SH3_10 domain-containing protein

Overview
NameSH3_10 domain-containing protein
Smed IDSMED30028063
Length (bp)2414
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SH3_10 domain-containing protein (SMED30028063) t-SNE clustered cells

Violin plots show distribution of expression levels for SH3_10 domain-containing protein (SMED30028063) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SH3_10 domain-containing protein (SMED30028063) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SH3_10 domain-containing protein (SMED30028063) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028063

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30028063SMESG000018362.1 SMESG000018320.1 SmedASXL_017008SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30028063SMESG000018362.1 SMESG000018320.1 SmedASXL_017009SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30028063SMESG000018362.1 SMESG000018320.1 dd_Smed_v4_16329_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30028063SMESG000018362.1 SMESG000018320.1 dd_Smed_v4_16329_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30028063SMESG000018362.1 SMESG000018320.1 dd_Smed_v6_16329_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
photoreceptor neuronSMED30028063SMESG000018362.1 SMESG000018320.1 SMED30028063smed_20140614PMID:22884275
Lapan et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SH3_10 domain-containing protein vs. TrEMBL
Match: A0A267GJE9 (SH3_10 domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig000782g2 PE=4 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 1.641e-15
Identity = 66/259 (25.48%), Postives = 122/259 (47.10%), Query Frame = 2
Query:  467 MENHSRQYYNWWQKIESLIAKAKSKYPVEFTIDKTDQIVPIKIPIN----KATIKTNENFCHTNTVHRNRITKISSTESRKHFPSVCNEIYPSDINVIEDVLVLRLDLLANWTSSLKEIDEVLMDYVLHILEYWSRLNIANSFDPDQLNGKNDIFECLAAIETLLNEYWKDSPQLENLQNKIGKLKKELESQKNHSE-------NQNKIINKPDXXXXXXXXXXFETFIFQKRAINILIGKYKELYKNWEYYKYQVDNA 1210
            M++       WWQ+I+SLI +++   P+   +   D   P K+ ++    + T+K N++    +T  R+  T  ++       PS+C  I   D  V+E  L +R  LLA+WT++L+E+   L+ + L +    +R    +    D L+G+ ++   L  +E LL  YW  +P+  ++  +I K +  L    +  +       + N +  +        S S     + QK  + +L+ KY+EL K WE YK  V+ +
Sbjct:  126 MQSLITAVLQWWQRIDSLIIQSRKVLPMAARLGPLDMKRPGKVLVDFETKELTLKANDDVFVVDTSDRDSWTVETTRGQSISLPSMCIAISGPDPEVMERSLSVRTFLLADWTATLREVGRALVSFTLSVFRL-ARTAEVDLPTEDSLDGR-ELEPLLGVMEKLLQTYWAKNPEFSDMAERISKARVSLAIYDDAQDIDDCTHIDINTLFLQLSPLAITGSNSEESGGVTQK-MLTLLMRKYQELLKYWEVYKVLVETS 381          
BLAST of SH3_10 domain-containing protein vs. TrEMBL
Match: A0A267DP62 (SH3_10 domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig013512g1 PE=4 SV=1)

HSP 1 Score: 91.2781 bits (225), Expect = 4.618e-15
Identity = 65/249 (26.10%), Postives = 119/249 (47.79%), Query Frame = 2
Query:  497 WWQKIESLIAKAKSKYPVEFTIDKTDQIVPIKIPIN----KATIKTNENFCHTNTVHRNRITKISSTESRKHFPSVCNEIYPSDINVIEDVLVLRLDLLANWTSSLKEIDEVLMDYVLHILEYWSRLNIANSFDPDQLNGKNDIFECLAAIETLLNEYWKDSPQLENLQNKIGKLKKELESQKNHSE-------NQNKIINKPDXXXXXXXXXXFETFIFQKRAINILIGKYKELYKNWEYYKYQVDNA 1210
            WWQ+I+SLI +++   P+   +   D   P K+ ++    + T+K N++    +T  R+  T  ++       PS+C  I   D  V+E  L +R  LLA+WT++L+E+   L+ + L +    +R    +    D L+G+ ++   L  +E LL  YW  +P+  ++  +I K +  L    +  +       + N +  +        S S     + QK  + +L+ KY+EL K WE YK  V+ +
Sbjct:  136 WWQRIDSLIIQSRKVLPMAARLGPLDMKRPGKVLVDFETKELTLKANDDVFVVDTSDRDSWTVETTRGQSISLPSMCIAISGPDPEVMERSLSVRTFLLADWTATLREVGRALVSFTLSVFRL-ARTAEVDLPTEDSLDGR-ELEPLLGVMEKLLQTYWAKNPEFSDMAERISKARVSLAIYDDAQDIDDCTHIDINTLFLQLSPLAITGSNSEESGGVTQK-MLTLLMRKYQELLKYWEVYKVLVETS 381          
BLAST of SH3_10 domain-containing protein vs. TrEMBL
Match: A0A1I8GRI7 (SH3_10 domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 91.2781 bits (225), Expect = 5.369e-15
Identity = 65/249 (26.10%), Postives = 119/249 (47.79%), Query Frame = 2
Query:  497 WWQKIESLIAKAKSKYPVEFTIDKTDQIVPIKIPIN----KATIKTNENFCHTNTVHRNRITKISSTESRKHFPSVCNEIYPSDINVIEDVLVLRLDLLANWTSSLKEIDEVLMDYVLHILEYWSRLNIANSFDPDQLNGKNDIFECLAAIETLLNEYWKDSPQLENLQNKIGKLKKELESQKNHSE-------NQNKIINKPDXXXXXXXXXXFETFIFQKRAINILIGKYKELYKNWEYYKYQVDNA 1210
            WWQ+I+SLI +++   P+   +   D   P K+ ++    + T+K N++    +T  R+  T  ++       PS+C  I   D  V+E  L +R  LLA+WT++L+E+   L+ + L +    +R    +    D L+G+ ++   L  +E LL  YW  +P+  ++  +I K +  L    +  +       + N +  +        S S     + QK  + +L+ KY+EL K WE YK  V+ +
Sbjct:  132 WWQRIDSLIIQSRKVLPMAARLGPLDMKRPGKVLVDFETKELTLKANDDVFVVDTSDRDSWTVETTRGQSISLPSMCIAISGPDPEVMERSLSVRTFLLADWTATLREVGRALVSFTLSVFRL-ARTAEVDLPTEDSLDGR-ELEPLLGVMEKLLQTYWAKNPEFSDMAERISKARVSLAIYDDAQDIDDCTHIDINTLFLQLSPLAITGSNSEESGGVTQK-MLTLLMRKYQELLKYWEVYKVLVETS 377          
BLAST of SH3_10 domain-containing protein vs. TrEMBL
Match: A0A1I8III3 (SH3_10 domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 6.218e-15
Identity = 65/249 (26.10%), Postives = 119/249 (47.79%), Query Frame = 2
Query:  497 WWQKIESLIAKAKSKYPVEFTIDKTDQIVPIKIPIN----KATIKTNENFCHTNTVHRNRITKISSTESRKHFPSVCNEIYPSDINVIEDVLVLRLDLLANWTSSLKEIDEVLMDYVLHILEYWSRLNIANSFDPDQLNGKNDIFECLAAIETLLNEYWKDSPQLENLQNKIGKLKKELESQKNHSE-------NQNKIINKPDXXXXXXXXXXFETFIFQKRAINILIGKYKELYKNWEYYKYQVDNA 1210
            WWQ+I+SLI +++   P+   +   D   P K+ ++    + T+K N++    +T  R+  T  ++       PS+C  I   D  V+E  L +R  LLA+WT++L+E+   L+ + L +    +R    +    D L+G+ ++   L  +E LL  YW  +P+  ++  +I K +  L    +  +       + N +  +        S S     + QK  + +L+ KY+EL K WE YK  V+ +
Sbjct:  237 WWQRIDSLIIQSRKVLPMAARLGPLDMKRPGKVLVDFETKELTLKANDDVFVVDTSDRDSWTVETTRGQSISLPSMCIAISGPDPEVMERSLSVRTFLLADWTATLREVGRALVSFTLSVFRL-ARTAEVDLPTEDSLDGR-ELEPLLGVMEKLLQTYWAKNPEFSDMAERISKARVSLAIYDDAQDIDDCTHIDINTLFLQLSPLAITGSNSEESGGVTQK-MLTLLMRKYQELLKYWEVYKVLVETS 482          
BLAST of SH3_10 domain-containing protein vs. TrEMBL
Match: A0A1I8IVI6 (SH3_10 domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 90.1225 bits (222), Expect = 1.025e-14
Identity = 63/245 (25.71%), Postives = 121/245 (49.39%), Query Frame = 2
Query:  497 WWQKIESLIAKAKSKYPVEFTIDKTDQIVPIKIPIN----KATIKTNENFCHTNTVHRNRITKISSTESRKHFPSVCNEIYPSDINVIEDVLVLRLDLLANWTSSLKEIDEVLMDYVLHILEYWSRLNIANSFDPDQLNGKNDIFECLAAIETLLNEYWKDSPQLENLQNKIGKLKKEL---ESQKNHSENQNKIINKPDXXXXXXXXXXFETFIFQKRAINILIGKYKELYKNWEYYKYQVDNA 1210
            WWQ+I+SLI +++   P+   +   D   P K+ ++    + T+K N++    +T  R+  T  ++       PS+C  I   D  V+E  L +R  LLA+WT++L+E+   L+ + L +    +R    +    D L+G+ ++   L  +E LL  YW  +P+  ++  +I K +  L   +  ++  +  +  IN      S  +++   +     + + +L+ KY+EL K WE YK  V+ +
Sbjct:  133 WWQRIDSLIIQSRKVLPMAARLGPLDMKRPGKVLVDFETKELTLKANDDVFVVDTSDRDSWTVETTRGQSISLPSMCIAISGPDPEVMERSLSVRTFLLADWTATLREVGRALVSFTLSVFRL-ARTAEVDLPTEDSLDGR-ELEPLLGVMEKLLQTYWAKNPEFSDMAERISKARVSLAIYDDAQDIDDCTHIDINTLFLQLSPLAITGSNSEESGGKMLTLLMRKYQELLKYWEVYKVLVETS 375          
BLAST of SH3_10 domain-containing protein vs. Planmine SMEST
Match: SMESG000018362.1 (SMESG000018362.1)

HSP 1 Score: 1239.56 bits (3206), Expect = 0.000e+0
Identity = 632/666 (94.89%), Postives = 634/666 (95.20%), Query Frame = 2
Query:  335 MENQEVKKTNFHNSNYQNEDIGSQNQFESYWAQFDAVGLEFAYMMENHSRQYYNWWQKIESLIAKAKSKYPVEFTIDKTDQIVPIKIPINKATIKTNENFCHTNTVHRNRITKISSTESRKHFPSVCNEIYPSDINVIEDVLVLRLDLLANWTSSLKEIDEVLMDYVLHILEYWSRLNIANSFDPDQLNGKNDIFECLAAIETLLNEYWKDSPQLENLQNKIGKLKKELESQKNHSENQNKIINKPDXXXXXXXXXXFETFIFQKRAINILIGKYKELYKNWEYYKYQVDNAVNISSLRSKINRSKIFPNDLSKTEQSLSYVSSETQSIWSKYIDSQIEKKQFIEKHCFDKYPLISVSPQKMELVSKKNVFDIKSGLQNSRIDITVPGEKQMRFYQNKPITIQSEKRITSTIDISHYFTRSLLPSQRNIDLISINKVNNPTVGNDLTTINYRDSSLQRSKSTYNRMSSQRIDFNRSKTQIHSVMGNYEKLNMNKIPDASKSFFVVLNLPCIEKISSILDKKQRKLLTPQQAKENGLCDETFLEILDTDSKIKYSFRAAILKGLVXXXXXXXXXXXXXXXXSEEHFTKEVYKIEEILDPDRNEWINVKVAINRHVLNQHSGLLKLNSTEYQHIAKVINSPNVRGRRIYHCNAKSLPPEMTIEISKVF 2332
            MENQEVKKTNFHNSNYQNEDIGSQNQF+SYWAQFDAVGLEFAYMMENHSRQYYNWWQKIESLIAKAKSKYPVEFTIDKTDQIVPIKIPINKATIKTNENFCHTNTVHRNRITKISSTESRKHFP VCNEIYPSDINVIEDVLVLRLDLLANWTSSLKEIDEVLMDYVLHILEYWSRLNIANSFDPDQLNGKNDIFECLAAIETLLNEYWKDSPQLENLQNKIGKLKKELESQKNHSENQNKIIN                           I   KELYKNWEYYKYQVDNAVNISSLRS+INRSKIFPNDLSKTEQSLSYVSSETQSIWSKYIDSQIEKKQFIEKHCFDKYPLISVSPQKMELVSKKNVFDIKSGLQNSRIDITVPGEKQMRFYQNKPITIQSEKRITSTIDISHYFTRSLLPSQRNIDLISINKVNNPTVGNDLTTINYRDSSLQRSKS YNRMSSQRIDFNRSKTQIHSVMGNYEKLNMNKIPDASKSFFVVLNLPCIEKISSILDKKQRKLLTPQQAKENGLCDETFLEILDTDSKIKYSFRAAILKGLVMLNLKDNNKKDKMSLLSEEHFTKEVYKIEEILDPDRNEWINVKVAINRHVLNQHSGLLKLNSTEYQHIAKVINSPNVRGRRIYHCNAKSLPPEMTIEISKVF
Sbjct:    1 MENQEVKKTNFHNSNYQNEDIGSQNQFDSYWAQFDAVGLEFAYMMENHSRQYYNWWQKIESLIAKAKSKYPVEFTIDKTDQIVPIKIPINKATIKTNENFCHTNTVHRNRITKISSTESRKHFPLVCNEIYPSDINVIEDVLVLRLDLLANWTSSLKEIDEVLMDYVLHILEYWSRLNIANSFDPDQLNGKNDIFECLAAIETLLNEYWKDSPQLENLQNKIGKLKKELESQKNHSENQNKIIN---------------------------IITIKELYKNWEYYKYQVDNAVNISSLRSRINRSKIFPNDLSKTEQSLSYVSSETQSIWSKYIDSQIEKKQFIEKHCFDKYPLISVSPQKMELVSKKNVFDIKSGLQNSRIDITVPGEKQMRFYQNKPITIQSEKRITSTIDISHYFTRSLLPSQRNIDLISINKVNNPTVGNDLTTINYRDSSLQRSKSAYNRMSSQRIDFNRSKTQIHSVMGNYEKLNMNKIPDASKSFFVVLNLPCIEKISSILDKKQRKLLTPQQAKENGLCDETFLEILDTDSKIKYSFRAAILKGLVMLNLKDNNKKDKMSLLSEEHFTKEVYKIEEILDPDRNEWINVKVAINRHVLNQHSGLLKLNSTEYQHIAKVINSPNVRGRRIYHCNAKSLPPEMTIEISKVF 639          
BLAST of SH3_10 domain-containing protein vs. Planmine SMEST
Match: SMESG000018362.1 (SMESG000018362.1)

HSP 1 Score: 1217.6 bits (3149), Expect = 0.000e+0
Identity = 633/666 (95.05%), Postives = 636/666 (95.50%), Query Frame = 2
Query:  335 MENQEVKKTNFHNSNYQNEDIGSQNQFESYWAQFDAVGLEFAYMMENHSRQYYNWWQKIESLIAKAKSKYPVEFTIDKTDQIVPIKIPINKATIKTNENFCHTNTVHRNRITKISSTESRKHFPSVCNEIYPSDINVIEDVLVLRLDLLANWTSSLKEIDEVLMDYVLHILEYWSRLNIANSFDPDQLNGKNDIFECLAAIETLLNEYWKDSPQLENLQNKIGKLKKELESQKNHSENQNKIINKPDXXXXXXXXXXFETFIFQKRAINILIGKYKELYKNWEYYKYQVDNAVNISSLRSKINRSKIFPNDLSKTEQSLSYVSSETQSIWSKYIDSQIEKKQFIEKHCFDKYPLISVSPQKMELVSKKNVFDIKSGLQNSRIDITVPGEKQMRFYQNKPITIQSEKRITSTIDISHYFTRSLLPSQRNIDLISINKVNNPTVGNDLTTINYRDSSLQRSKSTYNRMSSQRIDFNRSKTQIHSVMGNYEKLNMNKIPDASKSFFVVLNLPCIEKISSILDKKQRKLLTPQQAKENGLCDETFLEILDTDSKIKYSFRAAILKGLVXXXXXXXXXXXXXXXXSEEHFTKEVYKIEEILDPDRNEWINVKVAINRHVLNQHSGLLKLNSTEYQHIAKVINSPNVRGRRIYHCNAKSLPPEMTIEISKVF 2332
            MENQEVKKTNFHNSNYQNEDIGSQNQF+SYWAQFDAVGLEFAYMMENHSRQYYNWWQKIESLIAKAKSKYPVEFTIDKTDQIVPIKIPINKATIKTNENFCHTNTVHRNRITKISSTESRKHFP VCNEIYPSDINVIEDVLVLRLDLLANWTSSLKEIDEVLMDYVLHILEYWSRLNIANSFDPDQLNGKNDIFECLAAIETLLNEYWKDSPQLENLQNKIGKLKKELESQKNHSENQNKIIN                        NI+    KELYKNWEYYKYQVDNAVNISSLRS+INRSKIFPNDLSKTEQSLSYVSSETQSIWSKYIDSQIEKKQFIEKHCFDKYPLISVSPQKMELVSKKNVFDIKSGLQNSRIDITVPGEKQMRFYQNKPITIQSEKRITSTIDISHYFTRSLLPSQRNIDLISINKVNNPTVGNDLTTINYRDSSLQRSKS YNRMSSQRIDFNRSKTQIHSVMGNYEKLNMNKIPDASKSFFVVLNLPCIEKISSILDKKQRKLLTPQQAKENGLCDETFLEILDTDSKIKYSFRAAILKGLVMLNLKDNNKKDKMSLLSEEHFTKEVYKIEEILDPDRNEWINVKVAINRHVLNQHSGLLKLNSTEYQHIAKVINSPNVRGRRIYHCNAKSLPPEMTIEISKVF
Sbjct:    1 MENQEVKKTNFHNSNYQNEDIGSQNQFDSYWAQFDAVGLEFAYMMENHSRQYYNWWQKIESLIAKAKSKYPVEFTIDKTDQIVPIKIPINKATIKTNENFCHTNTVHRNRITKISSTESRKHFPLVCNEIYPSDINVIEDVLVLRLDLLANWTSSLKEIDEVLMDYVLHILEYWSRLNIANSFDPDQLNGKNDIFECLAAIETLLNEYWKDSPQLENLQNKIGKLKKELESQKNHSENQNKIINS-----------------------NIIT--IKELYKNWEYYKYQVDNAVNISSLRSRINRSKIFPNDLSKTEQSLSYVSSETQSIWSKYIDSQIEKKQFIEKHCFDKYPLISVSPQKMELVSKKNVFDIKSGLQNSRIDITVPGEKQMRFYQNKPITIQSEKRITSTIDISHYFTRSLLPSQRNIDLISINKVNNPTVGNDLTTINYRDSSLQRSKSAYNRMSSQRIDFNRSKTQIHSVMGNYEKLNMNKIPDASKSFFVVLNLPCIEKISSILDKKQRKLLTPQQAKENGLCDETFLEILDTDSKIKYSFRAAILKGLVMLNLKDNNKKDKMSLLSEEHFTKEVYKIEEILDPDRNEWINVKVAINRHVLNQHSGLLKLNSTEYQHIAKVINSPNVRGRRIYHCNAKSLPPEMTIEISKVF 641          
BLAST of SH3_10 domain-containing protein vs. Planmine SMEST
Match: SMESG000018362.1 (SMESG000018362.1)

HSP 1 Score: 1214.91 bits (3142), Expect = 0.000e+0
Identity = 635/666 (95.35%), Postives = 641/666 (96.25%), Query Frame = 2
Query:  335 MENQEVKKTNFHNSNYQNEDIGSQNQFESYWAQFDAVGLEFAYMMENHSRQYYNWWQKIESLIAKAKSKYPVEFTIDKTDQIVPIKIPINKATIKTNENFCHTNTVHRNRITKISSTESRKHFPSVCNEIYPSDINVIEDVLVLRLDLLANWTSSLKEIDEVLMDYVLHILEYWSRLNIANSFDPDQLNGKNDIFECLAAIETLLNEYWKDSPQLENLQNKIGKLKKELESQKNHSENQNKIINKPDXXXXXXXXXXFETFIFQKRAINILIGKYKELYKNWEYYKYQVDNAVNISSLRSKINRSKIFPNDLSKTEQSLSYVSSETQSIWSKYIDSQIEKKQFIEKHCFDKYPLISVSPQKMELVSKKNVFDIKSGLQNSRIDITVPGEKQMRFYQNKPITIQSEKRITSTIDISHYFTRSLLPSQRNIDLISINKVNNPTVGNDLTTINYRDSSLQRSKSTYNRMSSQRIDFNRSKTQIHSVMGNYEKLNMNKIPDASKSFFVVLNLPCIEKISSILDKKQRKLLTPQQAKENGLCDETFLEILDTDSKIKYSFRAAILKGLVXXXXXXXXXXXXXXXXSEEHFTKEVYKIEEILDPDRNEWINVKVAINRHVLNQHSGLLKLNSTEYQHIAKVINSPNVRGRRIYHCNAKSLPPEMTIEISKVF 2332
            MENQEVKKTNFHNSNYQNEDIGSQNQF+SYWAQFDAVGLEFAYMMENHSRQYYNWWQKIESLIAKAKSKYPVEFTIDKTDQIVPIKIPINKATIKTNENFCHTNTVHRNRITKISSTESRKHFP VCNEIYPSDINVIEDVLVLRLDLLANWTSSLKEIDEVLMDYVLHILEYWSRLNIANSFDPDQLNGKNDIFECLAAIETLLNEYWKDSPQLENLQNKIGKLKKELESQKNHSENQNK        NS S +  F     + + I ILI   +ELYKNWEYYKYQVDNAVNISSLRS+INRSKIFPNDLSKTEQSLSYVSSETQSIWSKYIDSQIEKKQFIEKHCFDKYPLISVSPQKMELVSKKNVFDIKSGLQNSRIDITVPGEKQMRFYQNKPITIQSEKRITSTIDISHYFTRSLLPSQRNIDLISINKVNNPTVGNDLTTINYRDSSLQRSKS YNRMSSQRIDFNRSKTQIHSVMGNYEKLNMNKIPDASKSFFVVLNLPCIEKISSILDKKQRKLLTPQQAKENGLCDETFLEILDTDSKIKYSFRAAILKGLVMLNLKDNNKKDKMSLLSEEHFTKEVYKIEEILDPDRNEWINVKVAINRHVLNQHSGLLKLNSTEYQHIAKVINSPNVRGRRIYHCNAKSLPPEMTIEISKVF
Sbjct:    1 MENQEVKKTNFHNSNYQNEDIGSQNQFDSYWAQFDAVGLEFAYMMENHSRQYYNWWQKIESLIAKAKSKYPVEFTIDKTDQIVPIKIPINKATIKTNENFCHTNTVHRNRITKISSTESRKHFPLVCNEIYPSDINVIEDVLVLRLDLLANWTSSLKEIDEVLMDYVLHILEYWSRLNIANSFDPDQLNGKNDIFECLAAIETLLNEYWKDSPQLENLQNKIGKLKKELESQKNHSENQNK------IINSNSIIIHFPNEPIKNQIIPILIHLCQELYKNWEYYKYQVDNAVNISSLRSRINRSKIFPNDLSKTEQSLSYVSSETQSIWSKYIDSQIEKKQFIEKHCFDKYPLISVSPQKMELVSKKNVFDIKSGLQNSRIDITVPGEKQMRFYQNKPITIQSEKRITSTIDISHYFTRSLLPSQRNIDLISINKVNNPTVGNDLTTINYRDSSLQRSKSAYNRMSSQRIDFNRSKTQIHSVMGNYEKLNMNKIPDASKSFFVVLNLPCIEKISSILDKKQRKLLTPQQAKENGLCDETFLEILDTDSKIKYSFRAAILKGLVMLNLKDNNKKDKMSLLSEEHFTKEVYKIEEILDPDRNEWINVKVAINRHVLNQHSGLLKLNSTEYQHIAKVINSPNVRGRRIYHCNAKSLPPEMTIEISKVF 660          
BLAST of SH3_10 domain-containing protein vs. Planmine SMEST
Match: SMESG000018320.1 (SMESG000018320.1)

HSP 1 Score: 1189.48 bits (3076), Expect = 0.000e+0
Identity = 623/656 (94.97%), Postives = 625/656 (95.27%), Query Frame = 2
Query:  365 FHNSNYQNEDIGSQNQFESYWAQFDAVGLEFAYMMENHSRQYYNWWQKIESLIAKAKSKYPVEFTIDKTDQIVPIKIPINKATIKTNENFCHTNTVHRNRITKISSTESRKHFPSVCNEIYPSDINVIEDVLVLRLDLLANWTSSLKEIDEVLMDYVLHILEYWSRLNIANSFDPDQLNGKNDIFECLAAIETLLNEYWKDSPQLENLQNKIGKLKKELESQKNHSENQNKIINKPDXXXXXXXXXXFETFIFQKRAINILIGKYKELYKNWEYYKYQVDNAVNISSLRSKINRSKIFPNDLSKTEQSLSYVSSETQSIWSKYIDSQIEKKQFIEKHCFDKYPLISVSPQKMELVSKKNVFDIKSGLQNSRIDITVPGEKQMRFYQNKPITIQSEKRITSTIDISHYFTRSLLPSQRNIDLISINKVNNPTVGNDLTTINYRDSSLQRSKSTYNRMSSQRIDFNRSKTQIHSVMGNYEKLNMNKIPDASKSFFVVLNLPCIEKISSILDKKQRKLLTPQQAKENGLCDETFLEILDTDSKIKYSFRAAILKGLVXXXXXXXXXXXXXXXXSEEHFTKEVYKIEEILDPDRNEWINVKVAINRHVLNQHSGLLKLNSTEYQHIAKVINSPNVRGRRIYHCNAKSLPPEMTIEISKVF 2332
             +NSNYQNEDIGSQNQFESYWAQFDAVGLEFAYMMENHSRQYYNWWQKIESLIAKAKSKYPVEFTIDKTDQIVPIKIPINKATIKTNENFCHTNTVHRNRITKISSTESRKHFPSVCNEIYPSDINVIEDVLVLRLDLLANWTSSLKEIDEVLMDYVLHILEYWSRLNIANSFDPDQLN KNDIFE LAAIETLLNEYWKDSPQLENLQNKIGKLKKELESQKNHSENQNKIIN                        NI+    KELYKNWEYYKYQVDNAVNISSLRSKINRSKIFPNDLSKTEQSLSYVSSETQSIWSKYIDSQIEKKQFIEKHCFDKYPLISVSPQKMELVSKKNVFDIKSGLQNSRIDITVPGEKQMRFYQNKPITIQSEKRITSTIDISHYFTRSLLPSQRNIDLISINKVNNPTVGNDLTTINYRDSSLQRSKSTYNRMSSQRIDFNRSKTQIHSVMGNYEKLNMNKIPDASKSFFVVLNLPCIEKISSILDKKQRKLLTPQQAKENGLCDETFLEILDTDSKIKYSFRAAILKGLVMLNLKDNNKKDKMSLLSEEHFTKEVYKIEEILDPDRNEWINVKVAINRHVLNQHSGLLKLNSTEYQHIAKVINSPNVRGRRIYHCNAKSLPPEMTIEISKVF
Sbjct:  335 LNNSNYQNEDIGSQNQFESYWAQFDAVGLEFAYMMENHSRQYYNWWQKIESLIAKAKSKYPVEFTIDKTDQIVPIKIPINKATIKTNENFCHTNTVHRNRITKISSTESRKHFPSVCNEIYPSDINVIEDVLVLRLDLLANWTSSLKEIDEVLMDYVLHILEYWSRLNIANSFDPDQLNSKNDIFESLAAIETLLNEYWKDSPQLENLQNKIGKLKKELESQKNHSENQNKIINS-----------------------NIIT--IKELYKNWEYYKYQVDNAVNISSLRSKINRSKIFPNDLSKTEQSLSYVSSETQSIWSKYIDSQIEKKQFIEKHCFDKYPLISVSPQKMELVSKKNVFDIKSGLQNSRIDITVPGEKQMRFYQNKPITIQSEKRITSTIDISHYFTRSLLPSQRNIDLISINKVNNPTVGNDLTTINYRDSSLQRSKSTYNRMSSQRIDFNRSKTQIHSVMGNYEKLNMNKIPDASKSFFVVLNLPCIEKISSILDKKQRKLLTPQQAKENGLCDETFLEILDTDSKIKYSFRAAILKGLVMLNLKDNNKKDKMSLLSEEHFTKEVYKIEEILDPDRNEWINVKVAINRHVLNQHSGLLKLNSTEYQHIAKVINSPNVRGRRIYHCNAKSLPPEMTIEISKVF 965          
BLAST of SH3_10 domain-containing protein vs. Planmine SMEST
Match: SMESG000018320.1 (SMESG000018320.1)

HSP 1 Score: 1172.92 bits (3033), Expect = 0.000e+0
Identity = 619/654 (94.65%), Postives = 620/654 (94.80%), Query Frame = 2
Query:  365 FHNSNYQNEDIGSQNQFESYWAQFDAVGLEFAYMMENHSRQYYNWWQKIESLIAKAKSKYPVEFTIDKTDQIVPIKIPINKATIKTNENFCHTNTVHRNRITKISSTESRKHFPSVCNEIYPSDINVIEDVLVLRLDLLANWTSSLKEIDEVLMDYVLHILEYWSRLNIANSFDPDQLNGKNDIFECLAAIETLLNEYWKDSPQLENLQNKIGKLKKELESQKNHSENQNKIINKPDXXXXXXXXXXFETFIFQKRAINILIGKYKELYKNWEYYKYQVDNAVNISSLRSKINRSKIFPNDLSKTEQSLSYVSSETQSIWSKYIDSQIEKKQFIEKHCFDKYPLISVSPQKMELVSKKNVFDIKSGLQNSRIDITVPGEKQMRFYQNKPITIQSEKRITSTIDISHYFTRSLLPSQRNIDLISINKVNNPTVGNDLTTINYRDSSLQRSKSTYNRMSSQRIDFNRSKTQIHSVMGNYEKLNMNKIPDASKSFFVVLNLPCIEKISSILDKKQRKLLTPQQAKENGLCDETFLEILDTDSKIKYSFRAAILKGLVXXXXXXXXXXXXXXXXSEEHFTKEVYKIEEILDPDRNEWINVKVAINRHVLNQHSGLLKLNSTEYQHIAKVINSPNVRGRRIYHCNAKSLPPEMTIEISK 2326
             +NSNYQNEDIGSQNQFESYWAQFDAVGLEFAYMMENHSRQYYNWWQKIESLIAKAKSKYPVEFTIDKTDQIVPIKIPINKATIKTNENFCHTNTVHRNRITKISSTESRKHFPSVCNEIYPSDINVIEDVLVLRLDLLANWTSSLKEIDEVLMDYVLHILEYWSRLNIANSFDPDQLN KNDIFE LAAIETLLNEYWKDSPQLENLQNKIGKLKKELESQKNHSENQNKIIN                               KELYKNWEYYKYQVDNAVNISSLRSKINRSKIFPNDLSKTEQSLSYVSSETQSIWSKYIDSQIEKKQFIEKHCFDKYPLISVSPQKMELVSKKNVFDIKSGLQNSRIDITVPGEKQMRFYQNKPITIQSEKRITSTIDISHYFTRSLLPSQRNIDLISINKVNNPTVGNDLTTINYRDSSLQRSKSTYNRMSSQRIDFNRSKTQIHSVMGNYEKLNMNKIPDASKSFFVVLNLPCIEKISSILDKKQRKLLTPQQAKENGLCDETFLEILDTDSKIKYSFRAAILKGLVMLNLKDNNKKDKMSLLSEEHFTKEVYKIEEILDPDRNEWINVKVAINRHVLNQHSGLLKLNSTEYQHIAKVINSPNVRGRRIYHCNAKSLPPEMTIEISK
Sbjct:  335 LNNSNYQNEDIGSQNQFESYWAQFDAVGLEFAYMMENHSRQYYNWWQKIESLIAKAKSKYPVEFTIDKTDQIVPIKIPINKATIKTNENFCHTNTVHRNRITKISSTESRKHFPSVCNEIYPSDINVIEDVLVLRLDLLANWTSSLKEIDEVLMDYVLHILEYWSRLNIANSFDPDQLNSKNDIFESLAAIETLLNEYWKDSPQLENLQNKIGKLKKELESQKNHSENQNKIINI---------------------------ITIKELYKNWEYYKYQVDNAVNISSLRSKINRSKIFPNDLSKTEQSLSYVSSETQSIWSKYIDSQIEKKQFIEKHCFDKYPLISVSPQKMELVSKKNVFDIKSGLQNSRIDITVPGEKQMRFYQNKPITIQSEKRITSTIDISHYFTRSLLPSQRNIDLISINKVNNPTVGNDLTTINYRDSSLQRSKSTYNRMSSQRIDFNRSKTQIHSVMGNYEKLNMNKIPDASKSFFVVLNLPCIEKISSILDKKQRKLLTPQQAKENGLCDETFLEILDTDSKIKYSFRAAILKGLVMLNLKDNNKKDKMSLLSEEHFTKEVYKIEEILDPDRNEWINVKVAINRHVLNQHSGLLKLNSTEYQHIAKVINSPNVRGRRIYHCNAKSLPPEMTIEISK 961          
The following BLAST results are available for this feature:
BLAST of SH3_10 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SH3_10 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SH3_10 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SH3_10 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SH3_10 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SH3_10 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SH3_10 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SH3_10 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267GJE91.641e-1525.48SH3_10 domain-containing protein OS=Macrostomum li... [more]
A0A267DP624.618e-1526.10SH3_10 domain-containing protein OS=Macrostomum li... [more]
A0A1I8GRI75.369e-1526.10SH3_10 domain-containing protein OS=Macrostomum li... [more]
A0A1I8III36.218e-1526.10SH3_10 domain-containing protein OS=Macrostomum li... [more]
A0A1I8IVI61.025e-1425.71SH3_10 domain-containing protein OS=Macrostomum li... [more]
back to top
BLAST of SH3_10 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SH3_10 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SH3_10 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SH3_10 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SH3_10 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SH3_10 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000018362.10.000e+094.89SMESG000018362.1[more]
SMESG000018362.10.000e+095.05SMESG000018362.1[more]
SMESG000018362.10.000e+095.35SMESG000018362.1[more]
SMESG000018320.10.000e+094.97SMESG000018320.1[more]
SMESG000018320.10.000e+094.65SMESG000018320.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028063 ID=SMED30028063|Name=SH3_10 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2414bp
ATTCTCGATGTGTTGACAGAATTCCAAAGTAAATACGGAAACAACAGAAT
ATTTGATGAATCGTGTTACTCAATCTAGAAAGATCAAACATCGACGTGTT
GATAATTGAGATTTGTGCATATTGCAGATCAAATAATATCAAATCCGATC
ATTAGTCAATTTATGCGCACAAATAAATATCAATGTGACAAATGAATCGT
CATATTAAAGCATATCATAATTTTTTATAAATGATATTTTGATGAATCGG
TAAAGTTTATAGAAACATTCCGACAAAAAAAAATTCAGAAATATATCTTT
ACTTCAGTATAGAAAAATTCATAAATATCAAGATATGGAAAATCAAGAAG
TAAAAAAAACAAATTTCCACAATTCGAACTACCAAAATGAAGACATTGGA
AGCCAAAATCAGTTTGAATCATATTGGGCGCAGTTTGATGCAGTTGGTCT
AGAATTTGCATATATGATGGAGAATCATTCCAGACAATACTACAATTGGT
GGCAGAAGATTGAATCGTTGATAGCAAAGGCGAAATCCAAATATCCTGTT
GAATTTACGATCGACAAAACAGATCAAATAGTTCCAATAAAAATACCAAT
AAATAAGGCAACCATTAAAACAAATGAAAATTTCTGTCACACAAACACTG
TTCATCGAAATCGAATCACCAAAATTAGTTCTACGGAATCTAGGAAACAT
TTCCCATCAGTTTGTAATGAAATATATCCATCGGATATAAATGTCATTGA
AGATGTTTTGGTTCTGCGATTGGATCTGCTGGCCAATTGGACAAGTTCCC
TGAAAGAAATCGACGAAGTTCTTATGGATTACGTTCTGCACATTCTTGAA
TATTGGAGCCGACTTAATATTGCTAACTCTTTTGACCCAGATCAACTAAA
TGGTAAAAATGATATATTTGAATGTCTGGCCGCAATTGAAACGTTACTAA
ATGAGTACTGGAAAGACTCACCACAGTTGGAAAATCTGCAGAATAAAATT
GGAAAGCTAAAAAAGGAATTGGAGTCTCAGAAAAATCATTCTGAAAATCA
GAACAAAATTATAAATAAACCAGATTATTCCAATTCTTATTCATCTTTGT
CAAGTTTTGAAACTTTCATTTTCCAAAAGAGAGCAATAAATATTCTTATT
GGCAAATACAAAGAACTCTATAAAAATTGGGAATATTACAAATACCAAGT
TGATAATGCAGTGAATATTTCATCTTTACGCAGCAAAATCAACCGTTCTA
AAATATTTCCAAATGATCTGTCAAAAACAGAGCAATCGTTGAGCTATGTA
TCGTCAGAAACTCAGTCTATTTGGTCGAAATATATTGATTCACAAATAGA
GAAAAAACAATTTATAGAAAAGCATTGTTTCGACAAATATCCCTTAATTA
GTGTTTCGCCTCAAAAAATGGAGCTGGTGTCAAAAAAAAATGTGTTTGAC
ATAAAAAGTGGTCTACAAAATAGCCGAATTGACATCACAGTTCCGGGCGA
GAAGCAAATGAGATTTTATCAAAATAAACCAATCACAATCCAGTCCGAGA
AGCGCATCACATCGACTATCGATATAAGCCATTATTTTACTAGATCTTTG
TTGCCAAGCCAAAGAAATATAGATTTAATTTCCATAAACAAAGTCAACAA
TCCGACTGTGGGAAATGACTTGACAACAATTAACTACCGAGACTCCTCAT
TACAAAGATCAAAATCAACATACAATCGAATGAGCTCTCAAAGGATTGAT
TTCAACAGATCAAAAACTCAAATTCATTCCGTGATGGGGAATTATGAGAA
ATTGAATATGAATAAAATACCAGATGCTTCTAAATCATTTTTCGTTGTTC
TAAATCTTCCATGTATTGAGAAAATATCAAGCATTCTGGATAAAAAACAA
CGAAAATTGTTAACTCCACAACAAGCAAAGGAAAACGGATTATGCGATGA
GACCTTCCTTGAAATATTAGATACTGACTCTAAAATAAAATACAGTTTTC
GAGCAGCGATCTTAAAAGGGTTGGTTATGTTGAATTTGAAAGACAATAAT
AAAAAAGATAAAATGTCTTTGTTGAGTGAAGAACACTTCACGAAAGAAGT
TTACAAAATCGAGGAAATTCTTGATCCTGACAGGAATGAATGGATCAATG
TAAAAGTTGCCATCAACCGGCATGTGCTCAACCAACATAGTGGGTTATTA
AAACTGAACTCAACTGAATATCAACATATTGCCAAAGTAATAAATTCACC
AAATGTTCGTGGCCGACGAATTTATCATTGCAATGCAAAGTCTCTACCTC
CTGAAATGACTATAGAAATCTCAAAAGTATTTTAAATGTTTCATGTATCA
GTAGTTCCGGTATTGTTTTCTAATATTTTAACATTTCACGGGTTTTCAAT
TTCTATTATCACCG
back to top

protein sequence of SMED30028063-orf-1

>SMED30028063-orf-1 ID=SMED30028063-orf-1|Name=SMED30028063-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=667bp
MENQEVKKTNFHNSNYQNEDIGSQNQFESYWAQFDAVGLEFAYMMENHSR
QYYNWWQKIESLIAKAKSKYPVEFTIDKTDQIVPIKIPINKATIKTNENF
CHTNTVHRNRITKISSTESRKHFPSVCNEIYPSDINVIEDVLVLRLDLLA
NWTSSLKEIDEVLMDYVLHILEYWSRLNIANSFDPDQLNGKNDIFECLAA
IETLLNEYWKDSPQLENLQNKIGKLKKELESQKNHSENQNKIINKPDYSN
SYSSLSSFETFIFQKRAINILIGKYKELYKNWEYYKYQVDNAVNISSLRS
KINRSKIFPNDLSKTEQSLSYVSSETQSIWSKYIDSQIEKKQFIEKHCFD
KYPLISVSPQKMELVSKKNVFDIKSGLQNSRIDITVPGEKQMRFYQNKPI
TIQSEKRITSTIDISHYFTRSLLPSQRNIDLISINKVNNPTVGNDLTTIN
YRDSSLQRSKSTYNRMSSQRIDFNRSKTQIHSVMGNYEKLNMNKIPDASK
SFFVVLNLPCIEKISSILDKKQRKLLTPQQAKENGLCDETFLEILDTDSK
IKYSFRAAILKGLVMLNLKDNNKKDKMSLLSEEHFTKEVYKIEEILDPDR
NEWINVKVAINRHVLNQHSGLLKLNSTEYQHIAKVINSPNVRGRRIYHCN
AKSLPPEMTIEISKVF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000017photoreceptor neuron
PLANA:0000020protonephridia
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR035915Plakin_repeat_sf
IPR001101Plectin_repeat
Vocabulary: cellular component
TermDefinition
GO:0005856cytoskeleton
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 215..235
IPR035915Plakin repeat superfamilySUPERFAMILYSSF75399Plakin repeatcoord: 515..629