 GGPNIDAKVDIKKPKADLDLKGHG---------------DVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 2041          

HSP 11 Score: 79.7221 bits (195), Expect = 6.726e-17
Identity = 60/129 (46.51%), Postives = 68/129 (52.71%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIG--NRSIERKVDKPK-----------IDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++ K +IKKP  DL LK  G                V  DI  D   KK   ID+G    S   KV KPK           ID  VD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct: 1994 GGPNIDAKVDIKKPKADLDLKGHG---------------DVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 2107          

HSP 12 Score: 79.7221 bits (195), Expect = 6.726e-17
Identity = 60/129 (46.51%), Postives = 68/129 (52.71%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIG--NRSIERKVDKPK-----------IDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++ K +IKKP  DL LK  G                V  DI  D   KK   ID+G    S   KV KPK           ID  VD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct: 2060 GGPNIDAKVDIKKPKADLDLKGHG---------------DVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 2173          

HSP 13 Score: 79.7221 bits (195), Expect = 6.726e-17
Identity = 60/129 (46.51%), Postives = 68/129 (52.71%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIG--NRSIERKVDKPK-----------IDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++ K +IKKP  DL LK  G                V  DI  D   KK   ID+G    S   KV KPK           ID  VD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct: 2241 GGPNIDAKVDIKKPKADLDLKGHG---------------DVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 2354          

HSP 14 Score: 78.9518 bits (193), Expect = 1.461e-16
Identity = 56/129 (43.41%), Postives = 66/129 (51.16%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIG-------------NRSIERKVDKPKIDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++ K +IKKP  DL LK  G                V  DI  D   KK   ID+G                I+  +  P ID  VD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct:  710 GGPNIDAKVDIKKPKADLDLKGHG---------------DVDVDIDLDGKKKKHGGIDLGFNMPLFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 823          

HSP 15 Score: 78.9518 bits (193), Expect = 1.576e-16
Identity = 58/126 (46.03%), Postives = 68/126 (53.97%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPF--------KDKDQGNIDI--RSPKVQTDIKYDIDAKKSCEIDIGNRSIERKVDKPKIDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++   +IKKP  DL LK  G          K K QG ID+    P     +K     K   +IDIG          P ID  VD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct: 2530 GGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKQGGIDLGFNMPSFGGKVKK---PKGEIDIDIGG---------PNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 2643          

HSP 16 Score: 78.5666 bits (192), Expect = 1.700e-16
Identity = 68/156 (43.59%), Postives = 79/156 (50.64%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPF--------KDKDQGNIDI---------RSPKVQTDIK------YDIDA----KKSCEIDIG--NRSIERKVDKPK-----------IDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++ K +IKKP  DL LK  G          K K  G ID+         + PK   D+K       DID     KK   ID+G    S   KV KPK           ID  VD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct: 1157 GGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 1312          

HSP 17 Score: 78.1814 bits (191), Expect = 2.390e-16
Identity = 58/128 (45.31%), Postives = 68/128 (53.12%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPF----------KDKDQGNIDI--RSPKVQTDIKYDIDAKKSCEIDIGNRSIERKVDKPKIDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++   +IKKP  DL LK  G            K K  G ID+    P     +K     K   +IDIG          P ID NVD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct: 1023 GGPNIDANVDIKKPKADLDLKGHGDVDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKK---PKGEIDIDIGG---------PNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 1138          

HSP 18 Score: 78.1814 bits (191), Expect = 2.703e-16
Identity = 59/129 (45.74%), Postives = 67/129 (51.94%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIG--NRSIERKVDKPK-----------IDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++   +IKKP  DL LK  G                V  DI  D   KK   ID+G    S   KV KPK           ID  VD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct:  380 GGPNIDANVDIKKPKADLDLKGHG---------------DVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 493          

HSP 19 Score: 78.1814 bits (191), Expect = 2.703e-16
Identity = 59/129 (45.74%), Postives = 67/129 (51.94%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIG--NRSIERKVDKPK-----------IDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++   +IKKP  DL LK  G                V  DI  D   KK   ID+G    S   KV KPK           ID  VD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct:  644 GGPNIDANVDIKKPKADLDLKGHG---------------DVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 757          

HSP 20 Score: 78.1814 bits (191), Expect = 2.703e-16
Identity = 59/129 (45.74%), Postives = 67/129 (51.94%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIG--NRSIERKVDKPK-----------IDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++   +IKKP  DL LK  G                V  DI  D   KK   ID+G    S   KV KPK           ID  VD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct:  842 GGPNIDANVDIKKPKADLDLKGHG---------------DVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 955          

HSP 21 Score: 78.1814 bits (191), Expect = 2.703e-16
Identity = 59/129 (45.74%), Postives = 67/129 (51.94%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIG--NRSIERKVDKPK-----------IDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++   +IKKP  DL LK  G                V  DI  D   KK   ID+G    S   KV KPK           ID  VD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct: 1091 GGPNIDANVDIKKPKADLDLKGHG---------------DVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 1204          

HSP 22 Score: 78.1814 bits (191), Expect = 2.703e-16
Identity = 59/129 (45.74%), Postives = 67/129 (51.94%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIG--NRSIERKVDKPK-----------IDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++   +IKKP  DL LK  G                V  DI  D   KK   ID+G    S   KV KPK           ID  VD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct: 1632 GGPNIDANVDIKKPKADLDLKGHG---------------DVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 1745          

HSP 23 Score: 77.411 bits (189), Expect = 4.295e-16
Identity = 58/128 (45.31%), Postives = 68/128 (53.12%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPF----------KDKDQGNIDI--RSPKVQTDIKYDIDAKKSCEIDIGNRSIERKVDKPKIDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++ K +IKKP  DL LK  G            K K  G ID+    P     +K     K   +IDIG          P ID  VD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct: 1331 GGPNIDAKVDIKKPKADLDLKGHGDVDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKK---PKGEIDIDIGG---------PNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 1446          

HSP 24 Score: 75.485 bits (184), Expect = 1.965e-15
Identity = 67/163 (41.10%), Postives = 77/163 (47.24%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPF--------KDKDQGNID-----------IRSPK---------------VQTDIKYDIDAKKSCEIDIG--NRSIERKVDKPK-----------IDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++ K +IKKP  DL LK  G          K K  G ID           ++ PK               V  DI  D   KK   ID+G    S   KV KPK           ID  VD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct: 2126 GGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 2288          

HSP 25 Score: 74.7146 bits (182), Expect = 4.261e-15
Identity = 65/166 (39.16%), Postives = 80/166 (48.19%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPF--------KDKDQGNID-----------IRSPK--VQTDIKYDIDAKKSCEIDI-----GNR-------------SIERKVDKPK-----------IDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++ K +IKKP  DL LK  G          K K  G ID           ++ PK  +  DI  D+D K   ++D+     G +             S   KV KPK           ID  VD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct: 2307 GGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 2472          

HSP 26 Score: 73.9442 bits (180), Expect = 6.214e-15
Identity = 61/149 (40.94%), Postives = 73/149 (48.99%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPF--------KDKDQGNID-----------IRSPKVQTDI---KYDIDAKKSCEIDIGNRSIERKVDKPK-----------IDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++ K +IKKP  DL LK  G          K K  G ID           ++ PK + DI             ++     S   KV KPK           ID NVD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct: 1531 CGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 1679          

HSP 27 Score: 72.7886 bits (177), Expect = 1.907e-14
Identity = 52/101 (51.49%), Postives = 59/101 (58.42%), Query Frame = 3
Query:  456 NIDIRSPKVQTDIKYDIDA----KKSCEIDIG--NRSIERKVDKPK-----------IDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
            +IDI   K   D+  DID     KK   ID+G    S   KV KPK           ID  VD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct: 1809 DIDIGDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 1909          

HSP 28 Score: 71.633 bits (174), Expect = 4.327e-14
Identity = 55/126 (43.65%), Postives = 67/126 (53.17%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPF--------KDKDQGNIDI--RSPKVQTDIKYDIDAKKSCEIDIGNRSIERKVDKPKIDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++   +IKKP  DL LK  G          K K  G ID+    P     +K     K   +IDI   +I+ K         VD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct: 1465 GGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKK---PKGEIDIDICGPNIDAK---------VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 1578          

HSP 29 Score: 67.3958 bits (163), Expect = 1.065e-12
Identity = 63/148 (42.57%), Postives = 75/148 (50.68%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPF--------KDKDQGNID-----------IRSPKVQTDIKY---DIDAKK--SCEIDIG--NRSIERKVDKPK-----------IDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIE 692
             G N++ K +IKKP  DL LK  G          K K  G ID           ++ PK + DI     +IDAKK     ID+G    S   KV KPK           ID NVD KKPKADL LK HGD+DVD+DL+ KK KH GI+
Sbjct: 2596 GGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHSGID 2743          

HSP 30 Score: 66.2402 bits (160), Expect = 2.904e-12
Identity = 51/119 (42.86%), Postives = 64/119 (53.78%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIG--NRSIERKVDKPKIDVNVDKKKPKADLG-LKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++ K +IKKP  DL LK  G                V  DI  D   KK   ID+G    S   KV KPK ++++D       +G LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct:  908 GGPNIDAKVDIKKPKADLDLKGHG---------------DVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDID-------IGDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 1004          

HSP 31 Score: 57.3806 bits (137), Expect = 2.843e-9
Identity = 60/131 (45.80%), Postives = 68/131 (51.91%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIG--NRSIERKVDKPK-----------IDVNVDKKKPKADLGLKSHGDLDVDVDLEE--KKNKHGGIELGFNM 707
             G N++ K +IKKP  DL LK  G                V  DI  D   KK   ID+G    S   KV KPK           ID  VD KKPKADL LK HGD+DVDVD++   KK KHGGI+LGFNM
Sbjct: 1265 GGPNIDAKVDIKKPKADLDLKGHG---------------DVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDVDIDLDGKKKKHGGIDLGFNM 1380          
BLAST of SMED30028069 vs. Planmine SMEST
Match: SMESG000059907.1 (SMESG000059907.1)

HSP 1 Score: 342.043 bits (876), Expect = 5.266e-108
Identity = 224/229 (97.82%), Postives = 226/229 (98.69%), Query Frame = 3
Query:   21 MSQEKKKGVFGNILGYFKPSITVNINKDEKEDKSEKQVELISVNAGAKTNIPDLGFKAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGEFKAKATIGGNAKISGEAGHNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIGNRSIERKVDKPKIDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
            MSQEKKKGVFGNILGYFKPSITVNINKDEKEDKSEKQVELISVNAGAKTNIPDLGFKASVKKDKRSHSSSSSSSSSSSSSSDADKKKKKPKSSEKGEFKAKATIGGNAKISGEA HNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIGNRSIERKVDKPKID+NVDKKKPKADL LKSHGDLDVDVDLEEKK KHGGI+LGFNM
Sbjct:    1 MSQEKKKGVFGNILGYFKPSITVNINKDEKEDKSEKQVELISVNAGAKTNIPDLGFKASVKKDKRSHSSSSSSSSSSSSSSDADKKKKKPKSSEKGEFKAKATIGGNAKISGEAEHNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIGNRSIERKVDKPKIDINVDKKKPKADLELKSHGDLDVDVDLEEKKKKHGGIDLGFNM 229          

HSP 2 Score: 82.4185 bits (202), Expect = 9.459e-18
Identity = 61/129 (47.29%), Postives = 69/129 (53.49%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIG--NRSIERKVDKPK-----------IDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++ K +IKKP  DL LK  G                V  DI  D   KK   ID+G    S   KV KPK           ID NVD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct:  248 GGPNIDAKVDIKKPKADLDLKGHG---------------DVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 361          

HSP 3 Score: 82.4185 bits (202), Expect = 9.459e-18
Identity = 61/129 (47.29%), Postives = 69/129 (53.49%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIG--NRSIERKVDKPK-----------IDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++ K +IKKP  DL LK  G                V  DI  D   KK   ID+G    S   KV KPK           ID NVD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct:  446 GGPNIDAKVDIKKPKADLDLKGHG---------------DVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 559          

HSP 4 Score: 82.4185 bits (202), Expect = 9.459e-18
Identity = 61/129 (47.29%), Postives = 69/129 (53.49%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIG--NRSIERKVDKPK-----------IDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++ K +IKKP  DL LK  G                V  DI  D   KK   ID+G    S   KV KPK           ID NVD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct:  776 GGPNIDAKVDIKKPKADLDLKGHG---------------DVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 889          

HSP 5 Score: 82.4185 bits (202), Expect = 9.459e-18
Identity = 61/129 (47.29%), Postives = 69/129 (53.49%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIG--NRSIERKVDKPK-----------IDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++ K +IKKP  DL LK  G                V  DI  D   KK   ID+G    S   KV KPK           ID NVD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct: 1399 GGPNIDAKVDIKKPKADLDLKGHG---------------DVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 1512          

HSP 6 Score: 80.4925 bits (197), Expect = 3.845e-17
Identity = 60/129 (46.51%), Postives = 68/129 (52.71%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIG--NRSIERKVDKPK-----------IDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++   +IKKP  DL LK  G                V  DI  D   KK   ID+G    S   KV KPK           ID NVD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct:  314 GGPNIDANVDIKKPKADLDLKGHG---------------DVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 427          

HSP 7 Score: 80.4925 bits (197), Expect = 3.845e-17
Identity = 60/129 (46.51%), Postives = 68/129 (52.71%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIG--NRSIERKVDKPK-----------IDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++   +IKKP  DL LK  G                V  DI  D   KK   ID+G    S   KV KPK           ID NVD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct:  512 GGPNIDANVDIKKPKADLDLKGHG---------------DVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 625          

HSP 8 Score: 80.4925 bits (197), Expect = 3.845e-17
Identity = 60/129 (46.51%), Postives = 68/129 (52.71%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIG--NRSIERKVDKPK-----------IDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++   +IKKP  DL LK  G                V  DI  D   KK   ID+G    S   KV KPK           ID NVD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct:  578 GGPNIDANVDIKKPKADLDLKGHG---------------DVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 691          

HSP 9 Score: 79.7221 bits (195), Expect = 6.850e-17
Identity = 60/129 (46.51%), Postives = 68/129 (52.71%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIG--NRSIERKVDKPK-----------IDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++ K +IKKP  DL LK  G                V  DI  D   KK   ID+G    S   KV KPK           ID  VD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct: 1832 GGPNIDAKVDIKKPKADLDLKGHG---------------DVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 1945          

HSP 10 Score: 79.7221 bits (195), Expect = 6.850e-17
Identity = 60/129 (46.51%), Postives = 68/129 (52.71%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIG--NRSIERKVDKPK-----------IDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++ K +IKKP  DL LK  G                V  DI  D   KK   ID+G    S   KV KPK           ID  VD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct: 1898 GGPNIDAKVDIKKPKADLDLKGHG---------------DVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 2011          

HSP 11 Score: 79.7221 bits (195), Expect = 6.850e-17
Identity = 60/129 (46.51%), Postives = 68/129 (52.71%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIG--NRSIERKVDKPK-----------IDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++ K +IKKP  DL LK  G                V  DI  D   KK   ID+G    S   KV KPK           ID  VD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct: 1964 GGPNIDAKVDIKKPKADLDLKGHG---------------DVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 2077          

HSP 12 Score: 79.7221 bits (195), Expect = 6.850e-17
Identity = 60/129 (46.51%), Postives = 68/129 (52.71%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIG--NRSIERKVDKPK-----------IDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++ K +IKKP  DL LK  G                V  DI  D   KK   ID+G    S   KV KPK           ID  VD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct: 2030 GGPNIDAKVDIKKPKADLDLKGHG---------------DVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 2143          

HSP 13 Score: 79.7221 bits (195), Expect = 6.850e-17
Identity = 60/129 (46.51%), Postives = 68/129 (52.71%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIG--NRSIERKVDKPK-----------IDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++ K +IKKP  DL LK  G                V  DI  D   KK   ID+G    S   KV KPK           ID  VD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct: 2211 GGPNIDAKVDIKKPKADLDLKGHG---------------DVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 2324          

HSP 14 Score: 78.9518 bits (193), Expect = 1.517e-16
Identity = 56/129 (43.41%), Postives = 66/129 (51.16%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIG-------------NRSIERKVDKPKIDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++ K +IKKP  DL LK  G                V  DI  D   KK   ID+G                I+  +  P ID  VD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct:  710 GGPNIDAKVDIKKPKADLDLKGHG---------------DVDVDIDLDGKKKKHGGIDLGFNMPLFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 823          

HSP 15 Score: 78.9518 bits (193), Expect = 1.560e-16
Identity = 58/126 (46.03%), Postives = 68/126 (53.97%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPF--------KDKDQGNIDI--RSPKVQTDIKYDIDAKKSCEIDIGNRSIERKVDKPKIDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++   +IKKP  DL LK  G          K K QG ID+    P     +K     K   +IDIG          P ID  VD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct: 2497 GGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKQGGIDLGFNMPSFGGKVKK---PKGEIDIDIGG---------PNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 2610          

HSP 16 Score: 78.5666 bits (192), Expect = 1.715e-16
Identity = 68/156 (43.59%), Postives = 79/156 (50.64%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPF--------KDKDQGNIDI---------RSPKVQTDIK------YDIDA----KKSCEIDIG--NRSIERKVDKPK-----------IDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++ K +IKKP  DL LK  G          K K  G ID+         + PK   D+K       DID     KK   ID+G    S   KV KPK           ID  VD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct: 1157 GGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 1312          

HSP 17 Score: 78.1814 bits (191), Expect = 2.411e-16
Identity = 58/128 (45.31%), Postives = 68/128 (53.12%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPF----------KDKDQGNIDI--RSPKVQTDIKYDIDAKKSCEIDIGNRSIERKVDKPKIDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++   +IKKP  DL LK  G            K K  G ID+    P     +K     K   +IDIG          P ID NVD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct: 1023 GGPNIDANVDIKKPKADLDLKGHGDVDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKK---PKGEIDIDIGG---------PNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 1138          

HSP 18 Score: 78.1814 bits (191), Expect = 2.779e-16
Identity = 59/129 (45.74%), Postives = 67/129 (51.94%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIG--NRSIERKVDKPK-----------IDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++   +IKKP  DL LK  G                V  DI  D   KK   ID+G    S   KV KPK           ID  VD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct:  380 GGPNIDANVDIKKPKADLDLKGHG---------------DVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 493          

HSP 19 Score: 78.1814 bits (191), Expect = 2.779e-16
Identity = 59/129 (45.74%), Postives = 67/129 (51.94%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIG--NRSIERKVDKPK-----------IDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++   +IKKP  DL LK  G                V  DI  D   KK   ID+G    S   KV KPK           ID  VD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct:  644 GGPNIDANVDIKKPKADLDLKGHG---------------DVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 757          

HSP 20 Score: 78.1814 bits (191), Expect = 2.779e-16
Identity = 59/129 (45.74%), Postives = 67/129 (51.94%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIG--NRSIERKVDKPK-----------IDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++   +IKKP  DL LK  G                V  DI  D   KK   ID+G    S   KV KPK           ID  VD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct:  842 GGPNIDANVDIKKPKADLDLKGHG---------------DVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 955          

HSP 21 Score: 78.1814 bits (191), Expect = 2.779e-16
Identity = 59/129 (45.74%), Postives = 67/129 (51.94%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIG--NRSIERKVDKPK-----------IDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++   +IKKP  DL LK  G                V  DI  D   KK   ID+G    S   KV KPK           ID  VD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct: 1091 GGPNIDANVDIKKPKADLDLKGHG---------------DVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 1204          

HSP 22 Score: 78.1814 bits (191), Expect = 2.779e-16
Identity = 59/129 (45.74%), Postives = 67/129 (51.94%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIG--NRSIERKVDKPK-----------IDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++   +IKKP  DL LK  G                V  DI  D   KK   ID+G    S   KV KPK           ID  VD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct: 1632 GGPNIDANVDIKKPKADLDLKGHG---------------DVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 1745          

HSP 23 Score: 77.411 bits (189), Expect = 4.292e-16
Identity = 58/128 (45.31%), Postives = 68/128 (53.12%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPF----------KDKDQGNIDI--RSPKVQTDIKYDIDAKKSCEIDIGNRSIERKVDKPKIDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++ K +IKKP  DL LK  G            K K  G ID+    P     +K     K   +IDIG          P ID  VD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct: 1331 GGPNIDAKVDIKKPKADLDLKGHGDVDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKK---PKGEIDIDIGG---------PNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 1446          

HSP 24 Score: 75.485 bits (184), Expect = 2.002e-15
Identity = 67/163 (41.10%), Postives = 77/163 (47.24%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPF--------KDKDQGNID-----------IRSPK---------------VQTDIKYDIDAKKSCEIDIG--NRSIERKVDKPK-----------IDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++ K +IKKP  DL LK  G          K K  G ID           ++ PK               V  DI  D   KK   ID+G    S   KV KPK           ID  VD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct: 2096 GGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 2258          

HSP 25 Score: 75.485 bits (184), Expect = 2.002e-15
Identity = 67/163 (41.10%), Postives = 77/163 (47.24%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPF--------KDKDQGNID-----------IRSPK---------------VQTDIKYDIDAKKSCEIDIG--NRSIERKVDKPK-----------IDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++ K +IKKP  DL LK  G          K K  G ID           ++ PK               V  DI  D   KK   ID+G    S   KV KPK           ID  VD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct: 2277 GGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 2439          

HSP 26 Score: 75.0998 bits (183), Expect = 2.607e-15
Identity = 60/131 (45.80%), Postives = 68/131 (51.91%), Query Frame = 3
Query:  360 AGHNVNIKS--EIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIG--NRSIERKVDKPK-----------IDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++ K   +IKKP  DL LK  G                V  DI  D   KK   ID+G    S   KV KPK           ID  VD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct: 1764 GGPNIDAKRKVDIKKPKADLDLKGHG---------------DVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 1879          

HSP 27 Score: 73.9442 bits (180), Expect = 6.328e-15
Identity = 61/149 (40.94%), Postives = 73/149 (48.99%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPF--------KDKDQGNID-----------IRSPKVQTDI---KYDIDAKKSCEIDIGNRSIERKVDKPK-----------IDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++ K +IKKP  DL LK  G          K K  G ID           ++ PK + DI             ++     S   KV KPK           ID NVD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct: 1531 CGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 1679          

HSP 28 Score: 71.633 bits (174), Expect = 4.204e-14
Identity = 55/126 (43.65%), Postives = 67/126 (53.17%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPF--------KDKDQGNIDI--RSPKVQTDIKYDIDAKKSCEIDIGNRSIERKVDKPKIDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++   +IKKP  DL LK  G          K K  G ID+    P     +K     K   +IDI   +I+ K         VD KKPKADL LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct: 1465 GGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKK---PKGEIDIDICGPNIDAK---------VDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 1578          

HSP 29 Score: 67.3958 bits (163), Expect = 1.095e-12
Identity = 63/148 (42.57%), Postives = 75/148 (50.68%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPF--------KDKDQGNID-----------IRSPKVQTDIKY---DIDAKK--SCEIDIG--NRSIERKVDKPK-----------IDVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIE 692
             G N++ K +IKKP  DL LK  G          K K  G ID           ++ PK + DI     +IDAKK     ID+G    S   KV KPK           ID NVD KKPKADL LK HGD+DVD+DL+ KK KH GI+
Sbjct: 2563 GGPNIDAKVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKHSGID 2710          

HSP 30 Score: 66.2402 bits (160), Expect = 2.929e-12
Identity = 51/119 (42.86%), Postives = 64/119 (53.78%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIG--NRSIERKVDKPKIDVNVDKKKPKADLG-LKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++ K +IKKP  DL LK  G                V  DI  D   KK   ID+G    S   KV KPK ++++D       +G LK HGD+DVD+DL+ KK KHGGI+LGFNM
Sbjct:  908 GGPNIDAKVDIKKPKADLDLKGHG---------------DVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDID-------IGDLKGHGDVDVDIDLDGKKKKHGGIDLGFNM 1004          

HSP 31 Score: 61.2326 bits (147), Expect = 1.276e-10
Identity = 59/168 (35.12%), Postives = 67/168 (39.88%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIG--NRSIERKVDKPKI--------------------------------------------------DVNVDKKKPKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM 707
             G N++ K +IKKP  DL LK  G                V  DI  D   KK   ID+G    S   KV KPK                                                   D NVD KKPKADL LK HGD+DVD+DL+ KK K GGI+LGFNM
Sbjct: 2392 GGPNIDAKVDIKKPKADLDLKGHG---------------DVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKKKKHGGIDLGFTMPSFGGKVKKPKGEIDIDIGGPNIDANVDIKKPKADLDLKGHGDVDVDIDLDGKKKKQGGIDLGFNM 2544          

HSP 32 Score: 57.3806 bits (137), Expect = 2.894e-9
Identity = 60/131 (45.80%), Postives = 68/131 (51.91%), Query Frame = 3
Query:  360 AGHNVNIKSEIKKPNIDLHLKDKGPFKDKDQGNIDIRSPKVQTDIKYDIDAKKSCEIDIG--NRSIERKVDKPK-----------IDVNVDKKKPKADLGLKSHGDLDVDVDLEE--KKNKHGGIELGFNM 707
             G N++ K +IKKP  DL LK  G                V  DI  D   KK   ID+G    S   KV KPK           ID  VD KKPKADL LK HGD+DVDVD++   KK KHGGI+LGFNM
Sbjct: 1265 GGPNIDAKVDIKKPKADLDLKGHG---------------DVDVDIDLDGKKKKHGGIDLGFNMPSFGGKVKKPKGEIDIDIGGPNIDAKVDIKKPKADLDLKGHGDVDVDVDIDLDGKKKKHGGIDLGFNM 1380          
The following BLAST results are available for this feature:
BLAST of SMED30028069 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30028069 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30028069 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30028069 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30028069 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30028069 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30028069 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30028069 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30028069 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30028069 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30028069 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30028069 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30028069 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30028069 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000059907.13.903e-10897.82SMESG000059907.1[more]
SMESG000059907.14.690e-10897.82SMESG000059907.1[more]
SMESG000059907.14.877e-10897.82SMESG000059907.1[more]
SMESG000059907.14.877e-10897.82SMESG000059907.1[more]
SMESG000059907.15.266e-10897.82SMESG000059907.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028069 ID=SMED30028069|Name=SMED30028069|organism=Schmidtea mediterranea sexual|type=transcript|length=707bp
AGACACAATACAAAATTTGGATGAGTCAAGAAAAGAAAAAAGGAGTTTTT
GGTAACATTTTAGGATATTTTAAGCCATCAATCACAGTAAACATCAATAA
AGATGAAAAAGAAGATAAATCAGAAAAGCAAGTTGAATTAATATCAGTAA
ATGCAGGTGCAAAGACAAACATACCAGATCTGGGTTTTAAAGCATCAGTT
AAAAAGGATAAGCGATCTCATAGTTCAAGTAGTTCCAGTAGTTCAAGTAG
TTCCAGTTCTAGTGATGCTGATAAGAAAAAGAAAAAACCAAAATCTTCCG
AGAAAGGAGAATTTAAGGCTAAAGCGACAATCGGCGGCAATGCTAAAATA
TCAGGGGAAGCCGGACATAACGTTAATATTAAGTCTGAAATTAAAAAACC
AAATATTGATCTTCACTTGAAAGATAAAGGTCCATTTAAAGACAAAGATC
AAGGAAACATTGACATCAGGAGTCCTAAGGTACAAACAGATATAAAATAT
GATATTGATGCGAAAAAAAGTTGTGAAATAGATATAGGTAATCGATCAAT
TGAAAGGAAAGTCGATAAGCCGAAAATAGATGTAAATGTAGACAAAAAGA
AACCCAAAGCTGATCTAGGATTAAAAAGTCACGGTGATCTTGATGTTGAT
GTTGATTTAGAGGAAAAGAAAAATAAACATGGCGGAATCGAGCTTGGATT
TAACATG
back to top

protein sequence of SMED30028069-orf-1

>SMED30028069-orf-1 ID=SMED30028069-orf-1|Name=SMED30028069-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=235bp
TQYKIWMSQEKKKGVFGNILGYFKPSITVNINKDEKEDKSEKQVELISVN
AGAKTNIPDLGFKASVKKDKRSHSSSSSSSSSSSSSSDADKKKKKPKSSE
KGEFKAKATIGGNAKISGEAGHNVNIKSEIKKPNIDLHLKDKGPFKDKDQ
GNIDIRSPKVQTDIKYDIDAKKSCEIDIGNRSIERKVDKPKIDVNVDKKK
PKADLGLKSHGDLDVDVDLEEKKNKHGGIELGFNM
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000035Category 3 cell
PLANA:0000054dorsal region of the epidermis
PLANA:0002032epidermal cell
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 58..156
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 87..104
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 122..156