Taurocyamine kinase

Overview
NameTaurocyamine kinase
Smed IDSMED30028062
Length (bp)2727
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Taurocyamine kinase (SMED30028062) t-SNE clustered cells

Violin plots show distribution of expression levels for Taurocyamine kinase (SMED30028062) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028062

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30028062SMESG000069023.1 SmedASXL_059060SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
reproductive organSMED30028062SMESG000069023.1 Contig39760newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30028062SMESG000069023.1 Contig39760uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
testisSMED30028062SMESG000069023.1 PL06020A1H08ncbi_smed_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30028062SMESG000069023.1 Contig5990_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
early male germ cellSMED30028062SMESG000069023.1 Contig5990_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism asexual adult cDNA to DNA expression microarray evidence
testis primordiumSMED30028062SMESG000069023.1 Contig5990_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
neoblastSMED30028062SMESG000069023.1 SMED_33754_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30028062SMESG000069023.1 SMED_33754_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Taurocyamine kinase vs. Ensembl Human
Match: CKB (creatine kinase B [Source:HGNC Symbol;Acc:HGNC:1991])

HSP 1 Score: 253.062 bits (645), Expect = 2.161e-75
Identity = 145/338 (42.90%), Postives = 196/338 (57.99%), Query Frame = 1
Query: 1276 KHLTKEIVDKFNTIRTKNGSTLAHCIRNSVYNN-----KAICPRTGDAKCYNCFSEYLDVVIRDYHKVKEPEVRH-PNVNFGDLENLGFQNLDPEGSFIMSTRIRVGRSIDGFNFPPTISKVDRLKLEKTIVDALSSLTGIHGGTYYPLTGMKENVQKQLIEDHFLF-KDDDPVLRDAGGYRDWPSGRGIFHNNEKTFLVWVCEEDHMRIISMQKGGDIAAVFTRLVQGIRQIETKLT-----FAHSKKYGYLTCCPSNLGTTMRASVHLKIPKLSSDKTKLNEVCDRFNLQARGFHGEHTESPEGIYDISNKRRLGLMEIEAATEMAKGVLEMIQIE 2253
            K LT E+  +     T +G TL   I+  V N        +    GD + Y  F +  D +I D H   +P   H  ++N  +L+  G  +LDP  ++++S+R+R GRSI GF  PP  S+ +R  +EK  V+ALSSL G   G YY L  M E  Q+QLI+DHFLF K   P+L  +G  RDWP  RGI+HN+ KTFLVWV EEDH+R+ISMQKGG++  VFTR   G+ QIET        F  +   GY+  CPSNLGT +RA VH+K+P L   + K +EV  R  LQ RG  G  T +  G++D+SN  RLG  E+E    +  GV  +I++E
Sbjct:   32 KVLTPELYAELRAKSTPSGFTLDDVIQTGVDNPGHPYIMTVGCVAGDEESYEVFKDLFDPIIEDRHGGYKPSDEHKTDLNPDNLQ--GGDDLDP--NYVLSSRVRTGRSIRGFCLPPHCSRGERRAIEKLAVEALSSLDGDLAGRYYALKSMTEAEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKTFLVWVNEEDHLRVISMQKGGNMKEVFTRFCTGLTQIETLFKSKDYEFMWNPHLGYILTCPSNLGTGLRAGVHIKLPNLGKHE-KFSEVLKRLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEVELVQMVVDGVKLLIEME 364          

HSP 2 Score: 243.432 bits (620), Expect = 7.569e-72
Identity = 137/364 (37.64%), Postives = 213/364 (58.52%), Query Frame = 1
Query:  112 KMEYKSLDEIYDMIYSNSENKSLAKKHLTKEIVAKYKNTKSKFGGTLAMCLNTNAYNP-----RALMCRTADPDCYDVFGDYFNELIKDYHKVATKEIEHPASDFGDIEHLPFKNMDVDKVYINSTRVRFGRTVKGFAFAPVISKEDRVTLSEQIANALKNLTGELQGNYYGLDNMTKEKQDELIKDHFLY-RDDDQVLRDAGGYRDWPSGRGIFLNNEKTFVVWINEEDHIRIISMEPGGDLPKVYRRLIAGLKGLE-----ENLEFERHKRFGFLTFCPTNLGTTMRASVHIKIPFLSMLPNFKQICEQYSLQARGTYGEHTENVGGVFDISNQRRLGLTEIQAAKEMYDGVNAIIAIEKML 1170
            K+ + + DE  D+   ++ N  +AK  LT E+ A+ +   +  G TL   + T   NP       + C   D + Y+VF D F+ +I+D H       EH  +D  + ++L   + D+D  Y+ S+RVR GR+++GF   P  S+ +R  + +    AL +L G+L G YY L +MT+ +Q +LI DHFL+ +    +L  +G  RDWP  RGI+ N+ KTF+VW+NEEDH+R+ISM+ GG++ +V+ R   GL  +E     ++ EF  +   G++  CP+NLGT +RA VHIK+P L     F ++ ++  LQ RGT G  T  VGGVFD+SN  RLG +E++  + + DGV  +I +E+ L
Sbjct:   11 KLRFPAEDEFPDL---SAHNNHMAKV-LTPELYAELRAKSTPSGFTLDDVIQTGVDNPGHPYIMTVGCVAGDEESYEVFKDLFDPIIEDRHGGYKPSDEH-KTDL-NPDNLQGGD-DLDPNYVLSSRVRTGRSIRGFCLPPHCSRGERRAIEKLAVEALSSLDGDLAGRYYALKSMTEAEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKTFLVWVNEEDHLRVISMQKGGNMKEVFTRFCTGLTQIETLFKSKDYEFMWNPHLGYILTCPSNLGTGLRAGVHIKLPNLGKHEKFSEVLKRLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEVELVQMVVDGVKLLIEMEQRL 367          
BLAST of Taurocyamine kinase vs. Ensembl Human
Match: CKMT1A (creatine kinase, mitochondrial 1A [Source:HGNC Symbol;Acc:HGNC:31736])

HSP 1 Score: 248.054 bits (632), Expect = 4.300e-73
Identity = 142/379 (37.47%), Postives = 212/379 (55.94%), Query Frame = 1
Query:   70 LFLRFPKIYSAYLRKMEYKSLDEIYDMIYSNSENKSLAKKHLTKEIVAKYKNTKSKFGGTLAMCLNTNAYNPRALMCRT-----ADPDCYDVFGDYFNELIKDYHK-VATKEIEHPASDFGDIEHLPFKNMDVDKVYINSTRVRFGRTVKGFAFAPVISKEDRVTLSEQIANALKNLTGELQGNYYGLDNMTKEKQDELIKDHFLY-RDDDQVLRDAGGYRDWPSGRGIFLNNEKTFVVWINEEDHIRIISMEPGGDLPKVYRRLIAGLKGLEE-----NLEFERHKRFGFLTFCPTNLGTTMRASVHIKIPFLSMLPNFKQICEQYSLQARGTYGEHTENVGGVFDISNQRRLGLTEIQAAKEMYDGVNAIIAIEKML 1170
              LR   + +A  R+  Y    E  D+      N  +A  HLT  + A+  +  +  G TL  C+ T   NP     +T      D + Y+VF D F+ +I++ H     + ++H      D++    ++   D+ Y+ S+RVR GR+++G +  P  ++ +R  +   + +AL  L G+L G YY L  MT+ +Q +LI DHFL+ +    +L  AG  RDWP  RGI+ NNEK+F++W+NEEDH R+ISME GG++ +V+ R   GLK +E        EF  ++R G++  CP+NLGT +RA VHIK+P LS    F +I E   LQ RGT G  T   GGVFDISN  RLG +E++  + + DGVN +I  E+ L
Sbjct:   30 FLLRPEPVRAASERRRLYPPSAEYPDL---RKHNNCMAS-HLTPAVYARLCDKTTPTGWTLDQCIQTGVDNPGHPFIKTVGMVAGDEETYEVFADLFDPVIQERHNGYDPRTMKHTT----DLDASKIRSGYFDERYVLSSRVRTGRSIRGLSLPPACTRAERREVERVVVDALSGLKGDLAGRYYRLSEMTEAEQQQLIDDHFLFDKPVSPLLTAAGMARDWPDARGIWHNNEKSFLIWVNEEDHTRVISMEKGGNMKRVFERFCRGLKEVERLIQERGWEFMWNERLGYILTCPSNLGTGLRAGVHIKLPLLSKDSRFPKILENLRLQKRGTGGVDTAATGGVFDISNLDRLGKSEVELVQLVIDGVNYLIDCERRL 400          

HSP 2 Score: 233.032 bits (593), Expect = 1.260e-67
Identity = 134/337 (39.76%), Postives = 198/337 (58.75%), Query Frame = 1
Query: 1279 HLTKEIVDKFNTIRTKNGSTLAHCIRNSVYNN-----KAICPRTGDAKCYNCFSEYLDVVIRDYHKVKEPE-VRHPNVNFGDLENLGFQNLDPEGSFIMSTRIRVGRSIDGFNFPPTISKVDRLKLEKTIVDALSSLTGIHGGTYYPLTGMKENVQKQLIEDHFLF-KDDDPVLRDAGGYRDWPSGRGIFHNNEKTFLVWVCEEDHMRIISMQKGGDIAAVFTRLVQGIRQIETKLT-----FAHSKKYGYLTCCPSNLGTTMRASVHLKIPKLSSDKTKLNEVCDRFNLQARGFHGEHTESPEGIYDISNKRRLGLMEIEAATEMAKGVLEMIQIE 2253
            HLT  +  +     T  G TL  CI+  V N      K +    GD + Y  F++  D VI++ H   +P  ++H      DL+    ++   +  +++S+R+R GRSI G + PP  ++ +R ++E+ +VDALS L G   G YY L+ M E  Q+QLI+DHFLF K   P+L  AG  RDWP  RGI+HNNEK+FL+WV EEDH R+ISM+KGG++  VF R  +G++++E  +      F  +++ GY+  CPSNLGT +RA VH+K+P LS D ++  ++ +   LQ RG  G  T +  G++DISN  RLG  E+E    +  GV  +I  E
Sbjct:   66 HLTPAVYARLCDKTTPTGWTLDQCIQTGVDNPGHPFIKTVGMVAGDEETYEVFADLFDPVIQERHNGYDPRTMKHTT----DLDASKIRSGYFDERYVLSSRVRTGRSIRGLSLPPACTRAERREVERVVVDALSGLKGDLAGRYYRLSEMTEAEQQQLIDDHFLFDKPVSPLLTAAGMARDWPDARGIWHNNEKSFLIWVNEEDHTRVISMEKGGNMKRVFERFCRGLKEVERLIQERGWEFMWNERLGYILTCPSNLGTGLRAGVHIKLPLLSKD-SRFPKILENLRLQKRGTGGVDTAATGGVFDISNLDRLGKSEVELVQLVIDGVNYLIDCE 397          
BLAST of Taurocyamine kinase vs. Ensembl Human
Match: CKMT1A (creatine kinase, mitochondrial 1A [Source:HGNC Symbol;Acc:HGNC:31736])

HSP 1 Score: 248.054 bits (632), Expect = 4.300e-73
Identity = 142/379 (37.47%), Postives = 212/379 (55.94%), Query Frame = 1
Query:   70 LFLRFPKIYSAYLRKMEYKSLDEIYDMIYSNSENKSLAKKHLTKEIVAKYKNTKSKFGGTLAMCLNTNAYNPRALMCRT-----ADPDCYDVFGDYFNELIKDYHK-VATKEIEHPASDFGDIEHLPFKNMDVDKVYINSTRVRFGRTVKGFAFAPVISKEDRVTLSEQIANALKNLTGELQGNYYGLDNMTKEKQDELIKDHFLY-RDDDQVLRDAGGYRDWPSGRGIFLNNEKTFVVWINEEDHIRIISMEPGGDLPKVYRRLIAGLKGLEE-----NLEFERHKRFGFLTFCPTNLGTTMRASVHIKIPFLSMLPNFKQICEQYSLQARGTYGEHTENVGGVFDISNQRRLGLTEIQAAKEMYDGVNAIIAIEKML 1170
              LR   + +A  R+  Y    E  D+      N  +A  HLT  + A+  +  +  G TL  C+ T   NP     +T      D + Y+VF D F+ +I++ H     + ++H      D++    ++   D+ Y+ S+RVR GR+++G +  P  ++ +R  +   + +AL  L G+L G YY L  MT+ +Q +LI DHFL+ +    +L  AG  RDWP  RGI+ NNEK+F++W+NEEDH R+ISME GG++ +V+ R   GLK +E        EF  ++R G++  CP+NLGT +RA VHIK+P LS    F +I E   LQ RGT G  T   GGVFDISN  RLG +E++  + + DGVN +I  E+ L
Sbjct:   30 FLLRPEPVRAASERRRLYPPSAEYPDL---RKHNNCMAS-HLTPAVYARLCDKTTPTGWTLDQCIQTGVDNPGHPFIKTVGMVAGDEETYEVFADLFDPVIQERHNGYDPRTMKHTT----DLDASKIRSGYFDERYVLSSRVRTGRSIRGLSLPPACTRAERREVERVVVDALSGLKGDLAGRYYRLSEMTEAEQQQLIDDHFLFDKPVSPLLTAAGMARDWPDARGIWHNNEKSFLIWVNEEDHTRVISMEKGGNMKRVFERFCRGLKEVERLIQERGWEFMWNERLGYILTCPSNLGTGLRAGVHIKLPLLSKDSRFPKILENLRLQKRGTGGVDTAATGGVFDISNLDRLGKSEVELVQLVIDGVNYLIDCERRL 400          

HSP 2 Score: 233.032 bits (593), Expect = 1.260e-67
Identity = 134/337 (39.76%), Postives = 198/337 (58.75%), Query Frame = 1
Query: 1279 HLTKEIVDKFNTIRTKNGSTLAHCIRNSVYNN-----KAICPRTGDAKCYNCFSEYLDVVIRDYHKVKEPE-VRHPNVNFGDLENLGFQNLDPEGSFIMSTRIRVGRSIDGFNFPPTISKVDRLKLEKTIVDALSSLTGIHGGTYYPLTGMKENVQKQLIEDHFLF-KDDDPVLRDAGGYRDWPSGRGIFHNNEKTFLVWVCEEDHMRIISMQKGGDIAAVFTRLVQGIRQIETKLT-----FAHSKKYGYLTCCPSNLGTTMRASVHLKIPKLSSDKTKLNEVCDRFNLQARGFHGEHTESPEGIYDISNKRRLGLMEIEAATEMAKGVLEMIQIE 2253
            HLT  +  +     T  G TL  CI+  V N      K +    GD + Y  F++  D VI++ H   +P  ++H      DL+    ++   +  +++S+R+R GRSI G + PP  ++ +R ++E+ +VDALS L G   G YY L+ M E  Q+QLI+DHFLF K   P+L  AG  RDWP  RGI+HNNEK+FL+WV EEDH R+ISM+KGG++  VF R  +G++++E  +      F  +++ GY+  CPSNLGT +RA VH+K+P LS D ++  ++ +   LQ RG  G  T +  G++DISN  RLG  E+E    +  GV  +I  E
Sbjct:   66 HLTPAVYARLCDKTTPTGWTLDQCIQTGVDNPGHPFIKTVGMVAGDEETYEVFADLFDPVIQERHNGYDPRTMKHTT----DLDASKIRSGYFDERYVLSSRVRTGRSIRGLSLPPACTRAERREVERVVVDALSGLKGDLAGRYYRLSEMTEAEQQQLIDDHFLFDKPVSPLLTAAGMARDWPDARGIWHNNEKSFLIWVNEEDHTRVISMEKGGNMKRVFERFCRGLKEVERLIQERGWEFMWNERLGYILTCPSNLGTGLRAGVHIKLPLLSKD-SRFPKILENLRLQKRGTGGVDTAATGGVFDISNLDRLGKSEVELVQLVIDGVNYLIDCE 397          
BLAST of Taurocyamine kinase vs. Ensembl Human
Match: CKMT1B (creatine kinase, mitochondrial 1B [Source:HGNC Symbol;Acc:HGNC:1995])

HSP 1 Score: 248.054 bits (632), Expect = 4.300e-73
Identity = 142/379 (37.47%), Postives = 212/379 (55.94%), Query Frame = 1
Query:   70 LFLRFPKIYSAYLRKMEYKSLDEIYDMIYSNSENKSLAKKHLTKEIVAKYKNTKSKFGGTLAMCLNTNAYNPRALMCRT-----ADPDCYDVFGDYFNELIKDYHK-VATKEIEHPASDFGDIEHLPFKNMDVDKVYINSTRVRFGRTVKGFAFAPVISKEDRVTLSEQIANALKNLTGELQGNYYGLDNMTKEKQDELIKDHFLY-RDDDQVLRDAGGYRDWPSGRGIFLNNEKTFVVWINEEDHIRIISMEPGGDLPKVYRRLIAGLKGLEE-----NLEFERHKRFGFLTFCPTNLGTTMRASVHIKIPFLSMLPNFKQICEQYSLQARGTYGEHTENVGGVFDISNQRRLGLTEIQAAKEMYDGVNAIIAIEKML 1170
              LR   + +A  R+  Y    E  D+      N  +A  HLT  + A+  +  +  G TL  C+ T   NP     +T      D + Y+VF D F+ +I++ H     + ++H      D++    ++   D+ Y+ S+RVR GR+++G +  P  ++ +R  +   + +AL  L G+L G YY L  MT+ +Q +LI DHFL+ +    +L  AG  RDWP  RGI+ NNEK+F++W+NEEDH R+ISME GG++ +V+ R   GLK +E        EF  ++R G++  CP+NLGT +RA VHIK+P LS    F +I E   LQ RGT G  T   GGVFDISN  RLG +E++  + + DGVN +I  E+ L
Sbjct:   30 FLLRPEPVRAASERRRLYPPSAEYPDL---RKHNNCMAS-HLTPAVYARLCDKTTPTGWTLDQCIQTGVDNPGHPFIKTVGMVAGDEETYEVFADLFDPVIQERHNGYDPRTMKHTT----DLDASKIRSGYFDERYVLSSRVRTGRSIRGLSLPPACTRAERREVERVVVDALSGLKGDLAGRYYRLSEMTEAEQQQLIDDHFLFDKPVSPLLTAAGMARDWPDARGIWHNNEKSFLIWVNEEDHTRVISMEKGGNMKRVFERFCRGLKEVERLIQERGWEFMWNERLGYILTCPSNLGTGLRAGVHIKLPLLSKDSRFPKILENLRLQKRGTGGVDTAATGGVFDISNLDRLGKSEVELVQLVIDGVNYLIDCERRL 400          

HSP 2 Score: 233.032 bits (593), Expect = 1.260e-67
Identity = 134/337 (39.76%), Postives = 198/337 (58.75%), Query Frame = 1
Query: 1279 HLTKEIVDKFNTIRTKNGSTLAHCIRNSVYNN-----KAICPRTGDAKCYNCFSEYLDVVIRDYHKVKEPE-VRHPNVNFGDLENLGFQNLDPEGSFIMSTRIRVGRSIDGFNFPPTISKVDRLKLEKTIVDALSSLTGIHGGTYYPLTGMKENVQKQLIEDHFLF-KDDDPVLRDAGGYRDWPSGRGIFHNNEKTFLVWVCEEDHMRIISMQKGGDIAAVFTRLVQGIRQIETKLT-----FAHSKKYGYLTCCPSNLGTTMRASVHLKIPKLSSDKTKLNEVCDRFNLQARGFHGEHTESPEGIYDISNKRRLGLMEIEAATEMAKGVLEMIQIE 2253
            HLT  +  +     T  G TL  CI+  V N      K +    GD + Y  F++  D VI++ H   +P  ++H      DL+    ++   +  +++S+R+R GRSI G + PP  ++ +R ++E+ +VDALS L G   G YY L+ M E  Q+QLI+DHFLF K   P+L  AG  RDWP  RGI+HNNEK+FL+WV EEDH R+ISM+KGG++  VF R  +G++++E  +      F  +++ GY+  CPSNLGT +RA VH+K+P LS D ++  ++ +   LQ RG  G  T +  G++DISN  RLG  E+E    +  GV  +I  E
Sbjct:   66 HLTPAVYARLCDKTTPTGWTLDQCIQTGVDNPGHPFIKTVGMVAGDEETYEVFADLFDPVIQERHNGYDPRTMKHTT----DLDASKIRSGYFDERYVLSSRVRTGRSIRGLSLPPACTRAERREVERVVVDALSGLKGDLAGRYYRLSEMTEAEQQQLIDDHFLFDKPVSPLLTAAGMARDWPDARGIWHNNEKSFLIWVNEEDHTRVISMEKGGNMKRVFERFCRGLKEVERLIQERGWEFMWNERLGYILTCPSNLGTGLRAGVHIKLPLLSKD-SRFPKILENLRLQKRGTGGVDTAATGGVFDISNLDRLGKSEVELVQLVIDGVNYLIDCE 397          
BLAST of Taurocyamine kinase vs. Ensembl Human
Match: CKMT1B (creatine kinase, mitochondrial 1B [Source:HGNC Symbol;Acc:HGNC:1995])

HSP 1 Score: 248.054 bits (632), Expect = 4.300e-73
Identity = 142/379 (37.47%), Postives = 212/379 (55.94%), Query Frame = 1
Query:   70 LFLRFPKIYSAYLRKMEYKSLDEIYDMIYSNSENKSLAKKHLTKEIVAKYKNTKSKFGGTLAMCLNTNAYNPRALMCRT-----ADPDCYDVFGDYFNELIKDYHK-VATKEIEHPASDFGDIEHLPFKNMDVDKVYINSTRVRFGRTVKGFAFAPVISKEDRVTLSEQIANALKNLTGELQGNYYGLDNMTKEKQDELIKDHFLY-RDDDQVLRDAGGYRDWPSGRGIFLNNEKTFVVWINEEDHIRIISMEPGGDLPKVYRRLIAGLKGLEE-----NLEFERHKRFGFLTFCPTNLGTTMRASVHIKIPFLSMLPNFKQICEQYSLQARGTYGEHTENVGGVFDISNQRRLGLTEIQAAKEMYDGVNAIIAIEKML 1170
              LR   + +A  R+  Y    E  D+      N  +A  HLT  + A+  +  +  G TL  C+ T   NP     +T      D + Y+VF D F+ +I++ H     + ++H      D++    ++   D+ Y+ S+RVR GR+++G +  P  ++ +R  +   + +AL  L G+L G YY L  MT+ +Q +LI DHFL+ +    +L  AG  RDWP  RGI+ NNEK+F++W+NEEDH R+ISME GG++ +V+ R   GLK +E        EF  ++R G++  CP+NLGT +RA VHIK+P LS    F +I E   LQ RGT G  T   GGVFDISN  RLG +E++  + + DGVN +I  E+ L
Sbjct:   30 FLLRPEPVRAASERRRLYPPSAEYPDL---RKHNNCMAS-HLTPAVYARLCDKTTPTGWTLDQCIQTGVDNPGHPFIKTVGMVAGDEETYEVFADLFDPVIQERHNGYDPRTMKHTT----DLDASKIRSGYFDERYVLSSRVRTGRSIRGLSLPPACTRAERREVERVVVDALSGLKGDLAGRYYRLSEMTEAEQQQLIDDHFLFDKPVSPLLTAAGMARDWPDARGIWHNNEKSFLIWVNEEDHTRVISMEKGGNMKRVFERFCRGLKEVERLIQERGWEFMWNERLGYILTCPSNLGTGLRAGVHIKLPLLSKDSRFPKILENLRLQKRGTGGVDTAATGGVFDISNLDRLGKSEVELVQLVIDGVNYLIDCERRL 400          

HSP 2 Score: 233.032 bits (593), Expect = 1.260e-67
Identity = 134/337 (39.76%), Postives = 198/337 (58.75%), Query Frame = 1
Query: 1279 HLTKEIVDKFNTIRTKNGSTLAHCIRNSVYNN-----KAICPRTGDAKCYNCFSEYLDVVIRDYHKVKEPE-VRHPNVNFGDLENLGFQNLDPEGSFIMSTRIRVGRSIDGFNFPPTISKVDRLKLEKTIVDALSSLTGIHGGTYYPLTGMKENVQKQLIEDHFLF-KDDDPVLRDAGGYRDWPSGRGIFHNNEKTFLVWVCEEDHMRIISMQKGGDIAAVFTRLVQGIRQIETKLT-----FAHSKKYGYLTCCPSNLGTTMRASVHLKIPKLSSDKTKLNEVCDRFNLQARGFHGEHTESPEGIYDISNKRRLGLMEIEAATEMAKGVLEMIQIE 2253
            HLT  +  +     T  G TL  CI+  V N      K +    GD + Y  F++  D VI++ H   +P  ++H      DL+    ++   +  +++S+R+R GRSI G + PP  ++ +R ++E+ +VDALS L G   G YY L+ M E  Q+QLI+DHFLF K   P+L  AG  RDWP  RGI+HNNEK+FL+WV EEDH R+ISM+KGG++  VF R  +G++++E  +      F  +++ GY+  CPSNLGT +RA VH+K+P LS D ++  ++ +   LQ RG  G  T +  G++DISN  RLG  E+E    +  GV  +I  E
Sbjct:   66 HLTPAVYARLCDKTTPTGWTLDQCIQTGVDNPGHPFIKTVGMVAGDEETYEVFADLFDPVIQERHNGYDPRTMKHTT----DLDASKIRSGYFDERYVLSSRVRTGRSIRGLSLPPACTRAERREVERVVVDALSGLKGDLAGRYYRLSEMTEAEQQQLIDDHFLFDKPVSPLLTAAGMARDWPDARGIWHNNEKSFLIWVNEEDHTRVISMEKGGNMKRVFERFCRGLKEVERLIQERGWEFMWNERLGYILTCPSNLGTGLRAGVHIKLPLLSKD-SRFPKILENLRLQKRGTGGVDTAATGGVFDISNLDRLGKSEVELVQLVIDGVNYLIDCE 397          
BLAST of Taurocyamine kinase vs. Ensembl Celegans
Match: W10C8.5 (pep chromosome:WBcel235:I:2853975:2855715:-1 gene:WBGene00021128.1 transcript:W10C8.5.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:W10C8.5)

HSP 1 Score: 332.798 bits (852), Expect = 1.744e-105
Identity = 163/332 (49.10%), Postives = 227/332 (68.37%), Query Frame = 1
Query: 1264 TITKKHLTKEIVDKFNTIRTKNGSTLAHCIRNSVYN-NKAICPRTGDAKCYNCFSEYLDVVIRDYHKVKEPEVRHPNVNFGDLENLGFQNLDPEGSFIMSTRIRVGRSIDGFNFPPTISKVDRLKLEKTIVDALSSLTGIH-GGTYYPLTGMKENVQKQLIEDHFLFKDDDPVLRDAGGYRDWPSGRGIFHNNEKTFLVWVCEEDHMRIISMQKGGDIAAVFTRLVQGIRQIETKLTFAHSKKYGYLTCCPSNLGTTMRASVHLKIPKLSSDKTKLNEVCDRFNLQARGFHGEHTESPEGIYDISNKRRLGLMEIEAATEMAKGVLEMIQIE 2253
            ++ KKHLTK++V+K  T RTK G+TL  CIR+ VYN +  +     DA+ Y  F+   D +I DYH    P+ + P V+ G+ +   F  LDP+G +I STRIR GRS+ G+ F P +++ + L++E  +  A S  +     G YYPL GM ++ QKQLI DHFLFK+ D  L+ A     WP GRGIFHNN+KTFL+WV EEDHMRIISMQ+G D+ AV  RL++G+R IE ++ F+   + G+LT CP+NLG+T+RASVH+ +PKL++ K  + E+C++ NLQ RG HGEH+ES  G+YDISNK RLGL E +A  +M  GV ++I++E
Sbjct:   66 SLLKKHLTKDVVEKLKTKRTKLGATLYDCIRSGVYNLDAGVGVYAPDAEAYTLFAPLFDKIIEDYHGF-SPKQKQPPVDLGEGKTKEFPPLDPKGKYIKSTRIRCGRSLKGYPFNPCLTQDNYLEMEGKVKKAFSEYSDKELKGKYYPLDGMGKDTQKQLIADHFLFKEGDRHLQYANACNFWPKGRGIFHNNDKTFLIWVNEEDHMRIISMQEGSDVGAVLDRLIKGVRGIEKQVPFSRDDRLGWLTFCPTNLGSTVRASVHIALPKLAARKDFI-EICEKLNLQVRGIHGEHSESVGGVYDISNKARLGLSEYQAVKQMYDGVKKLIEME 395          

HSP 2 Score: 322.783 bits (826), Expect = 1.088e-101
Identity = 158/351 (45.01%), Postives = 235/351 (66.95%), Query Frame = 1
Query:  124 KSLDEIYDMIYS--NSENKSLAKKHLTKEIVAKYKNTKSKFGGTLAMCLNTNAYNPRA-LMCRTADPDCYDVFGDYFNELIKDYHKVATKEIEHPASDFGDIEHLPFKNMDVDKVYINSTRVRFGRTVKGFAFAPVISKEDRVTLSEQIANALKNLTG-ELQGNYYGLDNMTKEKQDELIKDHFLYRDDDQVLRDAGGYRDWPSGRGIFLNNEKTFVVWINEEDHIRIISMEPGGDLPKVYRRLIAGLKGLEENLEFERHKRFGFLTFCPTNLGTTMRASVHIKIPFLSMLPNFKQICEQYSLQARGTYGEHTENVGGVFDISNQRRLGLTEIQAAKEMYDGVNAIIAIEK 1164
            K ++E Y  +     ++ KSL KKHLTK++V K K  ++K G TL  C+ +  YN  A +     D + Y +F   F+++I+DYH  + K+ + P  D G+ +   F  +D    YI STR+R GR++KG+ F P +++++ + +  ++  A    +  EL+G YY LD M K+ Q +LI DHFL+++ D+ L+ A     WP GRGIF NN+KTF++W+NEEDH+RIISM+ G D+  V  RLI G++G+E+ + F R  R G+LTFCPTNLG+T+RASVHI +P L+   +F +ICE+ +LQ RG +GEH+E+VGGV+DISN+ RLGL+E QA K+MYDGV  +I +E+
Sbjct:   47 KKIEEAYAKLNGPEGAKCKSLLKKHLTKDVVEKLKTKRTKLGATLYDCIRSGVYNLDAGVGVYAPDAEAYTLFAPLFDKIIEDYHGFSPKQ-KQPPVDLGEGKTKEFPPLDPKGKYIKSTRIRCGRSLKGYPFNPCLTQDNYLEMEGKVKKAFSEYSDKELKGKYYPLDGMGKDTQKQLIADHFLFKEGDRHLQYANACNFWPKGRGIFHNNDKTFLIWVNEEDHMRIISMQEGSDVGAVLDRLIKGVRGIEKQVPFSRDDRLGWLTFCPTNLGSTVRASVHIALPKLAARKDFIEICEKLNLQVRGIHGEHSESVGGVYDISNKARLGLSEYQAVKQMYDGVKKLIEMEE 396          
BLAST of Taurocyamine kinase vs. Ensembl Celegans
Match: W10C8.5 (pep chromosome:WBcel235:I:2853975:2855732:-1 gene:WBGene00021128.1 transcript:W10C8.5.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:W10C8.5)

HSP 1 Score: 332.798 bits (852), Expect = 1.744e-105
Identity = 163/332 (49.10%), Postives = 227/332 (68.37%), Query Frame = 1
Query: 1264 TITKKHLTKEIVDKFNTIRTKNGSTLAHCIRNSVYN-NKAICPRTGDAKCYNCFSEYLDVVIRDYHKVKEPEVRHPNVNFGDLENLGFQNLDPEGSFIMSTRIRVGRSIDGFNFPPTISKVDRLKLEKTIVDALSSLTGIH-GGTYYPLTGMKENVQKQLIEDHFLFKDDDPVLRDAGGYRDWPSGRGIFHNNEKTFLVWVCEEDHMRIISMQKGGDIAAVFTRLVQGIRQIETKLTFAHSKKYGYLTCCPSNLGTTMRASVHLKIPKLSSDKTKLNEVCDRFNLQARGFHGEHTESPEGIYDISNKRRLGLMEIEAATEMAKGVLEMIQIE 2253
            ++ KKHLTK++V+K  T RTK G+TL  CIR+ VYN +  +     DA+ Y  F+   D +I DYH    P+ + P V+ G+ +   F  LDP+G +I STRIR GRS+ G+ F P +++ + L++E  +  A S  +     G YYPL GM ++ QKQLI DHFLFK+ D  L+ A     WP GRGIFHNN+KTFL+WV EEDHMRIISMQ+G D+ AV  RL++G+R IE ++ F+   + G+LT CP+NLG+T+RASVH+ +PKL++ K  + E+C++ NLQ RG HGEH+ES  G+YDISNK RLGL E +A  +M  GV ++I++E
Sbjct:   66 SLLKKHLTKDVVEKLKTKRTKLGATLYDCIRSGVYNLDAGVGVYAPDAEAYTLFAPLFDKIIEDYHGF-SPKQKQPPVDLGEGKTKEFPPLDPKGKYIKSTRIRCGRSLKGYPFNPCLTQDNYLEMEGKVKKAFSEYSDKELKGKYYPLDGMGKDTQKQLIADHFLFKEGDRHLQYANACNFWPKGRGIFHNNDKTFLIWVNEEDHMRIISMQEGSDVGAVLDRLIKGVRGIEKQVPFSRDDRLGWLTFCPTNLGSTVRASVHIALPKLAARKDFI-EICEKLNLQVRGIHGEHSESVGGVYDISNKARLGLSEYQAVKQMYDGVKKLIEME 395          

HSP 2 Score: 322.783 bits (826), Expect = 1.088e-101
Identity = 158/351 (45.01%), Postives = 235/351 (66.95%), Query Frame = 1
Query:  124 KSLDEIYDMIYS--NSENKSLAKKHLTKEIVAKYKNTKSKFGGTLAMCLNTNAYNPRA-LMCRTADPDCYDVFGDYFNELIKDYHKVATKEIEHPASDFGDIEHLPFKNMDVDKVYINSTRVRFGRTVKGFAFAPVISKEDRVTLSEQIANALKNLTG-ELQGNYYGLDNMTKEKQDELIKDHFLYRDDDQVLRDAGGYRDWPSGRGIFLNNEKTFVVWINEEDHIRIISMEPGGDLPKVYRRLIAGLKGLEENLEFERHKRFGFLTFCPTNLGTTMRASVHIKIPFLSMLPNFKQICEQYSLQARGTYGEHTENVGGVFDISNQRRLGLTEIQAAKEMYDGVNAIIAIEK 1164
            K ++E Y  +     ++ KSL KKHLTK++V K K  ++K G TL  C+ +  YN  A +     D + Y +F   F+++I+DYH  + K+ + P  D G+ +   F  +D    YI STR+R GR++KG+ F P +++++ + +  ++  A    +  EL+G YY LD M K+ Q +LI DHFL+++ D+ L+ A     WP GRGIF NN+KTF++W+NEEDH+RIISM+ G D+  V  RLI G++G+E+ + F R  R G+LTFCPTNLG+T+RASVHI +P L+   +F +ICE+ +LQ RG +GEH+E+VGGV+DISN+ RLGL+E QA K+MYDGV  +I +E+
Sbjct:   47 KKIEEAYAKLNGPEGAKCKSLLKKHLTKDVVEKLKTKRTKLGATLYDCIRSGVYNLDAGVGVYAPDAEAYTLFAPLFDKIIEDYHGFSPKQ-KQPPVDLGEGKTKEFPPLDPKGKYIKSTRIRCGRSLKGYPFNPCLTQDNYLEMEGKVKKAFSEYSDKELKGKYYPLDGMGKDTQKQLIADHFLFKEGDRHLQYANACNFWPKGRGIFHNNDKTFLIWVNEEDHMRIISMQEGSDVGAVLDRLIKGVRGIEKQVPFSRDDRLGWLTFCPTNLGSTVRASVHIALPKLAARKDFIEICEKLNLQVRGIHGEHSESVGGVYDISNKARLGLSEYQAVKQMYDGVKKLIEMEE 396          
BLAST of Taurocyamine kinase vs. Ensembl Celegans
Match: F32B5.1 (pep chromosome:WBcel235:I:2700420:2702158:1 gene:WBGene00017975.1 transcript:F32B5.1.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F32B5.1)

HSP 1 Score: 333.183 bits (853), Expect = 3.328e-105
Identity = 163/332 (49.10%), Postives = 227/332 (68.37%), Query Frame = 1
Query: 1264 TITKKHLTKEIVDKFNTIRTKNGSTLAHCIRNSVYN-NKAICPRTGDAKCYNCFSEYLDVVIRDYHKVKEPEVRHPNVNFGDLENLGFQNLDPEGSFIMSTRIRVGRSIDGFNFPPTISKVDRLKLEKTIVDALSSLTGIH-GGTYYPLTGMKENVQKQLIEDHFLFKDDDPVLRDAGGYRDWPSGRGIFHNNEKTFLVWVCEEDHMRIISMQKGGDIAAVFTRLVQGIRQIETKLTFAHSKKYGYLTCCPSNLGTTMRASVHLKIPKLSSDKTKLNEVCDRFNLQARGFHGEHTESPEGIYDISNKRRLGLMEIEAATEMAKGVLEMIQIE 2253
            ++ KKHLTKE+V+K  T RTK G+TL  CIR+ VYN +  +     DA+ Y  F+   D +I DYH    P+ + P V+ G+ +   F  LDP+G +I STRIR GRS+ G+ F P +++ + L++E  +  A S  +     G YYPL GM ++ QKQLI DHFLFK+ D  L+ A     WP GRGIFHNN+KTFL+WV EEDHMRIISMQ+G D+ AV  RL++G+R IE ++ F+   + G+LT CP+NLG+T+RASVH+ +PKL++ K  + E+C++ NLQ RG HGEH++S  G+YDISNK RLGL E +A  +M  GV ++I++E
Sbjct:   94 SLLKKHLTKEVVEKLKTKRTKVGATLYDCIRSGVYNLDAGVGVYAPDAEAYTLFAPLFDKIIEDYHGF-SPKQKQPPVDLGEGKTKEFPPLDPKGKYIKSTRIRCGRSLKGYPFNPCLTQDNYLEMEGKVKKAFSEYSDKELKGKYYPLDGMGKDTQKQLIADHFLFKEGDRHLQYANACNFWPKGRGIFHNNDKTFLIWVNEEDHMRIISMQEGSDVGAVLDRLIKGVRGIEKQVPFSRDDRLGWLTFCPTNLGSTVRASVHIALPKLAARKDFI-EICEKLNLQVRGIHGEHSDSVGGVYDISNKARLGLSEYQAVKQMYDGVKKLIEME 423          

HSP 2 Score: 322.398 bits (825), Expect = 4.294e-101
Identity = 158/351 (45.01%), Postives = 235/351 (66.95%), Query Frame = 1
Query:  124 KSLDEIYDMIYS--NSENKSLAKKHLTKEIVAKYKNTKSKFGGTLAMCLNTNAYNPRA-LMCRTADPDCYDVFGDYFNELIKDYHKVATKEIEHPASDFGDIEHLPFKNMDVDKVYINSTRVRFGRTVKGFAFAPVISKEDRVTLSEQIANALKNLTG-ELQGNYYGLDNMTKEKQDELIKDHFLYRDDDQVLRDAGGYRDWPSGRGIFLNNEKTFVVWINEEDHIRIISMEPGGDLPKVYRRLIAGLKGLEENLEFERHKRFGFLTFCPTNLGTTMRASVHIKIPFLSMLPNFKQICEQYSLQARGTYGEHTENVGGVFDISNQRRLGLTEIQAAKEMYDGVNAIIAIEK 1164
            K ++E Y  +     ++ KSL KKHLTKE+V K K  ++K G TL  C+ +  YN  A +     D + Y +F   F+++I+DYH  + K+ + P  D G+ +   F  +D    YI STR+R GR++KG+ F P +++++ + +  ++  A    +  EL+G YY LD M K+ Q +LI DHFL+++ D+ L+ A     WP GRGIF NN+KTF++W+NEEDH+RIISM+ G D+  V  RLI G++G+E+ + F R  R G+LTFCPTNLG+T+RASVHI +P L+   +F +ICE+ +LQ RG +GEH+++VGGV+DISN+ RLGL+E QA K+MYDGV  +I +E+
Sbjct:   75 KKIEEAYAKLNGPEGAKCKSLLKKHLTKEVVEKLKTKRTKVGATLYDCIRSGVYNLDAGVGVYAPDAEAYTLFAPLFDKIIEDYHGFSPKQ-KQPPVDLGEGKTKEFPPLDPKGKYIKSTRIRCGRSLKGYPFNPCLTQDNYLEMEGKVKKAFSEYSDKELKGKYYPLDGMGKDTQKQLIADHFLFKEGDRHLQYANACNFWPKGRGIFHNNDKTFLIWVNEEDHMRIISMQEGSDVGAVLDRLIKGVRGIEKQVPFSRDDRLGWLTFCPTNLGSTVRASVHIALPKLAARKDFIEICEKLNLQVRGIHGEHSDSVGGVYDISNKARLGLSEYQAVKQMYDGVKKLIEMEE 424          
BLAST of Taurocyamine kinase vs. Ensembl Celegans
Match: F46H5.3 (Probable arginine kinase F46H5.3 [Source:UniProtKB/Swiss-Prot;Acc:Q10454])

HSP 1 Score: 327.791 bits (839), Expect = 3.794e-104
Identity = 158/347 (45.53%), Postives = 232/347 (66.86%), Query Frame = 1
Query:  130 LDEIYDMIYSNSENKSLAKKHLTKEIVAKYKNTKSKFGGTLAMCLNTNAYN-PRALMCRTADPDCYDVFGDYFNELIKDYHKVATKEIEHPASDFGDIEHLPFKNMDVDKVYINSTRVRFGRTVKGFAFAPVISKEDRVTLSEQIANALKNLTG-ELQGNYYGLDNMTKEKQDELIKDHFLYRDDDQVLRDAGGYRDWPSGRGIFLNNEKTFVVWINEEDHIRIISMEPGGDLPKVYRRLIAGLKGLEENLEFERHKRFGFLTFCPTNLGTTMRASVHIKIPFLSMLPNFKQICEQYSLQARGTYGEHTENVGGVFDISNQRRLGLTEIQAAKEMYDGVNAIIAIEK 1164
            ++E Y  + +  E  SL KK+LTKE+V + K+ K+K G  L   + +   N    +     D + Y +F   F+ LI+DYH     + + P +D G+ +     ++D +  +INSTR+R GR+++G+ F P +S+ + + +  ++     N+T  EL G Y+ LD MTKE QD+LIKDHFL+++ D+ L+ A   R WP GRGIF NN+KTF++W NEEDH+RIISM+ GG++ +V  RLI G+K +E+   F R  R G+LTFCP+NLGTT+RASVHI++P +S  P+FK IC+   LQ RG +GEH+E+ GGV+DISN+ RLGLTE +A K+MYDG+  +IA+EK
Sbjct:   11 IEEGYAKLQAAPECHSLLKKYLTKEVVDQLKDKKTKLGANLLDVIQSGVANLDSGVGVYAPDAEAYTLFKPLFDPLIQDYHNGFAPDAKQPNTDLGEGKTSALVDLDPEGKFINSTRIRCGRSLQGYPFNPCLSEANYLEMESKVKAIFDNITDPELAGKYFPLDGMTKEIQDQLIKDHFLFKEGDRFLQAANACRYWPKGRGIFHNNQKTFLIWCNEEDHLRIISMQEGGNVGQVLERLIKGVKTIEKQAPFSRDDRLGWLTFCPSNLGTTVRASVHIRLPKISAKPDFKSICDGLKLQIRGIHGEHSESEGGVYDISNKARLGLTEFEAVKQMYDGIAHLIALEK 357          

HSP 2 Score: 324.324 bits (830), Expect = 8.497e-103
Identity = 155/336 (46.13%), Postives = 218/336 (64.88%), Query Frame = 1
Query: 1252 PSNDTITKKHLTKEIVDKFNTIRTKNGSTLAHCIRNSVYN-NKAICPRTGDAKCYNCFSEYLDVVIRDYHKVKEPEVRHPNVNFGDLENLGFQNLDPEGSFIMSTRIRVGRSIDGFNFPPTISKVDRLKLEKTIVDALSSLTGIH-GGTYYPLTGMKENVQKQLIEDHFLFKDDDPVLRDAGGYRDWPSGRGIFHNNEKTFLVWVCEEDHMRIISMQKGGDIAAVFTRLVQGIRQIETKLTFAHSKKYGYLTCCPSNLGTTMRASVHLKIPKLSSDKTKLNEVCDRFNLQARGFHGEHTESPEGIYDISNKRRLGLMEIEAATEMAKGVLEMIQIE 2253
            P   ++ KK+LTKE+VD+    +TK G+ L   I++ V N +  +     DA+ Y  F    D +I+DYH    P+ + PN + G+ +     +LDPEG FI STRIR GRS+ G+ F P +S+ + L++E  +     ++T     G Y+PL GM + +Q QLI+DHFLFK+ D  L+ A   R WP GRGIFHNN+KTFL+W  EEDH+RIISMQ+GG++  V  RL++G++ IE +  F+   + G+LT CPSNLGTT+RASVH+++PK+S+ K     +CD   LQ RG HGEH+ES  G+YDISNK RLGL E EA  +M  G+  +I +E
Sbjct:   22 PECHSLLKKYLTKEVVDQLKDKKTKLGANLLDVIQSGVANLDSGVGVYAPDAEAYTLFKPLFDPLIQDYHNGFAPDAKQPNTDLGEGKTSALVDLDPEGKFINSTRIRCGRSLQGYPFNPCLSEANYLEMESKVKAIFDNITDPELAGKYFPLDGMTKEIQDQLIKDHFLFKEGDRFLQAANACRYWPKGRGIFHNNQKTFLIWCNEEDHLRIISMQEGGNVGQVLERLIKGVKTIEKQAPFSRDDRLGWLTFCPSNLGTTVRASVHIRLPKISA-KPDFKSICDGLKLQIRGIHGEHSESEGGVYDISNKARLGLTEFEAVKQMYDGIAHLIALE 356          
BLAST of Taurocyamine kinase vs. Ensembl Celegans
Match: F46H5.3 (Probable arginine kinase F46H5.3 [Source:UniProtKB/Swiss-Prot;Acc:Q10454])

HSP 1 Score: 327.791 bits (839), Expect = 3.794e-104
Identity = 158/347 (45.53%), Postives = 232/347 (66.86%), Query Frame = 1
Query:  130 LDEIYDMIYSNSENKSLAKKHLTKEIVAKYKNTKSKFGGTLAMCLNTNAYN-PRALMCRTADPDCYDVFGDYFNELIKDYHKVATKEIEHPASDFGDIEHLPFKNMDVDKVYINSTRVRFGRTVKGFAFAPVISKEDRVTLSEQIANALKNLTG-ELQGNYYGLDNMTKEKQDELIKDHFLYRDDDQVLRDAGGYRDWPSGRGIFLNNEKTFVVWINEEDHIRIISMEPGGDLPKVYRRLIAGLKGLEENLEFERHKRFGFLTFCPTNLGTTMRASVHIKIPFLSMLPNFKQICEQYSLQARGTYGEHTENVGGVFDISNQRRLGLTEIQAAKEMYDGVNAIIAIEK 1164
            ++E Y  + +  E  SL KK+LTKE+V + K+ K+K G  L   + +   N    +     D + Y +F   F+ LI+DYH     + + P +D G+ +     ++D +  +INSTR+R GR+++G+ F P +S+ + + +  ++     N+T  EL G Y+ LD MTKE QD+LIKDHFL+++ D+ L+ A   R WP GRGIF NN+KTF++W NEEDH+RIISM+ GG++ +V  RLI G+K +E+   F R  R G+LTFCP+NLGTT+RASVHI++P +S  P+FK IC+   LQ RG +GEH+E+ GGV+DISN+ RLGLTE +A K+MYDG+  +IA+EK
Sbjct:   11 IEEGYAKLQAAPECHSLLKKYLTKEVVDQLKDKKTKLGANLLDVIQSGVANLDSGVGVYAPDAEAYTLFKPLFDPLIQDYHNGFAPDAKQPNTDLGEGKTSALVDLDPEGKFINSTRIRCGRSLQGYPFNPCLSEANYLEMESKVKAIFDNITDPELAGKYFPLDGMTKEIQDQLIKDHFLFKEGDRFLQAANACRYWPKGRGIFHNNQKTFLIWCNEEDHLRIISMQEGGNVGQVLERLIKGVKTIEKQAPFSRDDRLGWLTFCPSNLGTTVRASVHIRLPKISAKPDFKSICDGLKLQIRGIHGEHSESEGGVYDISNKARLGLTEFEAVKQMYDGIAHLIALEK 357          

HSP 2 Score: 324.324 bits (830), Expect = 8.497e-103
Identity = 155/336 (46.13%), Postives = 218/336 (64.88%), Query Frame = 1
Query: 1252 PSNDTITKKHLTKEIVDKFNTIRTKNGSTLAHCIRNSVYN-NKAICPRTGDAKCYNCFSEYLDVVIRDYHKVKEPEVRHPNVNFGDLENLGFQNLDPEGSFIMSTRIRVGRSIDGFNFPPTISKVDRLKLEKTIVDALSSLTGIH-GGTYYPLTGMKENVQKQLIEDHFLFKDDDPVLRDAGGYRDWPSGRGIFHNNEKTFLVWVCEEDHMRIISMQKGGDIAAVFTRLVQGIRQIETKLTFAHSKKYGYLTCCPSNLGTTMRASVHLKIPKLSSDKTKLNEVCDRFNLQARGFHGEHTESPEGIYDISNKRRLGLMEIEAATEMAKGVLEMIQIE 2253
            P   ++ KK+LTKE+VD+    +TK G+ L   I++ V N +  +     DA+ Y  F    D +I+DYH    P+ + PN + G+ +     +LDPEG FI STRIR GRS+ G+ F P +S+ + L++E  +     ++T     G Y+PL GM + +Q QLI+DHFLFK+ D  L+ A   R WP GRGIFHNN+KTFL+W  EEDH+RIISMQ+GG++  V  RL++G++ IE +  F+   + G+LT CPSNLGTT+RASVH+++PK+S+ K     +CD   LQ RG HGEH+ES  G+YDISNK RLGL E EA  +M  G+  +I +E
Sbjct:   22 PECHSLLKKYLTKEVVDQLKDKKTKLGANLLDVIQSGVANLDSGVGVYAPDAEAYTLFKPLFDPLIQDYHNGFAPDAKQPNTDLGEGKTSALVDLDPEGKFINSTRIRCGRSLQGYPFNPCLSEANYLEMESKVKAIFDNITDPELAGKYFPLDGMTKEIQDQLIKDHFLFKEGDRFLQAANACRYWPKGRGIFHNNQKTFLIWCNEEDHLRIISMQEGGNVGQVLERLIKGVKTIEKQAPFSRDDRLGWLTFCPSNLGTTVRASVHIRLPKISA-KPDFKSICDGLKLQIRGIHGEHSESEGGVYDISNKARLGLTEFEAVKQMYDGIAHLIALE 356          
BLAST of Taurocyamine kinase vs. Ensembl Fly
Match: Argk (gene:FBgn0000116 transcript:FBtr0331550)

HSP 1 Score: 336.265 bits (861), Expect = 2.906e-107
Identity = 163/346 (47.11%), Postives = 232/346 (67.05%), Query Frame = 1
Query: 1222 EYLAKIIWNDPSNDTITKKHLTKEIVDKF-NTIRTKNGSTLAHCIRNSVYN-NKAICPRTGDAKCYNCFSEYLDVVIRDYHKVKEPEVRHPNVNFGDLENLGFQNLDPEGSFIMSTRIRVGRSIDGFNFPPTISKVDRLKLEKTIVDALSSLTGIHGGTYYPLTGMKENVQKQLIEDHFLFKDDDPVLRDAGGYRDWPSGRGIFHNNEKTFLVWVCEEDHMRIISMQKGGDIAAVFTRLVQGIRQIETKLTFAHSKKYGYLTCCPSNLGTTMRASVHLKIPKLSSDKTKLNEVCDRFNLQARGFHGEHTESPEGIYDISNKRRLGLMEIEAATEMAKGVLEMIQIE 2253
            E  AK+  +D  + ++ KK+LTKE+ D   N +     STL   I++ + N +  +     DA+ Y  F++  D +I DYH   +   +HP  NFGD+   G  N+DP   +++STR+R GRS+ G+ F P +++    ++E  +   LS L G   G +YPLTGM++ VQ+QLI+DHFLFK+ D  L+ A   R WPSGRGI+HN+ KTFLVW  EEDH+RIISMQ+GGD+  ++ RLV  + +IE ++ F+H  + G+LT CP+NLGTT+RASVH+K+PKL+S+K KL EV  ++NLQ RG  GEHTE+  G+YDISNKRR+GL E EA  EM  G+ E+I++E
Sbjct:   12 EGYAKLAASD--SKSLLKKYLTKEVFDNLKNKVTPTFKSTLLDVIQSGLENHDSGVGIYAPDAEAYTVFADLFDPIIEDYHGGFKKTDKHPASNFGDVSTFG--NVDPTNEYVISTRVRCGRSMQGYPFNPCLTEAQYKEMESKVSSTLSGLEGELKGKFYPLTGMEKAVQQQLIDDHFLFKEGDRFLQAANACRFWPSGRGIYHNDAKTFLVWCNEEDHLRIISMQQGGDLGQIYKRLVTAVNEIEKRVPFSHDDRLGFLTFCPTNLGTTIRASVHIKVPKLASNKAKLEEVAAKYNLQVRGTRGEHTEAEGGVYDISNKRRMGLTEFEAVKEMYDGITELIKLE 353          

HSP 2 Score: 319.316 bits (817), Expect = 6.320e-101
Identity = 163/350 (46.57%), Postives = 229/350 (65.43%), Query Frame = 1
Query:  130 LDEIYDMIYSNSENKSLAKKHLTKEIVAKYKN-TKSKFGGTLAMCLNTNAYN-PRALMCRTADPDCYDVFGDYFNELIKDYHKVATKEIEHPASDFGDIEHLPFKNMDVDKVYINSTRVRFGRTVKGFAFAPVISKEDRVTLSEQIANALKNLTGELQGNYYGLDNMTKEKQDELIKDHFLYRDDDQVLRDAGGYRDWPSGRGIFLNNEKTFVVWINEEDHIRIISMEPGGDLPKVYRRLIAGLKGLEENLEFERHKRFGFLTFCPTNLGTTMRASVHIKIPFL-SMLPNFKQICEQYSLQARGTYGEHTENVGGVFDISNQRRLGLTEIQAAKEMYDGVNAIIAIEKML 1170
            L+E Y  + + S++KSL KK+LTKE+    KN     F  TL   + +   N    +     D + Y VF D F+ +I+DYH    K  +HPAS+FGD+    F N+D    Y+ STRVR GR+++G+ F P +++     +  ++++ L  L GEL+G +Y L  M K  Q +LI DHFL+++ D+ L+ A   R WPSGRGI+ N+ KTF+VW NEEDH+RIISM+ GGDL ++Y+RL+  +  +E+ + F    R GFLTFCPTNLGTT+RASVHIK+P L S     +++  +Y+LQ RGT GEHTE  GGV+DISN+RR+GLTE +A KEMYDG+  +I +EK L
Sbjct:   10 LEEGYAKL-AASDSKSLLKKYLTKEVFDNLKNKVTPTFKSTLLDVIQSGLENHDSGVGIYAPDAEAYTVFADLFDPIIEDYHGGFKKTDKHPASNFGDVS--TFGNVDPTNEYVISTRVRCGRSMQGYPFNPCLTEAQYKEMESKVSSTLSGLEGELKGKFYPLTGMEKAVQQQLIDDHFLFKEGDRFLQAANACRFWPSGRGIYHNDAKTFLVWCNEEDHLRIISMQQGGDLGQIYKRLVTAVNEIEKRVPFSHDDRLGFLTFCPTNLGTTIRASVHIKVPKLASNKAKLEEVAAKYNLQVRGTRGEHTEAEGGVYDISNKRRMGLTEFEAVKEMYDGITELIKLEKSL 356          
BLAST of Taurocyamine kinase vs. Ensembl Fly
Match: Argk (gene:FBgn0000116 transcript:FBtr0076545)

HSP 1 Score: 336.265 bits (861), Expect = 2.906e-107
Identity = 163/346 (47.11%), Postives = 232/346 (67.05%), Query Frame = 1
Query: 1222 EYLAKIIWNDPSNDTITKKHLTKEIVDKF-NTIRTKNGSTLAHCIRNSVYN-NKAICPRTGDAKCYNCFSEYLDVVIRDYHKVKEPEVRHPNVNFGDLENLGFQNLDPEGSFIMSTRIRVGRSIDGFNFPPTISKVDRLKLEKTIVDALSSLTGIHGGTYYPLTGMKENVQKQLIEDHFLFKDDDPVLRDAGGYRDWPSGRGIFHNNEKTFLVWVCEEDHMRIISMQKGGDIAAVFTRLVQGIRQIETKLTFAHSKKYGYLTCCPSNLGTTMRASVHLKIPKLSSDKTKLNEVCDRFNLQARGFHGEHTESPEGIYDISNKRRLGLMEIEAATEMAKGVLEMIQIE 2253
            E  AK+  +D  + ++ KK+LTKE+ D   N +     STL   I++ + N +  +     DA+ Y  F++  D +I DYH   +   +HP  NFGD+   G  N+DP   +++STR+R GRS+ G+ F P +++    ++E  +   LS L G   G +YPLTGM++ VQ+QLI+DHFLFK+ D  L+ A   R WPSGRGI+HN+ KTFLVW  EEDH+RIISMQ+GGD+  ++ RLV  + +IE ++ F+H  + G+LT CP+NLGTT+RASVH+K+PKL+S+K KL EV  ++NLQ RG  GEHTE+  G+YDISNKRR+GL E EA  EM  G+ E+I++E
Sbjct:   12 EGYAKLAASD--SKSLLKKYLTKEVFDNLKNKVTPTFKSTLLDVIQSGLENHDSGVGIYAPDAEAYTVFADLFDPIIEDYHGGFKKTDKHPASNFGDVSTFG--NVDPTNEYVISTRVRCGRSMQGYPFNPCLTEAQYKEMESKVSSTLSGLEGELKGKFYPLTGMEKAVQQQLIDDHFLFKEGDRFLQAANACRFWPSGRGIYHNDAKTFLVWCNEEDHLRIISMQQGGDLGQIYKRLVTAVNEIEKRVPFSHDDRLGFLTFCPTNLGTTIRASVHIKVPKLASNKAKLEEVAAKYNLQVRGTRGEHTEAEGGVYDISNKRRMGLTEFEAVKEMYDGITELIKLE 353          

HSP 2 Score: 319.316 bits (817), Expect = 6.320e-101
Identity = 163/350 (46.57%), Postives = 229/350 (65.43%), Query Frame = 1
Query:  130 LDEIYDMIYSNSENKSLAKKHLTKEIVAKYKN-TKSKFGGTLAMCLNTNAYN-PRALMCRTADPDCYDVFGDYFNELIKDYHKVATKEIEHPASDFGDIEHLPFKNMDVDKVYINSTRVRFGRTVKGFAFAPVISKEDRVTLSEQIANALKNLTGELQGNYYGLDNMTKEKQDELIKDHFLYRDDDQVLRDAGGYRDWPSGRGIFLNNEKTFVVWINEEDHIRIISMEPGGDLPKVYRRLIAGLKGLEENLEFERHKRFGFLTFCPTNLGTTMRASVHIKIPFL-SMLPNFKQICEQYSLQARGTYGEHTENVGGVFDISNQRRLGLTEIQAAKEMYDGVNAIIAIEKML 1170
            L+E Y  + + S++KSL KK+LTKE+    KN     F  TL   + +   N    +     D + Y VF D F+ +I+DYH    K  +HPAS+FGD+    F N+D    Y+ STRVR GR+++G+ F P +++     +  ++++ L  L GEL+G +Y L  M K  Q +LI DHFL+++ D+ L+ A   R WPSGRGI+ N+ KTF+VW NEEDH+RIISM+ GGDL ++Y+RL+  +  +E+ + F    R GFLTFCPTNLGTT+RASVHIK+P L S     +++  +Y+LQ RGT GEHTE  GGV+DISN+RR+GLTE +A KEMYDG+  +I +EK L
Sbjct:   10 LEEGYAKL-AASDSKSLLKKYLTKEVFDNLKNKVTPTFKSTLLDVIQSGLENHDSGVGIYAPDAEAYTVFADLFDPIIEDYHGGFKKTDKHPASNFGDVS--TFGNVDPTNEYVISTRVRCGRSMQGYPFNPCLTEAQYKEMESKVSSTLSGLEGELKGKFYPLTGMEKAVQQQLIDDHFLFKEGDRFLQAANACRFWPSGRGIYHNDAKTFLVWCNEEDHLRIISMQQGGDLGQIYKRLVTAVNEIEKRVPFSHDDRLGFLTFCPTNLGTTIRASVHIKVPKLASNKAKLEEVAAKYNLQVRGTRGEHTEAEGGVYDISNKRRMGLTEFEAVKEMYDGITELIKLEKSL 356          
BLAST of Taurocyamine kinase vs. Ensembl Fly
Match: Argk (gene:FBgn0000116 transcript:FBtr0345030)

HSP 1 Score: 336.265 bits (861), Expect = 2.906e-107
Identity = 163/346 (47.11%), Postives = 232/346 (67.05%), Query Frame = 1
Query: 1222 EYLAKIIWNDPSNDTITKKHLTKEIVDKF-NTIRTKNGSTLAHCIRNSVYN-NKAICPRTGDAKCYNCFSEYLDVVIRDYHKVKEPEVRHPNVNFGDLENLGFQNLDPEGSFIMSTRIRVGRSIDGFNFPPTISKVDRLKLEKTIVDALSSLTGIHGGTYYPLTGMKENVQKQLIEDHFLFKDDDPVLRDAGGYRDWPSGRGIFHNNEKTFLVWVCEEDHMRIISMQKGGDIAAVFTRLVQGIRQIETKLTFAHSKKYGYLTCCPSNLGTTMRASVHLKIPKLSSDKTKLNEVCDRFNLQARGFHGEHTESPEGIYDISNKRRLGLMEIEAATEMAKGVLEMIQIE 2253
            E  AK+  +D  + ++ KK+LTKE+ D   N +     STL   I++ + N +  +     DA+ Y  F++  D +I DYH   +   +HP  NFGD+   G  N+DP   +++STR+R GRS+ G+ F P +++    ++E  +   LS L G   G +YPLTGM++ VQ+QLI+DHFLFK+ D  L+ A   R WPSGRGI+HN+ KTFLVW  EEDH+RIISMQ+GGD+  ++ RLV  + +IE ++ F+H  + G+LT CP+NLGTT+RASVH+K+PKL+S+K KL EV  ++NLQ RG  GEHTE+  G+YDISNKRR+GL E EA  EM  G+ E+I++E
Sbjct:   12 EGYAKLAASD--SKSLLKKYLTKEVFDNLKNKVTPTFKSTLLDVIQSGLENHDSGVGIYAPDAEAYTVFADLFDPIIEDYHGGFKKTDKHPASNFGDVSTFG--NVDPTNEYVISTRVRCGRSMQGYPFNPCLTEAQYKEMESKVSSTLSGLEGELKGKFYPLTGMEKAVQQQLIDDHFLFKEGDRFLQAANACRFWPSGRGIYHNDAKTFLVWCNEEDHLRIISMQQGGDLGQIYKRLVTAVNEIEKRVPFSHDDRLGFLTFCPTNLGTTIRASVHIKVPKLASNKAKLEEVAAKYNLQVRGTRGEHTEAEGGVYDISNKRRMGLTEFEAVKEMYDGITELIKLE 353          

HSP 2 Score: 319.316 bits (817), Expect = 6.320e-101
Identity = 163/350 (46.57%), Postives = 229/350 (65.43%), Query Frame = 1
Query:  130 LDEIYDMIYSNSENKSLAKKHLTKEIVAKYKN-TKSKFGGTLAMCLNTNAYN-PRALMCRTADPDCYDVFGDYFNELIKDYHKVATKEIEHPASDFGDIEHLPFKNMDVDKVYINSTRVRFGRTVKGFAFAPVISKEDRVTLSEQIANALKNLTGELQGNYYGLDNMTKEKQDELIKDHFLYRDDDQVLRDAGGYRDWPSGRGIFLNNEKTFVVWINEEDHIRIISMEPGGDLPKVYRRLIAGLKGLEENLEFERHKRFGFLTFCPTNLGTTMRASVHIKIPFL-SMLPNFKQICEQYSLQARGTYGEHTENVGGVFDISNQRRLGLTEIQAAKEMYDGVNAIIAIEKML 1170
            L+E Y  + + S++KSL KK+LTKE+    KN     F  TL   + +   N    +     D + Y VF D F+ +I+DYH    K  +HPAS+FGD+    F N+D    Y+ STRVR GR+++G+ F P +++     +  ++++ L  L GEL+G +Y L  M K  Q +LI DHFL+++ D+ L+ A   R WPSGRGI+ N+ KTF+VW NEEDH+RIISM+ GGDL ++Y+RL+  +  +E+ + F    R GFLTFCPTNLGTT+RASVHIK+P L S     +++  +Y+LQ RGT GEHTE  GGV+DISN+RR+GLTE +A KEMYDG+  +I +EK L
Sbjct:   10 LEEGYAKL-AASDSKSLLKKYLTKEVFDNLKNKVTPTFKSTLLDVIQSGLENHDSGVGIYAPDAEAYTVFADLFDPIIEDYHGGFKKTDKHPASNFGDVS--TFGNVDPTNEYVISTRVRCGRSMQGYPFNPCLTEAQYKEMESKVSSTLSGLEGELKGKFYPLTGMEKAVQQQLIDDHFLFKEGDRFLQAANACRFWPSGRGIYHNDAKTFLVWCNEEDHLRIISMQQGGDLGQIYKRLVTAVNEIEKRVPFSHDDRLGFLTFCPTNLGTTIRASVHIKVPKLASNKAKLEEVAAKYNLQVRGTRGEHTEAEGGVYDISNKRRMGLTEFEAVKEMYDGITELIKLEKSL 356          
BLAST of Taurocyamine kinase vs. Ensembl Fly
Match: Argk (gene:FBgn0000116 transcript:FBtr0112791)

HSP 1 Score: 335.88 bits (860), Expect = 6.487e-107
Identity = 163/346 (47.11%), Postives = 232/346 (67.05%), Query Frame = 1
Query: 1222 EYLAKIIWNDPSNDTITKKHLTKEIVDKF-NTIRTKNGSTLAHCIRNSVYN-NKAICPRTGDAKCYNCFSEYLDVVIRDYHKVKEPEVRHPNVNFGDLENLGFQNLDPEGSFIMSTRIRVGRSIDGFNFPPTISKVDRLKLEKTIVDALSSLTGIHGGTYYPLTGMKENVQKQLIEDHFLFKDDDPVLRDAGGYRDWPSGRGIFHNNEKTFLVWVCEEDHMRIISMQKGGDIAAVFTRLVQGIRQIETKLTFAHSKKYGYLTCCPSNLGTTMRASVHLKIPKLSSDKTKLNEVCDRFNLQARGFHGEHTESPEGIYDISNKRRLGLMEIEAATEMAKGVLEMIQIE 2253
            E  AK+  +D  + ++ KK+LTKE+ D   N +     STL   I++ + N +  +     DA+ Y  F++  D +I DYH   +   +HP  NFGD+   G  N+DP   +++STR+R GRS+ G+ F P +++    ++E  +   LS L G   G +YPLTGM++ VQ+QLI+DHFLFK+ D  L+ A   R WPSGRGI+HN+ KTFLVW  EEDH+RIISMQ+GGD+  ++ RLV  + +IE ++ F+H  + G+LT CP+NLGTT+RASVH+K+PKL+S+K KL EV  ++NLQ RG  GEHTE+  G+YDISNKRR+GL E EA  EM  G+ E+I++E
Sbjct:   31 EGYAKLAASD--SKSLLKKYLTKEVFDNLKNKVTPTFKSTLLDVIQSGLENHDSGVGIYAPDAEAYTVFADLFDPIIEDYHGGFKKTDKHPASNFGDVSTFG--NVDPTNEYVISTRVRCGRSMQGYPFNPCLTEAQYKEMESKVSSTLSGLEGELKGKFYPLTGMEKAVQQQLIDDHFLFKEGDRFLQAANACRFWPSGRGIYHNDAKTFLVWCNEEDHLRIISMQQGGDLGQIYKRLVTAVNEIEKRVPFSHDDRLGFLTFCPTNLGTTIRASVHIKVPKLASNKAKLEEVAAKYNLQVRGTRGEHTEAEGGVYDISNKRRMGLTEFEAVKEMYDGITELIKLE 372          

HSP 2 Score: 319.316 bits (817), Expect = 1.552e-100
Identity = 163/350 (46.57%), Postives = 229/350 (65.43%), Query Frame = 1
Query:  130 LDEIYDMIYSNSENKSLAKKHLTKEIVAKYKN-TKSKFGGTLAMCLNTNAYN-PRALMCRTADPDCYDVFGDYFNELIKDYHKVATKEIEHPASDFGDIEHLPFKNMDVDKVYINSTRVRFGRTVKGFAFAPVISKEDRVTLSEQIANALKNLTGELQGNYYGLDNMTKEKQDELIKDHFLYRDDDQVLRDAGGYRDWPSGRGIFLNNEKTFVVWINEEDHIRIISMEPGGDLPKVYRRLIAGLKGLEENLEFERHKRFGFLTFCPTNLGTTMRASVHIKIPFL-SMLPNFKQICEQYSLQARGTYGEHTENVGGVFDISNQRRLGLTEIQAAKEMYDGVNAIIAIEKML 1170
            L+E Y  + + S++KSL KK+LTKE+    KN     F  TL   + +   N    +     D + Y VF D F+ +I+DYH    K  +HPAS+FGD+    F N+D    Y+ STRVR GR+++G+ F P +++     +  ++++ L  L GEL+G +Y L  M K  Q +LI DHFL+++ D+ L+ A   R WPSGRGI+ N+ KTF+VW NEEDH+RIISM+ GGDL ++Y+RL+  +  +E+ + F    R GFLTFCPTNLGTT+RASVHIK+P L S     +++  +Y+LQ RGT GEHTE  GGV+DISN+RR+GLTE +A KEMYDG+  +I +EK L
Sbjct:   29 LEEGYAKL-AASDSKSLLKKYLTKEVFDNLKNKVTPTFKSTLLDVIQSGLENHDSGVGIYAPDAEAYTVFADLFDPIIEDYHGGFKKTDKHPASNFGDVS--TFGNVDPTNEYVISTRVRCGRSMQGYPFNPCLTEAQYKEMESKVSSTLSGLEGELKGKFYPLTGMEKAVQQQLIDDHFLFKEGDRFLQAANACRFWPSGRGIYHNDAKTFLVWCNEEDHLRIISMQQGGDLGQIYKRLVTAVNEIEKRVPFSHDDRLGFLTFCPTNLGTTIRASVHIKVPKLASNKAKLEEVAAKYNLQVRGTRGEHTEAEGGVYDISNKRRMGLTEFEAVKEMYDGITELIKLEKSL 375          
BLAST of Taurocyamine kinase vs. Ensembl Fly
Match: Argk (gene:FBgn0000116 transcript:FBtr0076546)

HSP 1 Score: 335.88 bits (860), Expect = 1.351e-106
Identity = 163/346 (47.11%), Postives = 232/346 (67.05%), Query Frame = 1
Query: 1222 EYLAKIIWNDPSNDTITKKHLTKEIVDKF-NTIRTKNGSTLAHCIRNSVYN-NKAICPRTGDAKCYNCFSEYLDVVIRDYHKVKEPEVRHPNVNFGDLENLGFQNLDPEGSFIMSTRIRVGRSIDGFNFPPTISKVDRLKLEKTIVDALSSLTGIHGGTYYPLTGMKENVQKQLIEDHFLFKDDDPVLRDAGGYRDWPSGRGIFHNNEKTFLVWVCEEDHMRIISMQKGGDIAAVFTRLVQGIRQIETKLTFAHSKKYGYLTCCPSNLGTTMRASVHLKIPKLSSDKTKLNEVCDRFNLQARGFHGEHTESPEGIYDISNKRRLGLMEIEAATEMAKGVLEMIQIE 2253
            E  AK+  +D  + ++ KK+LTKE+ D   N +     STL   I++ + N +  +     DA+ Y  F++  D +I DYH   +   +HP  NFGD+   G  N+DP   +++STR+R GRS+ G+ F P +++    ++E  +   LS L G   G +YPLTGM++ VQ+QLI+DHFLFK+ D  L+ A   R WPSGRGI+HN+ KTFLVW  EEDH+RIISMQ+GGD+  ++ RLV  + +IE ++ F+H  + G+LT CP+NLGTT+RASVH+K+PKL+S+K KL EV  ++NLQ RG  GEHTE+  G+YDISNKRR+GL E EA  EM  G+ E+I++E
Sbjct:   52 EGYAKLAASD--SKSLLKKYLTKEVFDNLKNKVTPTFKSTLLDVIQSGLENHDSGVGIYAPDAEAYTVFADLFDPIIEDYHGGFKKTDKHPASNFGDVSTFG--NVDPTNEYVISTRVRCGRSMQGYPFNPCLTEAQYKEMESKVSSTLSGLEGELKGKFYPLTGMEKAVQQQLIDDHFLFKEGDRFLQAANACRFWPSGRGIYHNDAKTFLVWCNEEDHLRIISMQQGGDLGQIYKRLVTAVNEIEKRVPFSHDDRLGFLTFCPTNLGTTIRASVHIKVPKLASNKAKLEEVAAKYNLQVRGTRGEHTEAEGGVYDISNKRRMGLTEFEAVKEMYDGITELIKLE 393          

HSP 2 Score: 319.316 bits (817), Expect = 2.617e-100
Identity = 163/350 (46.57%), Postives = 229/350 (65.43%), Query Frame = 1
Query:  130 LDEIYDMIYSNSENKSLAKKHLTKEIVAKYKN-TKSKFGGTLAMCLNTNAYN-PRALMCRTADPDCYDVFGDYFNELIKDYHKVATKEIEHPASDFGDIEHLPFKNMDVDKVYINSTRVRFGRTVKGFAFAPVISKEDRVTLSEQIANALKNLTGELQGNYYGLDNMTKEKQDELIKDHFLYRDDDQVLRDAGGYRDWPSGRGIFLNNEKTFVVWINEEDHIRIISMEPGGDLPKVYRRLIAGLKGLEENLEFERHKRFGFLTFCPTNLGTTMRASVHIKIPFL-SMLPNFKQICEQYSLQARGTYGEHTENVGGVFDISNQRRLGLTEIQAAKEMYDGVNAIIAIEKML 1170
            L+E Y  + + S++KSL KK+LTKE+    KN     F  TL   + +   N    +     D + Y VF D F+ +I+DYH    K  +HPAS+FGD+    F N+D    Y+ STRVR GR+++G+ F P +++     +  ++++ L  L GEL+G +Y L  M K  Q +LI DHFL+++ D+ L+ A   R WPSGRGI+ N+ KTF+VW NEEDH+RIISM+ GGDL ++Y+RL+  +  +E+ + F    R GFLTFCPTNLGTT+RASVHIK+P L S     +++  +Y+LQ RGT GEHTE  GGV+DISN+RR+GLTE +A KEMYDG+  +I +EK L
Sbjct:   50 LEEGYAKL-AASDSKSLLKKYLTKEVFDNLKNKVTPTFKSTLLDVIQSGLENHDSGVGIYAPDAEAYTVFADLFDPIIEDYHGGFKKTDKHPASNFGDVS--TFGNVDPTNEYVISTRVRCGRSMQGYPFNPCLTEAQYKEMESKVSSTLSGLEGELKGKFYPLTGMEKAVQQQLIDDHFLFKEGDRFLQAANACRFWPSGRGIYHNDAKTFLVWCNEEDHLRIISMQQGGDLGQIYKRLVTAVNEIEKRVPFSHDDRLGFLTFCPTNLGTTIRASVHIKVPKLASNKAKLEEVAAKYNLQVRGTRGEHTEAEGGVYDISNKRRMGLTEFEAVKEMYDGITELIKLEKSL 396          
BLAST of Taurocyamine kinase vs. Ensembl Zebrafish
Match: ckmb (creatine kinase, muscle b [Source:ZFIN;Acc:ZDB-GENE-040426-2128])

HSP 1 Score: 261.151 bits (666), Expect = 1.542e-78
Identity = 147/338 (43.49%), Postives = 203/338 (60.06%), Query Frame = 1
Query: 1276 KHLTKEIVDKFNTIRTKNGSTLAHCIRNSVYNNK-----AICPRTGDAKCYNCFSEYLDVVIRDYHKVKEPEVRH-PNVNFGDLENLGFQNLDPEGSFIMSTRIRVGRSIDGFNFPPTISKVDRLKLEKTIVDALSSLTGIHGGTYYPLTGMKENVQKQLIEDHFLF-KDDDPVLRDAGGYRDWPSGRGIFHNNEKTFLVWVCEEDHMRIISMQKGGDIAAVFTRLVQGIRQIETKLT-----FAHSKKYGYLTCCPSNLGTTMRASVHLKIPKLSSDKTKLNEVCDRFNLQARGFHGEHTESPEGIYDISNKRRLGLMEIEAATEMAKGVLEMIQIE 2253
            K LTK+I +K  +  T +G TL  CI+  V N        +    GD + Y  F E  D VI D H   +P  +H  ++N+ +L+  G  +LDP  ++++S+R+R GRSI GF  PP  S+ +R  +EK  ++AL+SL G   G YYPL  M +  Q+QLI DHFLF K   P+L  AG  RDWP GRGI+HN+ KTFLVWV EEDH+R+ISMQKGG++  VF R   G+++IE         F  ++  G++  CPSNLGT +R  VH+K+PKLS+   K  E+  R  LQ RG  G  T S  G++DISN  RLG  E++    +  GV  M+++E
Sbjct:   31 KVLTKDIYNKLRSKSTPSGFTLDDCIQTGVDNPGHPFIMTVGCVAGDEESYEAFKELFDPVISDRHGGYKPTDKHLTDLNWENLK--GGDDLDP--NYVLSSRVRTGRSIKGFTLPPHNSRGERRAVEKLSIEALNSLDGEFKGKYYPLKDMTDKEQEQLIADHFLFDKPVSPLLLAAGMARDWPDGRGIWHNDNKTFLVWVNEEDHLRVISMQKGGNMKEVFKRFCVGLQKIEDVFKKHNHGFMWNEHLGFILTCPSNLGTGLRGGVHVKLPKLST-HAKFEEILTRLRLQKRGTGGVDTASVGGVFDISNADRLGSSEVQQVQLVVDGVKLMVEME 363          

HSP 2 Score: 252.292 bits (643), Expect = 2.468e-75
Identity = 142/370 (38.38%), Postives = 217/370 (58.65%), Query Frame = 1
Query:  112 KMEYKSLDEIYDMIYSNSENKSLAKKHLTKEIVAKYKNTKSKFGGTLAMCLNTNAYNP-----RALMCRTADPDCYDVFGDYFNELIKDYHKVATKEIEHPASDFGDIEHLPFKNM----DVDKVYINSTRVRFGRTVKGFAFAPVISKEDRVTLSEQIANALKNLTGELQGNYYGLDNMTKEKQDELIKDHFLY-RDDDQVLRDAGGYRDWPSGRGIFLNNEKTFVVWINEEDHIRIISMEPGGDLPKVYRRLIAGLKGLEE-----NLEFERHKRFGFLTFCPTNLGTTMRASVHIKIPFLSMLPNFKQICEQYSLQARGTYGEHTENVGGVFDISNQRRLGLTEIQAAKEMYDGVNAIIAIEKMLGK 1176
            KM++   +E  D+    S++ +   K LTK+I  K ++  +  G TL  C+ T   NP       + C   D + Y+ F + F+ +I D H       +H       +  L ++N+    D+D  Y+ S+RVR GR++KGF   P  S+ +R  + +    AL +L GE +G YY L +MT ++Q++LI DHFL+ +    +L  AG  RDWP GRGI+ N+ KTF+VW+NEEDH+R+ISM+ GG++ +V++R   GL+ +E+     N  F  ++  GF+  CP+NLGT +R  VH+K+P LS    F++I  +  LQ RGT G  T +VGGVFDISN  RLG +E+Q  + + DGV  ++ +EK L K
Sbjct:   10 KMKFAVDEEFPDL----SQHNNHMSKVLTKDIYNKLRSKSTPSGFTLDDCIQTGVDNPGHPFIMTVGCVAGDEESYEAFKELFDPVISDRHGGYKPTDKH-------LTDLNWENLKGGDDLDPNYVLSSRVRTGRSIKGFTLPPHNSRGERRAVEKLSIEALNSLDGEFKGKYYPLKDMTDKEQEQLIADHFLFDKPVSPLLLAAGMARDWPDGRGIWHNDNKTFLVWVNEEDHLRVISMQKGGNMKEVFKRFCVGLQKIEDVFKKHNHGFMWNEHLGFILTCPSNLGTGLRGGVHVKLPKLSTHAKFEEILTRLRLQKRGTGGVDTASVGGVFDISNADRLGSSEVQQVQLVVDGVKLMVEMEKKLEK 368          
BLAST of Taurocyamine kinase vs. Ensembl Zebrafish
Match: ckmb (creatine kinase, muscle b [Source:ZFIN;Acc:ZDB-GENE-040426-2128])

HSP 1 Score: 261.151 bits (666), Expect = 1.542e-78
Identity = 147/338 (43.49%), Postives = 203/338 (60.06%), Query Frame = 1
Query: 1276 KHLTKEIVDKFNTIRTKNGSTLAHCIRNSVYNNK-----AICPRTGDAKCYNCFSEYLDVVIRDYHKVKEPEVRH-PNVNFGDLENLGFQNLDPEGSFIMSTRIRVGRSIDGFNFPPTISKVDRLKLEKTIVDALSSLTGIHGGTYYPLTGMKENVQKQLIEDHFLF-KDDDPVLRDAGGYRDWPSGRGIFHNNEKTFLVWVCEEDHMRIISMQKGGDIAAVFTRLVQGIRQIETKLT-----FAHSKKYGYLTCCPSNLGTTMRASVHLKIPKLSSDKTKLNEVCDRFNLQARGFHGEHTESPEGIYDISNKRRLGLMEIEAATEMAKGVLEMIQIE 2253
            K LTK+I +K  +  T +G TL  CI+  V N        +    GD + Y  F E  D VI D H   +P  +H  ++N+ +L+  G  +LDP  ++++S+R+R GRSI GF  PP  S+ +R  +EK  ++AL+SL G   G YYPL  M +  Q+QLI DHFLF K   P+L  AG  RDWP GRGI+HN+ KTFLVWV EEDH+R+ISMQKGG++  VF R   G+++IE         F  ++  G++  CPSNLGT +R  VH+K+PKLS+   K  E+  R  LQ RG  G  T S  G++DISN  RLG  E++    +  GV  M+++E
Sbjct:   31 KVLTKDIYNKLRSKSTPSGFTLDDCIQTGVDNPGHPFIMTVGCVAGDEESYEAFKELFDPVISDRHGGYKPTDKHLTDLNWENLK--GGDDLDP--NYVLSSRVRTGRSIKGFTLPPHNSRGERRAVEKLSIEALNSLDGEFKGKYYPLKDMTDKEQEQLIADHFLFDKPVSPLLLAAGMARDWPDGRGIWHNDNKTFLVWVNEEDHLRVISMQKGGNMKEVFKRFCVGLQKIEDVFKKHNHGFMWNEHLGFILTCPSNLGTGLRGGVHVKLPKLST-HAKFEEILTRLRLQKRGTGGVDTASVGGVFDISNADRLGSSEVQQVQLVVDGVKLMVEME 363          

HSP 2 Score: 252.292 bits (643), Expect = 2.468e-75
Identity = 142/370 (38.38%), Postives = 217/370 (58.65%), Query Frame = 1
Query:  112 KMEYKSLDEIYDMIYSNSENKSLAKKHLTKEIVAKYKNTKSKFGGTLAMCLNTNAYNP-----RALMCRTADPDCYDVFGDYFNELIKDYHKVATKEIEHPASDFGDIEHLPFKNM----DVDKVYINSTRVRFGRTVKGFAFAPVISKEDRVTLSEQIANALKNLTGELQGNYYGLDNMTKEKQDELIKDHFLY-RDDDQVLRDAGGYRDWPSGRGIFLNNEKTFVVWINEEDHIRIISMEPGGDLPKVYRRLIAGLKGLEE-----NLEFERHKRFGFLTFCPTNLGTTMRASVHIKIPFLSMLPNFKQICEQYSLQARGTYGEHTENVGGVFDISNQRRLGLTEIQAAKEMYDGVNAIIAIEKMLGK 1176
            KM++   +E  D+    S++ +   K LTK+I  K ++  +  G TL  C+ T   NP       + C   D + Y+ F + F+ +I D H       +H       +  L ++N+    D+D  Y+ S+RVR GR++KGF   P  S+ +R  + +    AL +L GE +G YY L +MT ++Q++LI DHFL+ +    +L  AG  RDWP GRGI+ N+ KTF+VW+NEEDH+R+ISM+ GG++ +V++R   GL+ +E+     N  F  ++  GF+  CP+NLGT +R  VH+K+P LS    F++I  +  LQ RGT G  T +VGGVFDISN  RLG +E+Q  + + DGV  ++ +EK L K
Sbjct:   10 KMKFAVDEEFPDL----SQHNNHMSKVLTKDIYNKLRSKSTPSGFTLDDCIQTGVDNPGHPFIMTVGCVAGDEESYEAFKELFDPVISDRHGGYKPTDKH-------LTDLNWENLKGGDDLDPNYVLSSRVRTGRSIKGFTLPPHNSRGERRAVEKLSIEALNSLDGEFKGKYYPLKDMTDKEQEQLIADHFLFDKPVSPLLLAAGMARDWPDGRGIWHNDNKTFLVWVNEEDHLRVISMQKGGNMKEVFKRFCVGLQKIEDVFKKHNHGFMWNEHLGFILTCPSNLGTGLRGGVHVKLPKLSTHAKFEEILTRLRLQKRGTGGVDTASVGGVFDISNADRLGSSEVQQVQLVVDGVKLMVEMEKKLEK 368          
BLAST of Taurocyamine kinase vs. Ensembl Zebrafish
Match: ckma (creatine kinase, muscle a [Source:ZFIN;Acc:ZDB-GENE-980526-109])

HSP 1 Score: 249.21 bits (635), Expect = 3.822e-74
Identity = 144/370 (38.92%), Postives = 216/370 (58.38%), Query Frame = 1
Query:  112 KMEYKSLDEIYDMIYSNSENKSLAKKHLTKEIVAKYKNTKSKFGGTLAMCLNTNAYNP-----RALMCRTADPDCYDVFGDYFNELIKDYHKVATKEIEHPASDFGDIEHLPFKNM----DVDKVYINSTRVRFGRTVKGFAFAPVISKEDRVTLSEQIANALKNLTGELQGNYYGLDNMTKEKQDELIKDHFLY-RDDDQVLRDAGGYRDWPSGRGIFLNNEKTFVVWINEEDHIRIISMEPGGDLPKVYRRLIAGLKGLEE-----NLEFERHKRFGFLTFCPTNLGTTMRASVHIKIPFLSMLPNFKQICEQYSLQARGTYGEHTENVGGVFDISNQRRLGLTEIQAAKEMYDGVNAIIAIEKMLGK 1176
            K+ Y S+DE Y  +  +  N  +AK  LTKE+  K ++ ++  G T+   + T   NP       + C   D + Y+VF D F+ +I D H       +H          L F+N+    D+D  Y+ S+RVR GR++KG+A  P  S+ +R  + +    AL +L GE +G YY L +MT  +Q++LI DHFL+ +    +L  AG  RDWP  RGI+ N  KTF+VW+NEEDH+R+ISM+ GG++ +V++R   GL+ +EE     N  F  ++  GF+  CP+NLGT +R  VH+K+P LS    F++I  +  LQ RGT G  T +VGGVFDISN  R+G +E++  + + DGV  ++ +EK L K
Sbjct:   11 KLNY-SVDEEYPDL--SKHNNHMAKV-LTKEMYGKLRDKQTSTGFTVDDVIQTGVDNPGHPFIMTVGCVAGDEESYEVFKDLFDPVISDRHGGYKATDKHKTD-------LNFENLKGGDDLDPNYVLSSRVRTGRSIKGYALPPHNSRGERRAVEKLSVEALSSLDGEFKGKYYPLKSMTDAEQEQLIADHFLFDKPVSPLLLAAGMARDWPDARGIWHNENKTFLVWVNEEDHLRVISMQKGGNMKEVFKRFCVGLQRIEEIFKKHNHGFMWNEHLGFVLTCPSNLGTGLRGGVHVKLPKLSTHAKFEEILTRLRLQKRGTGGVDTASVGGVFDISNADRIGSSEVEQVQCVVDGVKLMVEMEKKLEK 369          

HSP 2 Score: 249.21 bits (635), Expect = 4.063e-74
Identity = 144/338 (42.60%), Postives = 197/338 (58.28%), Query Frame = 1
Query: 1276 KHLTKEIVDKFNTIRTKNGSTLAHCIRNSVYNNK-----AICPRTGDAKCYNCFSEYLDVVIRDYHKVKEPEVRH-PNVNFGDLENLGFQNLDPEGSFIMSTRIRVGRSIDGFNFPPTISKVDRLKLEKTIVDALSSLTGIHGGTYYPLTGMKENVQKQLIEDHFLF-KDDDPVLRDAGGYRDWPSGRGIFHNNEKTFLVWVCEEDHMRIISMQKGGDIAAVFTRLVQGIRQIETKLT-----FAHSKKYGYLTCCPSNLGTTMRASVHLKIPKLSSDKTKLNEVCDRFNLQARGFHGEHTESPEGIYDISNKRRLGLMEIEAATEMAKGVLEMIQIE 2253
            K LTKE+  K    +T  G T+   I+  V N        +    GD + Y  F +  D VI D H   +   +H  ++NF +L+  G  +LDP  ++++S+R+R GRSI G+  PP  S+ +R  +EK  V+ALSSL G   G YYPL  M +  Q+QLI DHFLF K   P+L  AG  RDWP  RGI+HN  KTFLVWV EEDH+R+ISMQKGG++  VF R   G+++IE         F  ++  G++  CPSNLGT +R  VH+K+PKLS+   K  E+  R  LQ RG  G  T S  G++DISN  R+G  E+E    +  GV  M+++E
Sbjct:   32 KVLTKEMYGKLRDKQTSTGFTVDDVIQTGVDNPGHPFIMTVGCVAGDEESYEVFKDLFDPVISDRHGGYKATDKHKTDLNFENLK--GGDDLDP--NYVLSSRVRTGRSIKGYALPPHNSRGERRAVEKLSVEALSSLDGEFKGKYYPLKSMTDAEQEQLIADHFLFDKPVSPLLLAAGMARDWPDARGIWHNENKTFLVWVNEEDHLRVISMQKGGNMKEVFKRFCVGLQRIEEIFKKHNHGFMWNEHLGFVLTCPSNLGTGLRGGVHVKLPKLST-HAKFEEILTRLRLQKRGTGGVDTASVGGVFDISNADRIGSSEVEQVQCVVDGVKLMVEME 364          
BLAST of Taurocyamine kinase vs. Ensembl Zebrafish
Match: ckma (creatine kinase, muscle a [Source:ZFIN;Acc:ZDB-GENE-980526-109])

HSP 1 Score: 249.21 bits (635), Expect = 3.822e-74
Identity = 144/370 (38.92%), Postives = 216/370 (58.38%), Query Frame = 1
Query:  112 KMEYKSLDEIYDMIYSNSENKSLAKKHLTKEIVAKYKNTKSKFGGTLAMCLNTNAYNP-----RALMCRTADPDCYDVFGDYFNELIKDYHKVATKEIEHPASDFGDIEHLPFKNM----DVDKVYINSTRVRFGRTVKGFAFAPVISKEDRVTLSEQIANALKNLTGELQGNYYGLDNMTKEKQDELIKDHFLY-RDDDQVLRDAGGYRDWPSGRGIFLNNEKTFVVWINEEDHIRIISMEPGGDLPKVYRRLIAGLKGLEE-----NLEFERHKRFGFLTFCPTNLGTTMRASVHIKIPFLSMLPNFKQICEQYSLQARGTYGEHTENVGGVFDISNQRRLGLTEIQAAKEMYDGVNAIIAIEKMLGK 1176
            K+ Y S+DE Y  +  +  N  +AK  LTKE+  K ++ ++  G T+   + T   NP       + C   D + Y+VF D F+ +I D H       +H          L F+N+    D+D  Y+ S+RVR GR++KG+A  P  S+ +R  + +    AL +L GE +G YY L +MT  +Q++LI DHFL+ +    +L  AG  RDWP  RGI+ N  KTF+VW+NEEDH+R+ISM+ GG++ +V++R   GL+ +EE     N  F  ++  GF+  CP+NLGT +R  VH+K+P LS    F++I  +  LQ RGT G  T +VGGVFDISN  R+G +E++  + + DGV  ++ +EK L K
Sbjct:   11 KLNY-SVDEEYPDL--SKHNNHMAKV-LTKEMYGKLRDKQTSTGFTVDDVIQTGVDNPGHPFIMTVGCVAGDEESYEVFKDLFDPVISDRHGGYKATDKHKTD-------LNFENLKGGDDLDPNYVLSSRVRTGRSIKGYALPPHNSRGERRAVEKLSVEALSSLDGEFKGKYYPLKSMTDAEQEQLIADHFLFDKPVSPLLLAAGMARDWPDARGIWHNENKTFLVWVNEEDHLRVISMQKGGNMKEVFKRFCVGLQRIEEIFKKHNHGFMWNEHLGFVLTCPSNLGTGLRGGVHVKLPKLSTHAKFEEILTRLRLQKRGTGGVDTASVGGVFDISNADRIGSSEVEQVQCVVDGVKLMVEMEKKLEK 369          

HSP 2 Score: 249.21 bits (635), Expect = 4.063e-74
Identity = 144/338 (42.60%), Postives = 197/338 (58.28%), Query Frame = 1
Query: 1276 KHLTKEIVDKFNTIRTKNGSTLAHCIRNSVYNNK-----AICPRTGDAKCYNCFSEYLDVVIRDYHKVKEPEVRH-PNVNFGDLENLGFQNLDPEGSFIMSTRIRVGRSIDGFNFPPTISKVDRLKLEKTIVDALSSLTGIHGGTYYPLTGMKENVQKQLIEDHFLF-KDDDPVLRDAGGYRDWPSGRGIFHNNEKTFLVWVCEEDHMRIISMQKGGDIAAVFTRLVQGIRQIETKLT-----FAHSKKYGYLTCCPSNLGTTMRASVHLKIPKLSSDKTKLNEVCDRFNLQARGFHGEHTESPEGIYDISNKRRLGLMEIEAATEMAKGVLEMIQIE 2253
            K LTKE+  K    +T  G T+   I+  V N        +    GD + Y  F +  D VI D H   +   +H  ++NF +L+  G  +LDP  ++++S+R+R GRSI G+  PP  S+ +R  +EK  V+ALSSL G   G YYPL  M +  Q+QLI DHFLF K   P+L  AG  RDWP  RGI+HN  KTFLVWV EEDH+R+ISMQKGG++  VF R   G+++IE         F  ++  G++  CPSNLGT +R  VH+K+PKLS+   K  E+  R  LQ RG  G  T S  G++DISN  R+G  E+E    +  GV  M+++E
Sbjct:   32 KVLTKEMYGKLRDKQTSTGFTVDDVIQTGVDNPGHPFIMTVGCVAGDEESYEVFKDLFDPVISDRHGGYKATDKHKTDLNFENLK--GGDDLDP--NYVLSSRVRTGRSIKGYALPPHNSRGERRAVEKLSVEALSSLDGEFKGKYYPLKSMTDAEQEQLIADHFLFDKPVSPLLLAAGMARDWPDARGIWHNENKTFLVWVNEEDHLRVISMQKGGNMKEVFKRFCVGLQRIEEIFKKHNHGFMWNEHLGFVLTCPSNLGTGLRGGVHVKLPKLST-HAKFEEILTRLRLQKRGTGGVDTASVGGVFDISNADRIGSSEVEQVQCVVDGVKLMVEME 364          
BLAST of Taurocyamine kinase vs. Ensembl Zebrafish
Match: ckba (creatine kinase, brain a [Source:ZFIN;Acc:ZDB-GENE-060929-902])

HSP 1 Score: 248.825 bits (634), Expect = 5.087e-74
Identity = 144/338 (42.60%), Postives = 198/338 (58.58%), Query Frame = 1
Query: 1276 KHLTKEIVDKFNTIRTKNGSTLAHCIRNSVYNNK-----AICPRTGDAKCYNCFSEYLDVVIRDYHKVKEPEVRH-PNVNFGDLENLGFQNLDPEGSFIMSTRIRVGRSIDGFNFPPTISKVDRLKLEKTIVDALSSLTGIHGGTYYPLTGMKENVQKQLIEDHFLF-KDDDPVLRDAGGYRDWPSGRGIFHNNEKTFLVWVCEEDHMRIISMQKGGDIAAVFTRLVQGIRQIETKL-----TFAHSKKYGYLTCCPSNLGTTMRASVHLKIPKLSSDKTKLNEVCDRFNLQARGFHGEHTESPEGIYDISNKRRLGLMEIEAATEMAKGVLEMIQIE 2253
            K LT  + +K  + +T +G TL   I+  V N        +    GD + Y  F E LD VI+D H   +P  +H  ++N  +L+  G  +LDP  ++++S+R+R GRSI GF  PP  S+ +R  +EK  V AL +L G   G YY L  M E  Q+QLI+DHFLF K   P+L  +G  RDWP  RGI+HN+ KTFLVWV EEDH+R+ISMQKGG +  VFTR   G+ +IE         F  ++  GY+  CPSNLGT +RA VH+K+P LS  + +  E+  R  LQ RG  G  T +  G++DISN  RLG  E+E    +  GV  +I++E
Sbjct:   32 KILTPGLYEKLRSKQTPSGFTLDDVIQTGVDNPGHPFIMTVGCVAGDEETYEVFKELLDPVIQDRHGGYKPTDKHKTDLNPSNLK--GGDDLDP--NYVLSSRVRTGRSIRGFCLPPHCSRGERRAVEKLSVQALGALAGDLKGKYYALKNMTEAEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDSKTFLVWVNEEDHLRVISMQKGGKMKEVFTRFCIGLTKIEELFRNKGHAFMWNEHLGYVLTCPSNLGTGLRAGVHVKLPNLSKYR-QFEEILKRLRLQKRGTGGVDTAAVGGVFDISNADRLGFSEVELVQMVVDGVKLLIEME 364          

HSP 2 Score: 241.891 bits (616), Expect = 2.065e-71
Identity = 139/367 (37.87%), Postives = 208/367 (56.68%), Query Frame = 1
Query:  112 KMEYKSLDEIYDMIYSNSENKSLAKKHLTKEIVAKYKNTKSKFGGTLAMCLNTNAYNP-----RALMCRTADPDCYDVFGDYFNELIKDYHKVATKEIEHPASDFGDIEHLPFKNMD-VDKVYINSTRVRFGRTVKGFAFAPVISKEDRVTLSEQIANALKNLTGELQGNYYGLDNMTKEKQDELIKDHFLY-RDDDQVLRDAGGYRDWPSGRGIFLNNEKTFVVWINEEDHIRIISMEPGGDLPKVYRRLIAGLKGLEENLEFERH-----KRFGFLTFCPTNLGTTMRASVHIKIPFLSMLPNFKQICEQYSLQARGTYGEHTENVGGVFDISNQRRLGLTEIQAAKEMYDGVNAIIAIEKMLGK 1176
            KM+Y S  E  D+    S++ +   K LT  +  K ++ ++  G TL   + T   NP       + C   D + Y+VF +  + +I+D H       +H      D+     K  D +D  Y+ S+RVR GR+++GF   P  S+ +R  + +    AL  L G+L+G YY L NMT+ +Q +LI DHFL+ +    +L  +G  RDWP  RGI+ N+ KTF+VW+NEEDH+R+ISM+ GG + +V+ R   GL  +EE    + H     +  G++  CP+NLGT +RA VH+K+P LS    F++I ++  LQ RGT G  T  VGGVFDISN  RLG +E++  + + DGV  +I +EK L K
Sbjct:   11 KMKYSSEQEYPDL----SKHNNYMAKILTPGLYEKLRSKQTPSGFTLDDVIQTGVDNPGHPFIMTVGCVAGDEETYEVFKELLDPVIQDRHGGYKPTDKHKT----DLNPSNLKGGDDLDPNYVLSSRVRTGRSIRGFCLPPHCSRGERRAVEKLSVQALGALAGDLKGKYYALKNMTEAEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDSKTFLVWVNEEDHLRVISMQKGGKMKEVFTRFCIGLTKIEELFRNKGHAFMWNEHLGYVLTCPSNLGTGLRAGVHVKLPNLSKYRQFEEILKRLRLQKRGTGGVDTAAVGGVFDISNADRLGFSEVELVQMVVDGVKLLIEMEKRLEK 369          
BLAST of Taurocyamine kinase vs. Ensembl Xenopus
Match: aldh1l2 (aldehyde dehydrogenase 1 family member L2 [Source:Xenbase;Acc:XB-GENE-5820495])

HSP 1 Score: 266.159 bits (679), Expect = 8.755e-80
Identity = 150/381 (39.37%), Postives = 215/381 (56.43%), Query Frame = 1
Query:   91 IYSAYLRKMEYKSLDEIYDMIYSNSENKSLAKKH-------LTKEIVAKYKNTKSKFGGTLAMCLNTNAYNPRALMCRT-----ADPDCYDVFGDYFNELIKDYHK-VATKEIEHPASDFGDIEHLPFKNMDVDKVYINSTRVRFGRTVKGFAFAPVISKEDRVTLSEQIANALKNLTGELQGNYYGLDNMTKEKQDELIKDHFLY-RDDDQVLRDAGGYRDWPSGRGIFLNNEKTFVVWINEEDHIRIISMEPGGDLPKVYRRLIAGLKGLE-----ENLEFERHKRFGFLTFCPTNLGTTMRASVHIKIPFLSMLPNFKQICEQYSLQARGTYGEHTENVGGVFDISNQRRLGLTEIQAAKEMYDGVNAIIAIEKMLGK 1176
            + + YL   E  S D     +Y  S      +KH       LT  I  K  + K+  G T+  C+ T   NP     +T      D +CY+VF D F+ +IK+ H     + ++HP     D++    K    D+ Y+ S+RVR GR+++G +  P  ++ +R  + +  A+AL  L G+L G+YY L  MT+++Q +LI DHFL+ +    +L  AG  RDWP  RGI+ NNEKTF++WINEEDH R+ISME GG++ +V+ R   GLK +E     +  EF  ++R G++  CP+NLGT +RA VHIK+P LS    F +I E   LQ RGT G  T  VG  FDISN  RLG +E++  + + DGVN +I  EK L K
Sbjct:   26 VAAGYLMTREAISADTSNRRLYPASAEYPDLRKHNNCMASNLTPAIYTKLCDKKTPAGFTVDQCIQTGVDNPGHPFIKTVGMVAGDEECYEVFADLFDPVIKERHNGYDPRTMKHPT----DLDASKIKGGFFDERYVLSSRVRTGRSIRGLSLPPACTRAERREVEKVTADALNGLQGDLSGHYYSLTQMTEKQQQQLIDDHFLFDKPVSPLLTAAGMARDWPDARGIWHNNEKTFLIWINEEDHTRVISMEKGGNMKRVFERFCRGLKEVERLIQEKGWEFMWNERLGYILTCPSNLGTGLRAGVHIKLPLLSKDARFAKILENLRLQKRGTGGVDTAAVGSTFDISNLDRLGKSEVELTQMVIDGVNYLIDCEKRLEK 402          

HSP 2 Score: 246.899 bits (629), Expect = 1.058e-72
Identity = 135/337 (40.06%), Postives = 195/337 (57.86%), Query Frame = 1
Query: 1279 HLTKEIVDKFNTIRTKNGSTLAHCIRNSVYNN-----KAICPRTGDAKCYNCFSEYLDVVIRDYHKVKEPE-VRHPNVNFGDLENLGFQNLDPEGSFIMSTRIRVGRSIDGFNFPPTISKVDRLKLEKTIVDALSSLTGIHGGTYYPLTGMKENVQKQLIEDHFLF-KDDDPVLRDAGGYRDWPSGRGIFHNNEKTFLVWVCEEDHMRIISMQKGGDIAAVFTRLVQGIRQIETKLT-----FAHSKKYGYLTCCPSNLGTTMRASVHLKIPKLSSDKTKLNEVCDRFNLQARGFHGEHTESPEGIYDISNKRRLGLMEIEAATEMAKGVLEMIQIE 2253
            +LT  I  K    +T  G T+  CI+  V N      K +    GD +CY  F++  D VI++ H   +P  ++HP     DL+    +    +  +++S+R+R GRSI G + PP  ++ +R ++EK   DAL+ L G   G YY LT M E  Q+QLI+DHFLF K   P+L  AG  RDWP  RGI+HNNEKTFL+W+ EEDH R+ISM+KGG++  VF R  +G++++E  +      F  +++ GY+  CPSNLGT +RA VH+K+P LS D  +  ++ +   LQ RG  G  T +    +DISN  RLG  E+E    +  GV  +I  E
Sbjct:   66 NLTPAIYTKLCDKKTPAGFTVDQCIQTGVDNPGHPFIKTVGMVAGDEECYEVFADLFDPVIKERHNGYDPRTMKHPT----DLDASKIKGGFFDERYVLSSRVRTGRSIRGLSLPPACTRAERREVEKVTADALNGLQGDLSGHYYSLTQMTEKQQQQLIDDHFLFDKPVSPLLTAAGMARDWPDARGIWHNNEKTFLIWINEEDHTRVISMEKGGNMKRVFERFCRGLKEVERLIQEKGWEFMWNERLGYILTCPSNLGTGLRAGVHIKLPLLSKD-ARFAKILENLRLQKRGTGGVDTAAVGSTFDISNLDRLGKSEVELTQMVIDGVNYLIDCE 397          
BLAST of Taurocyamine kinase vs. Ensembl Xenopus
Match: aldh1l2 (aldehyde dehydrogenase 1 family member L2 [Source:Xenbase;Acc:XB-GENE-5820495])

HSP 1 Score: 265.388 bits (677), Expect = 2.748e-79
Identity = 150/381 (39.37%), Postives = 215/381 (56.43%), Query Frame = 1
Query:   91 IYSAYLRKMEYKSLDEIYDMIYSNSENKSLAKKH-------LTKEIVAKYKNTKSKFGGTLAMCLNTNAYNPRALMCRT-----ADPDCYDVFGDYFNELIKDYHK-VATKEIEHPASDFGDIEHLPFKNMDVDKVYINSTRVRFGRTVKGFAFAPVISKEDRVTLSEQIANALKNLTGELQGNYYGLDNMTKEKQDELIKDHFLY-RDDDQVLRDAGGYRDWPSGRGIFLNNEKTFVVWINEEDHIRIISMEPGGDLPKVYRRLIAGLKGLE-----ENLEFERHKRFGFLTFCPTNLGTTMRASVHIKIPFLSMLPNFKQICEQYSLQARGTYGEHTENVGGVFDISNQRRLGLTEIQAAKEMYDGVNAIIAIEKMLGK 1176
            + + YL   E  S D     +Y  S      +KH       LT  I  K  + K+  G T+  C+ T   NP     +T      D +CY+VF D F+ +IK+ H     + ++HP     D++    K    D+ Y+ S+RVR GR+++G +  P  ++ +R  + +  A+AL  L G+L G+YY L  MT+++Q +LI DHFL+ +    +L  AG  RDWP  RGI+ NNEKTF++WINEEDH R+ISME GG++ +V+ R   GLK +E     +  EF  ++R G++  CP+NLGT +RA VHIK+P LS    F +I E   LQ RGT G  T  VG  FDISN  RLG +E++  + + DGVN +I  EK L K
Sbjct:   48 VAAGYLMTREAISADTSNRRLYPASAEYPDLRKHNNCMASNLTPAIYTKLCDKKTPAGFTVDQCIQTGVDNPGHPFIKTVGMVAGDEECYEVFADLFDPVIKERHNGYDPRTMKHPT----DLDASKIKGGFFDERYVLSSRVRTGRSIRGLSLPPACTRAERREVEKVTADALNGLQGDLSGHYYSLTQMTEKQQQQLIDDHFLFDKPVSPLLTAAGMARDWPDARGIWHNNEKTFLIWINEEDHTRVISMEKGGNMKRVFERFCRGLKEVERLIQEKGWEFMWNERLGYILTCPSNLGTGLRAGVHIKLPLLSKDARFAKILENLRLQKRGTGGVDTAAVGSTFDISNLDRLGKSEVELTQMVIDGVNYLIDCEKRLEK 424          

HSP 2 Score: 246.128 bits (627), Expect = 3.536e-72
Identity = 135/337 (40.06%), Postives = 195/337 (57.86%), Query Frame = 1
Query: 1279 HLTKEIVDKFNTIRTKNGSTLAHCIRNSVYNN-----KAICPRTGDAKCYNCFSEYLDVVIRDYHKVKEPE-VRHPNVNFGDLENLGFQNLDPEGSFIMSTRIRVGRSIDGFNFPPTISKVDRLKLEKTIVDALSSLTGIHGGTYYPLTGMKENVQKQLIEDHFLF-KDDDPVLRDAGGYRDWPSGRGIFHNNEKTFLVWVCEEDHMRIISMQKGGDIAAVFTRLVQGIRQIETKLT-----FAHSKKYGYLTCCPSNLGTTMRASVHLKIPKLSSDKTKLNEVCDRFNLQARGFHGEHTESPEGIYDISNKRRLGLMEIEAATEMAKGVLEMIQIE 2253
            +LT  I  K    +T  G T+  CI+  V N      K +    GD +CY  F++  D VI++ H   +P  ++HP     DL+    +    +  +++S+R+R GRSI G + PP  ++ +R ++EK   DAL+ L G   G YY LT M E  Q+QLI+DHFLF K   P+L  AG  RDWP  RGI+HNNEKTFL+W+ EEDH R+ISM+KGG++  VF R  +G++++E  +      F  +++ GY+  CPSNLGT +RA VH+K+P LS D  +  ++ +   LQ RG  G  T +    +DISN  RLG  E+E    +  GV  +I  E
Sbjct:   88 NLTPAIYTKLCDKKTPAGFTVDQCIQTGVDNPGHPFIKTVGMVAGDEECYEVFADLFDPVIKERHNGYDPRTMKHPT----DLDASKIKGGFFDERYVLSSRVRTGRSIRGLSLPPACTRAERREVEKVTADALNGLQGDLSGHYYSLTQMTEKQQQQLIDDHFLFDKPVSPLLTAAGMARDWPDARGIWHNNEKTFLIWINEEDHTRVISMEKGGNMKRVFERFCRGLKEVERLIQEKGWEFMWNERLGYILTCPSNLGTGLRAGVHIKLPLLSKD-ARFAKILENLRLQKRGTGGVDTAAVGSTFDISNLDRLGKSEVELTQMVIDGVNYLIDCE 419          
BLAST of Taurocyamine kinase vs. Ensembl Xenopus
Match: aldh1l2 (aldehyde dehydrogenase 1 family member L2 [Source:Xenbase;Acc:XB-GENE-5820495])

HSP 1 Score: 266.159 bits (679), Expect = 3.024e-79
Identity = 150/381 (39.37%), Postives = 215/381 (56.43%), Query Frame = 1
Query:   91 IYSAYLRKMEYKSLDEIYDMIYSNSENKSLAKKH-------LTKEIVAKYKNTKSKFGGTLAMCLNTNAYNPRALMCRT-----ADPDCYDVFGDYFNELIKDYHK-VATKEIEHPASDFGDIEHLPFKNMDVDKVYINSTRVRFGRTVKGFAFAPVISKEDRVTLSEQIANALKNLTGELQGNYYGLDNMTKEKQDELIKDHFLY-RDDDQVLRDAGGYRDWPSGRGIFLNNEKTFVVWINEEDHIRIISMEPGGDLPKVYRRLIAGLKGLE-----ENLEFERHKRFGFLTFCPTNLGTTMRASVHIKIPFLSMLPNFKQICEQYSLQARGTYGEHTENVGGVFDISNQRRLGLTEIQAAKEMYDGVNAIIAIEKMLGK 1176
            + + YL   E  S D     +Y  S      +KH       LT  I  K  + K+  G T+  C+ T   NP     +T      D +CY+VF D F+ +IK+ H     + ++HP     D++    K    D+ Y+ S+RVR GR+++G +  P  ++ +R  + +  A+AL  L G+L G+YY L  MT+++Q +LI DHFL+ +    +L  AG  RDWP  RGI+ NNEKTF++WINEEDH R+ISME GG++ +V+ R   GLK +E     +  EF  ++R G++  CP+NLGT +RA VHIK+P LS    F +I E   LQ RGT G  T  VG  FDISN  RLG +E++  + + DGVN +I  EK L K
Sbjct:   69 VAAGYLMTREAISADTSNRRLYPASAEYPDLRKHNNCMASNLTPAIYTKLCDKKTPAGFTVDQCIQTGVDNPGHPFIKTVGMVAGDEECYEVFADLFDPVIKERHNGYDPRTMKHPT----DLDASKIKGGFFDERYVLSSRVRTGRSIRGLSLPPACTRAERREVEKVTADALNGLQGDLSGHYYSLTQMTEKQQQQLIDDHFLFDKPVSPLLTAAGMARDWPDARGIWHNNEKTFLIWINEEDHTRVISMEKGGNMKRVFERFCRGLKEVERLIQEKGWEFMWNERLGYILTCPSNLGTGLRAGVHIKLPLLSKDARFAKILENLRLQKRGTGGVDTAAVGSTFDISNLDRLGKSEVELTQMVIDGVNYLIDCEKRLEK 445          

HSP 2 Score: 246.514 bits (628), Expect = 5.179e-72
Identity = 135/337 (40.06%), Postives = 195/337 (57.86%), Query Frame = 1
Query: 1279 HLTKEIVDKFNTIRTKNGSTLAHCIRNSVYNN-----KAICPRTGDAKCYNCFSEYLDVVIRDYHKVKEPE-VRHPNVNFGDLENLGFQNLDPEGSFIMSTRIRVGRSIDGFNFPPTISKVDRLKLEKTIVDALSSLTGIHGGTYYPLTGMKENVQKQLIEDHFLF-KDDDPVLRDAGGYRDWPSGRGIFHNNEKTFLVWVCEEDHMRIISMQKGGDIAAVFTRLVQGIRQIETKLT-----FAHSKKYGYLTCCPSNLGTTMRASVHLKIPKLSSDKTKLNEVCDRFNLQARGFHGEHTESPEGIYDISNKRRLGLMEIEAATEMAKGVLEMIQIE 2253
            +LT  I  K    +T  G T+  CI+  V N      K +    GD +CY  F++  D VI++ H   +P  ++HP     DL+    +    +  +++S+R+R GRSI G + PP  ++ +R ++EK   DAL+ L G   G YY LT M E  Q+QLI+DHFLF K   P+L  AG  RDWP  RGI+HNNEKTFL+W+ EEDH R+ISM+KGG++  VF R  +G++++E  +      F  +++ GY+  CPSNLGT +RA VH+K+P LS D  +  ++ +   LQ RG  G  T +    +DISN  RLG  E+E    +  GV  +I  E
Sbjct:  109 NLTPAIYTKLCDKKTPAGFTVDQCIQTGVDNPGHPFIKTVGMVAGDEECYEVFADLFDPVIKERHNGYDPRTMKHPT----DLDASKIKGGFFDERYVLSSRVRTGRSIRGLSLPPACTRAERREVEKVTADALNGLQGDLSGHYYSLTQMTEKQQQQLIDDHFLFDKPVSPLLTAAGMARDWPDARGIWHNNEKTFLIWINEEDHTRVISMEKGGNMKRVFERFCRGLKEVERLIQEKGWEFMWNERLGYILTCPSNLGTGLRAGVHIKLPLLSKD-ARFAKILENLRLQKRGTGGVDTAAVGSTFDISNLDRLGKSEVELTQMVIDGVNYLIDCE 440          
BLAST of Taurocyamine kinase vs. Ensembl Xenopus
Match: aldh1l2 (aldehyde dehydrogenase 1 family member L2 [Source:Xenbase;Acc:XB-GENE-5820495])

HSP 1 Score: 261.536 bits (667), Expect = 1.505e-78
Identity = 141/341 (41.35%), Postives = 203/341 (59.53%), Query Frame = 1
Query:  190 HLTKEIVAKYKNTKSKFGGTLAMCLNTNAYNPRALMCRT-----ADPDCYDVFGDYFNELIKDYHK-VATKEIEHPASDFGDIEHLPFKNMDVDKVYINSTRVRFGRTVKGFAFAPVISKEDRVTLSEQIANALKNLTGELQGNYYGLDNMTKEKQDELIKDHFLY-RDDDQVLRDAGGYRDWPSGRGIFLNNEKTFVVWINEEDHIRIISMEPGGDLPKVYRRLIAGLKGLE-----ENLEFERHKRFGFLTFCPTNLGTTMRASVHIKIPFLSMLPNFKQICEQYSLQARGTYGEHTENVGGVFDISNQRRLGLTEIQAAKEMYDGVNAIIAIEKMLGK 1176
            +LT  I  K  + K+  G T+  C+ T   NP     +T      D +CY+VF D F+ +IK+ H     + ++HP     D++    K    D+ Y+ S+RVR GR+++G +  P  ++ +R  + +  A+AL  L G+L G+YY L  MT+++Q +LI DHFL+ +    +L  AG  RDWP  RGI+ NNEKTF++WINEEDH R+ISME GG++ +V+ R   GLK +E     +  EF  ++R G++  CP+NLGT +RA VHIK+P LS    F +I E   LQ RGT G  T  VG  FDISN  RLG +E++  + + DGVN +I  EK L K
Sbjct:   27 NLTPAIYTKLCDKKTPAGFTVDQCIQTGVDNPGHPFIKTVGMVAGDEECYEVFADLFDPVIKERHNGYDPRTMKHPT----DLDASKIKGGFFDERYVLSSRVRTGRSIRGLSLPPACTRAERREVEKVTADALNGLQGDLSGHYYSLTQMTEKQQQQLIDDHFLFDKPVSPLLTAAGMARDWPDARGIWHNNEKTFLIWINEEDHTRVISMEKGGNMKRVFERFCRGLKEVERLIQEKGWEFMWNERLGYILTCPSNLGTGLRAGVHIKLPLLSKDARFAKILENLRLQKRGTGGVDTAAVGSTFDISNLDRLGKSEVELTQMVIDGVNYLIDCEKRLEK 363          

HSP 2 Score: 245.743 bits (626), Expect = 1.101e-72
Identity = 135/337 (40.06%), Postives = 195/337 (57.86%), Query Frame = 1
Query: 1279 HLTKEIVDKFNTIRTKNGSTLAHCIRNSVYNN-----KAICPRTGDAKCYNCFSEYLDVVIRDYHKVKEPE-VRHPNVNFGDLENLGFQNLDPEGSFIMSTRIRVGRSIDGFNFPPTISKVDRLKLEKTIVDALSSLTGIHGGTYYPLTGMKENVQKQLIEDHFLF-KDDDPVLRDAGGYRDWPSGRGIFHNNEKTFLVWVCEEDHMRIISMQKGGDIAAVFTRLVQGIRQIETKLT-----FAHSKKYGYLTCCPSNLGTTMRASVHLKIPKLSSDKTKLNEVCDRFNLQARGFHGEHTESPEGIYDISNKRRLGLMEIEAATEMAKGVLEMIQIE 2253
            +LT  I  K    +T  G T+  CI+  V N      K +    GD +CY  F++  D VI++ H   +P  ++HP     DL+    +    +  +++S+R+R GRSI G + PP  ++ +R ++EK   DAL+ L G   G YY LT M E  Q+QLI+DHFLF K   P+L  AG  RDWP  RGI+HNNEKTFL+W+ EEDH R+ISM+KGG++  VF R  +G++++E  +      F  +++ GY+  CPSNLGT +RA VH+K+P LS D  +  ++ +   LQ RG  G  T +    +DISN  RLG  E+E    +  GV  +I  E
Sbjct:   27 NLTPAIYTKLCDKKTPAGFTVDQCIQTGVDNPGHPFIKTVGMVAGDEECYEVFADLFDPVIKERHNGYDPRTMKHPT----DLDASKIKGGFFDERYVLSSRVRTGRSIRGLSLPPACTRAERREVEKVTADALNGLQGDLSGHYYSLTQMTEKQQQQLIDDHFLFDKPVSPLLTAAGMARDWPDARGIWHNNEKTFLIWINEEDHTRVISMEKGGNMKRVFERFCRGLKEVERLIQEKGWEFMWNERLGYILTCPSNLGTGLRAGVHIKLPLLSKD-ARFAKILENLRLQKRGTGGVDTAAVGSTFDISNLDRLGKSEVELTQMVIDGVNYLIDCE 358          
BLAST of Taurocyamine kinase vs. Ensembl Xenopus
Match: aldh1l2 (aldehyde dehydrogenase 1 family member L2 [Source:Xenbase;Acc:XB-GENE-5820495])

HSP 1 Score: 261.151 bits (666), Expect = 1.983e-78
Identity = 141/341 (41.35%), Postives = 203/341 (59.53%), Query Frame = 1
Query:  190 HLTKEIVAKYKNTKSKFGGTLAMCLNTNAYNPRALMCRT-----ADPDCYDVFGDYFNELIKDYHK-VATKEIEHPASDFGDIEHLPFKNMDVDKVYINSTRVRFGRTVKGFAFAPVISKEDRVTLSEQIANALKNLTGELQGNYYGLDNMTKEKQDELIKDHFLY-RDDDQVLRDAGGYRDWPSGRGIFLNNEKTFVVWINEEDHIRIISMEPGGDLPKVYRRLIAGLKGLE-----ENLEFERHKRFGFLTFCPTNLGTTMRASVHIKIPFLSMLPNFKQICEQYSLQARGTYGEHTENVGGVFDISNQRRLGLTEIQAAKEMYDGVNAIIAIEKMLGK 1176
            +LT  I  K  + K+  G T+  C+ T   NP     +T      D +CY+VF D F+ +IK+ H     + ++HP     D++    K    D+ Y+ S+RVR GR+++G +  P  ++ +R  + +  A+AL  L G+L G+YY L  MT+++Q +LI DHFL+ +    +L  AG  RDWP  RGI+ NNEKTF++WINEEDH R+ISME GG++ +V+ R   GLK +E     +  EF  ++R G++  CP+NLGT +RA VHIK+P LS    F +I E   LQ RGT G  T  VG  FDISN  RLG +E++  + + DGVN +I  EK L K
Sbjct:   29 NLTPAIYTKLCDKKTPAGFTVDQCIQTGVDNPGHPFIKTVGMVAGDEECYEVFADLFDPVIKERHNGYDPRTMKHPT----DLDASKIKGGFFDERYVLSSRVRTGRSIRGLSLPPACTRAERREVEKVTADALNGLQGDLSGHYYSLTQMTEKQQQQLIDDHFLFDKPVSPLLTAAGMARDWPDARGIWHNNEKTFLIWINEEDHTRVISMEKGGNMKRVFERFCRGLKEVERLIQEKGWEFMWNERLGYILTCPSNLGTGLRAGVHIKLPLLSKDARFAKILENLRLQKRGTGGVDTAAVGSTFDISNLDRLGKSEVELTQMVIDGVNYLIDCEKRLEK 365          

HSP 2 Score: 245.743 bits (626), Expect = 9.512e-73
Identity = 135/337 (40.06%), Postives = 195/337 (57.86%), Query Frame = 1
Query: 1279 HLTKEIVDKFNTIRTKNGSTLAHCIRNSVYNN-----KAICPRTGDAKCYNCFSEYLDVVIRDYHKVKEPE-VRHPNVNFGDLENLGFQNLDPEGSFIMSTRIRVGRSIDGFNFPPTISKVDRLKLEKTIVDALSSLTGIHGGTYYPLTGMKENVQKQLIEDHFLF-KDDDPVLRDAGGYRDWPSGRGIFHNNEKTFLVWVCEEDHMRIISMQKGGDIAAVFTRLVQGIRQIETKLT-----FAHSKKYGYLTCCPSNLGTTMRASVHLKIPKLSSDKTKLNEVCDRFNLQARGFHGEHTESPEGIYDISNKRRLGLMEIEAATEMAKGVLEMIQIE 2253
            +LT  I  K    +T  G T+  CI+  V N      K +    GD +CY  F++  D VI++ H   +P  ++HP     DL+    +    +  +++S+R+R GRSI G + PP  ++ +R ++EK   DAL+ L G   G YY LT M E  Q+QLI+DHFLF K   P+L  AG  RDWP  RGI+HNNEKTFL+W+ EEDH R+ISM+KGG++  VF R  +G++++E  +      F  +++ GY+  CPSNLGT +RA VH+K+P LS D  +  ++ +   LQ RG  G  T +    +DISN  RLG  E+E    +  GV  +I  E
Sbjct:   29 NLTPAIYTKLCDKKTPAGFTVDQCIQTGVDNPGHPFIKTVGMVAGDEECYEVFADLFDPVIKERHNGYDPRTMKHPT----DLDASKIKGGFFDERYVLSSRVRTGRSIRGLSLPPACTRAERREVEKVTADALNGLQGDLSGHYYSLTQMTEKQQQQLIDDHFLFDKPVSPLLTAAGMARDWPDARGIWHNNEKTFLIWINEEDHTRVISMEKGGNMKRVFERFCRGLKEVERLIQEKGWEFMWNERLGYILTCPSNLGTGLRAGVHIKLPLLSKD-ARFAKILENLRLQKRGTGGVDTAAVGSTFDISNLDRLGKSEVELTQMVIDGVNYLIDCE 360          
BLAST of Taurocyamine kinase vs. Ensembl Mouse
Match: Ckb (creatine kinase, brain [Source:MGI Symbol;Acc:MGI:88407])

HSP 1 Score: 251.906 bits (642), Expect = 4.915e-75
Identity = 144/345 (41.74%), Postives = 200/345 (57.97%), Query Frame = 1
Query: 1255 SNDTITKKHLTKEIVDKFNTIRTKNGSTLAHCIRNSVYNN-----KAICPRTGDAKCYNCFSEYLDVVIRDYHKVKEPEVRH-PNVNFGDLENLGFQNLDPEGSFIMSTRIRVGRSIDGFNFPPTISKVDRLKLEKTIVDALSSLTGIHGGTYYPLTGMKENVQKQLIEDHFLF-KDDDPVLRDAGGYRDWPSGRGIFHNNEKTFLVWVCEEDHMRIISMQKGGDIAAVFTRLVQGIRQIET-----KLTFAHSKKYGYLTCCPSNLGTTMRASVHLKIPKLSSDKTKLNEVCDRFNLQARGFHGEHTESPEGIYDISNKRRLGLMEIEAATEMAKGVLEMIQIE 2253
            S++    K LT E+  +     T +G TL   I+  V N        +    GD + Y+ F +  D +I + H   +P   H  ++N  +L+  G  +LDP  ++++S+R+R GRSI GF  PP  S+ +R  +EK  V+ALSSL G   G YY L  M E  Q+QLI+DHFLF K   P+L  +G  RDWP  RGI+HN+ KTFLVW+ EEDH+R+ISMQKGG++  VFTR   G+ QIET        F  +   GY+  CPSNLGT +RA VH+K+P L   + K +EV  R  LQ RG  G  T +  G++D+SN  RLG  E+E    +  GV  +I++E
Sbjct:   25 SHNNHMAKVLTPELYAELRAKCTPSGFTLDDAIQTGVDNPGHPYIMTVGAVAGDEESYDVFKDLFDPIIEERHGGYQPSDEHKTDLNPDNLQ--GGDDLDP--NYVLSSRVRTGRSIRGFCLPPHCSRGERRAIEKLAVEALSSLDGDLSGRYYALKSMTEAEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKTFLVWINEEDHLRVISMQKGGNMKEVFTRFCTGLTQIETLFKSKNYEFMWNPHLGYILTCPSNLGTGLRAGVHIKLPHLGKHE-KFSEVLKRLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEVELVQMVVDGVKLLIEME 364          

HSP 2 Score: 243.817 bits (621), Expect = 3.867e-72
Identity = 139/365 (38.08%), Postives = 213/365 (58.36%), Query Frame = 1
Query:  109 RKMEYKSLDEIYDMIYSNSENKSLAKKHLTKEIVAKYKNTKSKFGGTLAMCLNTNAYNP-----RALMCRTADPDCYDVFGDYFNELIKDYHKVATKEIEHPASDFGDIEHLPFKNMDVDKVYINSTRVRFGRTVKGFAFAPVISKEDRVTLSEQIANALKNLTGELQGNYYGLDNMTKEKQDELIKDHFLY-RDDDQVLRDAGGYRDWPSGRGIFLNNEKTFVVWINEEDHIRIISMEPGGDLPKVYRRLIAGLKGLE-----ENLEFERHKRFGFLTFCPTNLGTTMRASVHIKIPFLSMLPNFKQICEQYSLQARGTYGEHTENVGGVFDISNQRRLGLTEIQAAKEMYDGVNAIIAIEKML 1170
            +K+ + + DE  D+   +S N  +AK  LT E+ A+ +   +  G TL   + T   NP       +     D + YDVF D F+ +I++ H       EH  +D  + ++L   + D+D  Y+ S+RVR GR+++GF   P  S+ +R  + +    AL +L G+L G YY L +MT+ +Q +LI DHFL+ +    +L  +G  RDWP  RGI+ N+ KTF+VWINEEDH+R+ISM+ GG++ +V+ R   GL  +E     +N EF  +   G++  CP+NLGT +RA VHIK+P L     F ++ ++  LQ RGT G  T  VGGVFD+SN  RLG +E++  + + DGV  +I +E+ L
Sbjct:   10 QKLRFPAEDEFPDL---SSHNNHMAKV-LTPELYAELRAKCTPSGFTLDDAIQTGVDNPGHPYIMTVGAVAGDEESYDVFKDLFDPIIEERHGGYQPSDEH-KTDL-NPDNLQGGD-DLDPNYVLSSRVRTGRSIRGFCLPPHCSRGERRAIEKLAVEALSSLDGDLSGRYYALKSMTEAEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKTFLVWINEEDHLRVISMQKGGNMKEVFTRFCTGLTQIETLFKSKNYEFMWNPHLGYILTCPSNLGTGLRAGVHIKLPHLGKHEKFSEVLKRLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEVELVQMVVDGVKLLIEMEQRL 367          
BLAST of Taurocyamine kinase vs. Ensembl Mouse
Match: Ckm (creatine kinase, muscle [Source:MGI Symbol;Acc:MGI:88413])

HSP 1 Score: 246.514 bits (628), Expect = 3.980e-73
Identity = 140/367 (38.15%), Postives = 213/367 (58.04%), Query Frame = 1
Query:  112 KMEYKSLDEIYDMIYSNSENKSLAKKHLTKEIVAKYKNTKSKFGGTLAMCLNTNAYNP-----RALMCRTADPDCYDVFGDYFNELIKDYHKVATKEIEHPASDFGDIEHLPFKNMD-VDKVYINSTRVRFGRTVKGFAFAPVISKEDRVTLSEQIANALKNLTGELQGNYYGLDNMTKEKQDELIKDHFLY-RDDDQVLRDAGGYRDWPSGRGIFLNNEKTFVVWINEEDHIRIISMEPGGDLPKVYRRLIAGLKGLEENLE-----FERHKRFGFLTFCPTNLGTTMRASVHIKIPFLSMLPNFKQICEQYSLQARGTYGEHTENVGGVFDISNQRRLGLTEIQAAKEMYDGVNAIIAIEKMLGK 1176
            K+ YK  +E  D+   +  N  +AK  LT ++  K ++ ++  G TL   + T   NP       + C   D + Y VF D F+ +I+D H       +H      D+ H   K  D +D  Y+ S+RVR GR++KG+   P  S+ +R  + +    AL +LTGE +G YY L +MT+++Q +LI DHFL+ +    +L  +G  RDWP  RGI+ N+ K+F+VW+NEEDH+R+ISME GG++ +V+RR   GL+ +EE  +     F  ++  G++  CP+NLGT +R  VH+K+  LS  P F++I  +  LQ RGT G  T  VG VFDISN  RLG +E++  + + DGV  ++ +EK L K
Sbjct:   11 KLNYKPQEEYPDL---SKHNNHMAKV-LTPDLYNKLRDKETPSGFTLDDVIQTGVDNPGHPFIMTVGCVAGDEESYTVFKDLFDPIIQDRHGGYKPTDKHKT----DLNHENLKGGDDLDPNYVLSSRVRTGRSIKGYTLPPHCSRGERRAVEKLSVEALNSLTGEFKGKYYPLKSMTEQEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKSFLVWVNEEDHLRVISMEKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNEHLGYVLTCPSNLGTGLRGGVHVKLANLSKHPKFEEILTRLRLQKRGTGGVDTAAVGAVFDISNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEK 369          

HSP 2 Score: 243.047 bits (619), Expect = 8.647e-72
Identity = 138/338 (40.83%), Postives = 197/338 (58.28%), Query Frame = 1
Query: 1276 KHLTKEIVDKFNTIRTKNGSTLAHCIRNSVYNN-----KAICPRTGDAKCYNCFSEYLDVVIRDYHKVKEPEVRHP-NVNFGDLENLGFQNLDPEGSFIMSTRIRVGRSIDGFNFPPTISKVDRLKLEKTIVDALSSLTGIHGGTYYPLTGMKENVQKQLIEDHFLF-KDDDPVLRDAGGYRDWPSGRGIFHNNEKTFLVWVCEEDHMRIISMQKGGDIAAVFTRLVQGIRQIETKL-----TFAHSKKYGYLTCCPSNLGTTMRASVHLKIPKLSSDKTKLNEVCDRFNLQARGFHGEHTESPEGIYDISNKRRLGLMEIEAATEMAKGVLEMIQIE 2253
            K LT ++ +K     T +G TL   I+  V N        +    GD + Y  F +  D +I+D H   +P  +H  ++N  +L+  G  +LDP  ++++S+R+R GRSI G+  PP  S+ +R  +EK  V+AL+SLTG   G YYPL  M E  Q+QLI+DHFLF K   P+L  +G  RDWP  RGI+HN+ K+FLVWV EEDH+R+ISM+KGG++  VF R   G+++IE         F  ++  GY+  CPSNLGT +R  VH+K+  LS    K  E+  R  LQ RG  G  T +   ++DISN  RLG  E+E    +  GV  M+++E
Sbjct:   32 KVLTPDLYNKLRDKETPSGFTLDDVIQTGVDNPGHPFIMTVGCVAGDEESYTVFKDLFDPIIQDRHGGYKPTDKHKTDLNHENLK--GGDDLDP--NYVLSSRVRTGRSIKGYTLPPHCSRGERRAVEKLSVEALNSLTGEFKGKYYPLKSMTEQEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKSFLVWVNEEDHLRVISMEKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNEHLGYVLTCPSNLGTGLRGGVHVKLANLSK-HPKFEEILTRLRLQKRGTGGVDTAAVGAVFDISNADRLGSSEVEQVQLVVDGVKLMVEME 364          
BLAST of Taurocyamine kinase vs. Ensembl Mouse
Match: Ckmt2 (creatine kinase, mitochondrial 2 [Source:MGI Symbol;Acc:MGI:1923972])

HSP 1 Score: 246.128 bits (627), Expect = 1.642e-72
Identity = 138/339 (40.71%), Postives = 194/339 (57.23%), Query Frame = 1
Query:  193 LTKEIVAKYKNTKSKFGGTLAMCLNTNAYNPRALMCRT-----ADPDCYDVFGDYFNELIKDYHK-VATKEIEHPAS-DFGDIEHLPFKNMDVDKVYINSTRVRFGRTVKGFAFAPVISKEDRVTLSEQIANALKNLTGELQGNYYGLDNMTKEKQDELIKDHFLY-RDDDQVLRDAGGYRDWPSGRGIFLNNEKTFVVWINEEDHIRIISMEPGGDLPKVYRRLIAGLKGLEE-----NLEFERHKRFGFLTFCPTNLGTTMRASVHIKIPFLSMLPNFKQICEQYSLQARGTYGEHTENVGGVFDISNQRRLGLTEIQAAKEMYDGVNAIIAIEKML 1170
            LT  I AK +N  +  G TL  C+ T   NP     +T      D + Y+VF D F+ +IK  H     + ++HP   D   I H  F     D+ Y+ S+RVR GR+++G +  P  S+ +R  +      AL+ L G+L G YY L  MT++ Q  LI DHFL+ +    +L  AG  RDWP  RGI+ N +KTF++WINEEDH R+ISME GG++ +V+ R   GLK +E        EF  ++R G++  CP+NLGT +RA VH++IP LS  P F +I E   LQ RGT G  T  V  V+DISN  R+G +E++  + + DGVN ++  EK L
Sbjct:   68 LTPTIYAKLRNKMTPSGYTLDQCIQTGVDNPGHPFIKTVGMVAGDEESYEVFADLFDPVIKLRHNGYDPRVMKHPTDLDASKITHGQF-----DERYVLSSRVRTGRSIRGLSLPPACSRAERREVENVAITALEGLKGDLAGRYYKLSEMTEQDQQRLIDDHFLFDKPVSPLLTCAGMARDWPDARGIWHNYDKTFLIWINEEDHTRVISMEKGGNMKRVFERFCRGLKEVERLIQERGWEFMWNERLGYILTCPSNLGTGLRAGVHVRIPKLSKDPRFSKILENLRLQKRGTGGVDTAAVADVYDISNIDRIGRSEVELVQIVIDGVNYLVDCEKKL 401          

HSP 2 Score: 236.498 bits (602), Expect = 6.150e-69
Identity = 131/336 (38.99%), Postives = 192/336 (57.14%), Query Frame = 1
Query: 1282 LTKEIVDKFNTIRTKNGSTLAHCIRNSVYNN-----KAICPRTGDAKCYNCFSEYLDVVIRDYHKVKEPEV-RHPNVNFGDLENLGFQNLDPEGSFIMSTRIRVGRSIDGFNFPPTISKVDRLKLEKTIVDALSSLTGIHGGTYYPLTGMKENVQKQLIEDHFLF-KDDDPVLRDAGGYRDWPSGRGIFHNNEKTFLVWVCEEDHMRIISMQKGGDIAAVFTRLVQGIRQIETKLT-----FAHSKKYGYLTCCPSNLGTTMRASVHLKIPKLSSDKTKLNEVCDRFNLQARGFHGEHTESPEGIYDISNKRRLGLMEIEAATEMAKGVLEMIQIE 2253
            LT  I  K     T +G TL  CI+  V N      K +    GD + Y  F++  D VI+  H   +P V +HP     DL+     +   +  +++S+R+R GRSI G + PP  S+ +R ++E   + AL  L G   G YY L+ M E  Q++LI+DHFLF K   P+L  AG  RDWP  RGI+HN +KTFL+W+ EEDH R+ISM+KGG++  VF R  +G++++E  +      F  +++ GY+  CPSNLGT +RA VH++IPKLS D  + +++ +   LQ RG  G  T +   +YDISN  R+G  E+E    +  GV  ++  E
Sbjct:   68 LTPTIYAKLRNKMTPSGYTLDQCIQTGVDNPGHPFIKTVGMVAGDEESYEVFADLFDPVIKLRHNGYDPRVMKHPT----DLDASKITHGQFDERYVLSSRVRTGRSIRGLSLPPACSRAERREVENVAITALEGLKGDLAGRYYKLSEMTEQDQQRLIDDHFLFDKPVSPLLTCAGMARDWPDARGIWHNYDKTFLIWINEEDHTRVISMEKGGNMKRVFERFCRGLKEVERLIQERGWEFMWNERLGYILTCPSNLGTGLRAGVHVRIPKLSKD-PRFSKILENLRLQKRGTGGVDTAAVADVYDISNIDRIGRSEVELVQIVIDGVNYLVDCE 398          
BLAST of Taurocyamine kinase vs. Ensembl Mouse
Match: Ckmt1 (creatine kinase, mitochondrial 1, ubiquitous [Source:MGI Symbol;Acc:MGI:99441])

HSP 1 Score: 241.506 bits (615), Expect = 7.989e-71
Identity = 131/339 (38.64%), Postives = 198/339 (58.41%), Query Frame = 1
Query:  190 HLTKEIVAKYKNTKSKFGGTLAMCLNTNAYNPRALMCRT-----ADPDCYDVFGDYFNELIKDYHK-VATKEIEHPASDFGDIEHLPFKNMDVDKVYINSTRVRFGRTVKGFAFAPVISKEDRVTLSEQIANALKNLTGELQGNYYGLDNMTKEKQDELIKDHFLY-RDDDQVLRDAGGYRDWPSGRGIFLNNEKTFVVWINEEDHIRIISMEPGGDLPKVYRRLIAGLKGLEE-----NLEFERHKRFGFLTFCPTNLGTTMRASVHIKIPFLSMLPNFKQICEQYSLQARGTYGEHTENVGGVFDISNQRRLGLTEIQAAKEMYDGVNAIIAIEKML 1170
            HLT  + A+  +  +  G TL  C+ T   NP     +T      D + Y+VF + F+ +I++ H     + ++H      D++    ++   D+ Y+ S+RVR GR+++G +  P  ++ +R  +   + +AL  L G+L G YY L  MT+ +Q +LI DHFL+ +    +L  AG  RDWP  RGI+ NNEK+F++W+NEEDH R+ISME GG++ +V+ R   GLK +E+       EF  ++R G++  CP+NLGT +RA VHIK+P LS    F +I E   LQ RGT G  T   G VFDISN  RLG +E++  + + DGVN +I  E+ L
Sbjct:   67 HLTPAVYARLCDKTTPTGWTLDQCIQTGVDNPGHPFIKTVGMVAGDEETYEVFAELFDPVIQERHNGYDPRTMKHTT----DLDASKIRSGYFDERYVLSSRVRTGRSIRGLSLPPACTRAERREVERVVVDALSGLKGDLAGRYYRLSEMTEAEQQQLIDDHFLFDKPVSPLLTAAGMARDWPDARGIWHNNEKSFLIWVNEEDHTRVISMEKGGNMKRVFERFCRGLKEVEKLIQERGWEFMWNERLGYILTCPSNLGTGLRAGVHIKLPLLSKDNRFPKILENLRLQKRGTGGVDTAATGSVFDISNLDRLGKSEVELVQLVIDGVNYLIDCERRL 401          

HSP 2 Score: 232.261 bits (591), Expect = 2.294e-67
Identity = 134/337 (39.76%), Postives = 196/337 (58.16%), Query Frame = 1
Query: 1279 HLTKEIVDKFNTIRTKNGSTLAHCIRNSVYNN-----KAICPRTGDAKCYNCFSEYLDVVIRDYHKVKEPE-VRHPNVNFGDLENLGFQNLDPEGSFIMSTRIRVGRSIDGFNFPPTISKVDRLKLEKTIVDALSSLTGIHGGTYYPLTGMKENVQKQLIEDHFLF-KDDDPVLRDAGGYRDWPSGRGIFHNNEKTFLVWVCEEDHMRIISMQKGGDIAAVFTRLVQGIRQIETKLT-----FAHSKKYGYLTCCPSNLGTTMRASVHLKIPKLSSDKTKLNEVCDRFNLQARGFHGEHTESPEGIYDISNKRRLGLMEIEAATEMAKGVLEMIQIE 2253
            HLT  +  +     T  G TL  CI+  V N      K +    GD + Y  F+E  D VI++ H   +P  ++H      DL+    ++   +  +++S+R+R GRSI G + PP  ++ +R ++E+ +VDALS L G   G YY L+ M E  Q+QLI+DHFLF K   P+L  AG  RDWP  RGI+HNNEK+FL+WV EEDH R+ISM+KGG++  VF R  +G++++E  +      F  +++ GY+  CPSNLGT +RA VH+K+P LS D  +  ++ +   LQ RG  G  T +   ++DISN  RLG  E+E    +  GV  +I  E
Sbjct:   67 HLTPAVYARLCDKTTPTGWTLDQCIQTGVDNPGHPFIKTVGMVAGDEETYEVFAELFDPVIQERHNGYDPRTMKHTT----DLDASKIRSGYFDERYVLSSRVRTGRSIRGLSLPPACTRAERREVERVVVDALSGLKGDLAGRYYRLSEMTEAEQQQLIDDHFLFDKPVSPLLTAAGMARDWPDARGIWHNNEKSFLIWVNEEDHTRVISMEKGGNMKRVFERFCRGLKEVEKLIQERGWEFMWNERLGYILTCPSNLGTGLRAGVHIKLPLLSKD-NRFPKILENLRLQKRGTGGVDTAATGSVFDISNLDRLGKSEVELVQLVIDGVNYLIDCE 398          
BLAST of Taurocyamine kinase vs. Ensembl Mouse
Match: Ckmt1 (creatine kinase, mitochondrial 1, ubiquitous [Source:MGI Symbol;Acc:MGI:99441])

HSP 1 Score: 241.506 bits (615), Expect = 7.989e-71
Identity = 131/339 (38.64%), Postives = 198/339 (58.41%), Query Frame = 1
Query:  190 HLTKEIVAKYKNTKSKFGGTLAMCLNTNAYNPRALMCRT-----ADPDCYDVFGDYFNELIKDYHK-VATKEIEHPASDFGDIEHLPFKNMDVDKVYINSTRVRFGRTVKGFAFAPVISKEDRVTLSEQIANALKNLTGELQGNYYGLDNMTKEKQDELIKDHFLY-RDDDQVLRDAGGYRDWPSGRGIFLNNEKTFVVWINEEDHIRIISMEPGGDLPKVYRRLIAGLKGLEE-----NLEFERHKRFGFLTFCPTNLGTTMRASVHIKIPFLSMLPNFKQICEQYSLQARGTYGEHTENVGGVFDISNQRRLGLTEIQAAKEMYDGVNAIIAIEKML 1170
            HLT  + A+  +  +  G TL  C+ T   NP     +T      D + Y+VF + F+ +I++ H     + ++H      D++    ++   D+ Y+ S+RVR GR+++G +  P  ++ +R  +   + +AL  L G+L G YY L  MT+ +Q +LI DHFL+ +    +L  AG  RDWP  RGI+ NNEK+F++W+NEEDH R+ISME GG++ +V+ R   GLK +E+       EF  ++R G++  CP+NLGT +RA VHIK+P LS    F +I E   LQ RGT G  T   G VFDISN  RLG +E++  + + DGVN +I  E+ L
Sbjct:   67 HLTPAVYARLCDKTTPTGWTLDQCIQTGVDNPGHPFIKTVGMVAGDEETYEVFAELFDPVIQERHNGYDPRTMKHTT----DLDASKIRSGYFDERYVLSSRVRTGRSIRGLSLPPACTRAERREVERVVVDALSGLKGDLAGRYYRLSEMTEAEQQQLIDDHFLFDKPVSPLLTAAGMARDWPDARGIWHNNEKSFLIWVNEEDHTRVISMEKGGNMKRVFERFCRGLKEVEKLIQERGWEFMWNERLGYILTCPSNLGTGLRAGVHIKLPLLSKDNRFPKILENLRLQKRGTGGVDTAATGSVFDISNLDRLGKSEVELVQLVIDGVNYLIDCERRL 401          

HSP 2 Score: 232.261 bits (591), Expect = 2.294e-67
Identity = 134/337 (39.76%), Postives = 196/337 (58.16%), Query Frame = 1
Query: 1279 HLTKEIVDKFNTIRTKNGSTLAHCIRNSVYNN-----KAICPRTGDAKCYNCFSEYLDVVIRDYHKVKEPE-VRHPNVNFGDLENLGFQNLDPEGSFIMSTRIRVGRSIDGFNFPPTISKVDRLKLEKTIVDALSSLTGIHGGTYYPLTGMKENVQKQLIEDHFLF-KDDDPVLRDAGGYRDWPSGRGIFHNNEKTFLVWVCEEDHMRIISMQKGGDIAAVFTRLVQGIRQIETKLT-----FAHSKKYGYLTCCPSNLGTTMRASVHLKIPKLSSDKTKLNEVCDRFNLQARGFHGEHTESPEGIYDISNKRRLGLMEIEAATEMAKGVLEMIQIE 2253
            HLT  +  +     T  G TL  CI+  V N      K +    GD + Y  F+E  D VI++ H   +P  ++H      DL+    ++   +  +++S+R+R GRSI G + PP  ++ +R ++E+ +VDALS L G   G YY L+ M E  Q+QLI+DHFLF K   P+L  AG  RDWP  RGI+HNNEK+FL+WV EEDH R+ISM+KGG++  VF R  +G++++E  +      F  +++ GY+  CPSNLGT +RA VH+K+P LS D  +  ++ +   LQ RG  G  T +   ++DISN  RLG  E+E    +  GV  +I  E
Sbjct:   67 HLTPAVYARLCDKTTPTGWTLDQCIQTGVDNPGHPFIKTVGMVAGDEETYEVFAELFDPVIQERHNGYDPRTMKHTT----DLDASKIRSGYFDERYVLSSRVRTGRSIRGLSLPPACTRAERREVERVVVDALSGLKGDLAGRYYRLSEMTEAEQQQLIDDHFLFDKPVSPLLTAAGMARDWPDARGIWHNNEKSFLIWVNEEDHTRVISMEKGGNMKRVFERFCRGLKEVEKLIQERGWEFMWNERLGYILTCPSNLGTGLRAGVHIKLPLLSKD-NRFPKILENLRLQKRGTGGVDTAATGSVFDISNLDRLGKSEVELVQLVIDGVNYLIDCE 398          
BLAST of Taurocyamine kinase vs. UniProt/SwissProt
Match: sp|P16641|KTRC_SCHMA (Taurocyamine kinase OS=Schistosoma mansoni OX=6183 GN=Smp_194770 PE=1 SV=3)

HSP 1 Score: 927.546 bits (2396), Expect = 0.000e+0
Identity = 430/733 (58.66%), Postives = 561/733 (76.53%), Query Frame = 1
Query:   55 IHILKLFLRFPKIYSAYLRKMEYKSLDEIYDMIYSNSENKSLAKKHLTKEIVAKYKNTKSKFGGTLAMCLNTNAYNPRALMCRTADPDCYDVFGDYFNELIKDYHKVATKEIEHPASDFGDIEHLPFKNMDVDKVYINSTRVRFGRTVKGFAFAPVISKEDRVTLSEQIANALKNLTGELQGNYYGLDNMTKEKQDELIKDHFLYRDDDQVLRDAGGYRDWPSGRGIFLNNEKTFVVWINEEDHIRIISMEPGGDLPKVYRRLIAGLKGLEENLEFERHKRFGFLTFCPTNLGTTMRASVHIKIPFLSMLPNFKQICEQYSLQARGTYGEHTENVGGVFDISNQRRLGLTEIQAAKEMYDGVNAIIAIEKMLGKYNKTAPEGIPYVESLEYLAKIIWNDPSNDTITKKHLTKEIVDKFNTIRTKNGSTLAHCIRNSVYNNKAICPRTGDAKCYNCFSEYLDVVIRDYHKVKEPEVRHPNVNFGDLENLGFQNLDPEGSFIMSTRIRVGRSIDGFNFPPTISKVDRLKLEKTIVDALSSLTGIHGGTYYPLTGMKENVQKQLIEDHFLFKDDDPVLRDAGGYRDWPSGRGIFHNNEKTFLVWVCEEDHMRIISMQKGGDIAAVFTRLVQGIRQIETKLTFAHSKKYGYLTCCPSNLGTTMRASVHLKIPKLSSDKTKLNEVCDRFNLQARGFHGEHTESPEGIYDISNKRRLGLMEIEAATEMAKGVLEMIQIE 2253
            +  +++ +   +I S    +M+ +SL  +   I ++  N SL KK+LT +IV KY+ TK+  GGTLA C+NTNAYNP AL+ R+ D + Y+ F D+F+ +I DYHKV   +I+HP S+FGD++ L F +++     + STRVR GRTV+GF F P ++KE R+ L  +I+ AL NL+GE +G YY L  M++E + +L+ DHFL+R+DD VLRDAGGY DWP+GRGIF+N +K F+VWINEEDHIR+ISM+ GGDL  VY+RL   ++ L ++L+F  + R GF+TFCP+NLGTT+RASVH KIP L+ LPNFK+ICE++ +Q RGT+GEHTE+VGG++D+SN+RRLGLTE+ A  EM+ GV A++ +E ML +YNK APEG+  VE L YLAK++         T+K+LT EI+ K++  RT +G+TLAH IRN  YNN++ICPRTG+A+CY+ F +YLD +I DYH VK+   +HP   FGDL  L F +LDP G FI+STR+RVGRS++ F FP  +SK DR+KLE+ I  AL  LTG H GTYYPLT MKE  +KQL+EDHFLFK+DDPVLRDAGGYRDWP GRGIFHNN KTFLVWVCEEDHMRIISMQ+GG++AAV+ RL++GI  I   + FAHS KYGY+TCCPSNLGT+MRASV LKIPKLSS   KL+E+C ++ LQARG +GEHTESP+G YDISNKRRLGL E++AA EMA+GV +MI+IE
Sbjct:   11 VRFIQVVIDTREIRSLCTIRMQVESLQNLQAKIRNDERNHSLTKKYLTDDIVKKYQATKTSLGGTLAQCVNTNAYNPGALLPRSCDLNAYETFRDFFDAVIADYHKVPDGKIQHPKSNFGDLKSLSFTDLNTYGNLVVSTRVRLGRTVEGFGFGPTLTKETRIELENKISTALHNLSGEYEGTYYPLTGMSEEDRIKLVNDHFLFRNDDNVLRDAGGYIDWPTGRGIFINKQKNFLVWINEEDHIRVISMQKGGDLIAVYKRLADAIQELSKSLKFAFNDRLGFITFCPSNLGTTLRASVHAKIPMLASLPNFKEICEKHGIQPRGTHGEHTESVGGIYDLSNKRRLGLTELDAVTEMHSGVRALLELEVMLQEYNKGAPEGVMPVEPLTYLAKLLEGASIEKCYTRKYLTPEIIKKYDGKRTTHGATLAHMIRNGAYNNRSICPRTGEAECYSTFIDYLDPLICDYHGVKDSAFKHPAPTFGDLSKLPFGDLDPTGKFIVSTRVRVGRSVEDFLFPTIMSKTDRIKLEQVISGALKGLTGEHAGTYYPLTDMKEEDRKQLVEDHFLFKNDDPVLRDAGGYRDWPVGRGIFHNNSKTFLVWVCEEDHMRIISMQQGGNLAAVYKRLIEGINAIGKSMKFAHSDKYGYITCCPSNLGTSMRASVLLKIPKLSSQPKKLDEICAKYMLQARGLYGEHTESPDGTYDISNKRRLGLTELQAAHEMAEGVAKMIEIE 743          

HSP 2 Score: 372.859 bits (956), Expect = 3.521e-115
Identity = 179/353 (50.71%), Postives = 242/353 (68.56%), Query Frame = 1
Query:  115 MEYKSLDEIYDMIYSNSENKSLAKKHLTKEIVAKYKNTKSKFGGTLAMCLNTNAYNPRALMCRTADPDCYDVFGDYFNELIKDYHKVATKEIEHPASDFGDIEHLPFKNMDVDKVYINSTRVRFGRTVKGFAFAPVISKEDRVTLSEQIANALKNLTGELQGNYYGLDNMTKEKQDELIKDHFLYRDDDQVLRDAGGYRDWPSGRGIFLNNEKTFVVWINEEDHIRIISMEPGGDLPKVYRRLIAGLKGLEENLEFERHKRFGFLTFCPTNLGTTMRASVHIKIPFLSMLPN-FKQICEQYSLQARGTYGEHTENVGGVFDISNQRRLGLTEIQAAKEMYDGVNAIIAIEKML 1170
            M  + L  +  ++   S  K   +K+LT EI+ KY   ++  G TLA  +   AYN R++  RT + +CY  F DY + LI DYH V     +HPA  FGD+  LPF ++D    +I STRVR GR+V+ F F  ++SK DR+ L + I+ ALK LTGE  G YY L +M +E + +L++DHFL+++DD VLRDAGGYRDWP GRGIF NN KTF+VW+ EEDH+RIISM+ GG+L  VY+RLI G+  + ++++F    ++G++T CP+NLGT+MRASV +KIP LS  P    +IC +Y LQARG YGEHTE+  G +DISN+RRLGLTE+QAA EM +GV  +I IEK L
Sbjct:  394 MPVEPLTYLAKLLEGASIEKCYTRKYLTPEIIKKYDGKRTTHGATLAHMIRNGAYNNRSICPRTGEAECYSTFIDYLDPLICDYHGVKDSAFKHPAPTFGDLSKLPFGDLDPTGKFIVSTRVRVGRSVEDFLFPTIMSKTDRIKLEQVISGALKGLTGEHAGTYYPLTDMKEEDRKQLVEDHFLFKNDDPVLRDAGGYRDWPVGRGIFHNNSKTFLVWVCEEDHMRIISMQQGGNLAAVYKRLIEGINAIGKSMKFAHSDKYGYITCCPSNLGTSMRASVLLKIPKLSSQPKKLDEICAKYMLQARGLYGEHTESPDGTYDISNKRRLGLTELQAAHEMAEGVAKMIEIEKGL 746          
BLAST of Taurocyamine kinase vs. UniProt/SwissProt
Match: sp|O15992|KARG_ANTJA (Arginine kinase OS=Anthopleura japonica OX=67755 PE=1 SV=1)

HSP 1 Score: 604.749 bits (1558), Expect = 0.000e+0
Identity = 305/703 (43.39%), Postives = 445/703 (63.30%), Query Frame = 1
Query:  172 KSLAKKHLTKEIVAKYKNTKSKFGGTLAMCLNTNAYN-PRALMCRTADPDCYDVFGDYFNELIKDYHKVATKEIEHPASDFGDIEHLPFKNMDVDKVYINSTRVRFGRTVKGFAFAPVISKEDRVTLSEQIANALKNLTGELQGNYYGLDNMTKEKQDELIKDHFLYRDDDQVLRDAGGYRDWPSGRGIFLNNEKTFVVWINEEDHIRIISMEPGGDLPKVYRRLIAGLKGLEENLEFERHKRFGFLTFCPTNLGTTMRASVHIKIPFLSMLPNFKQICEQYSLQARGTYGEHTENVG---GVFDISNQRRLGLTEIQAAKEMYDGVNAIIAIEK-MLGKYNKTAPEGIPYVESLEYLAKIIWNDPSNDTITKKHLTKEIVDKFNTIRTKNGSTLAHCIRNSVYNNKAICP-RTGDAKCYNCFSEYLDVVIRDYHKVKEPEVRHPNVNFGDLENLGFQNLDPEGSFIMSTRIRVGRSIDGFNFPPTISKVDRLKLEKTIVDALSSLTGIHGGTYYPLTGMKENVQKQLIEDHFLFKDDDPVLRDAGGYRDWPSGRGIFHNNEKTFLVWVCEEDHMRIISMQKGGDIAAVFTRLVQGIRQIETKLTFAHSKKYGYLTCCPSNLGTTMRASVHLKIPKLSSDKTKLNEVCDRFNLQARGFHGEHTESP---EGIYDISNKRRLGLMEIEAATEMAKGVLEMIQIE 2253
            KSL KK+LT ++    KN K+K G TL  C+N+   N    +     D + Y +FG  F+ +I+DYH        H  SD  +  H+   ++D    YI STR+R  R++KG+  AP ++K  R+ + +++   L +LTG+L G YY L  M ++ + +L+ DHFL++  D+ L  AG  ++WP GRGI+ NN+KTF+VW+NEEDH+RIISME G D+  V+ RL   +  +++ L F+  K+ G+LT CP+NLGT MRASVH+KIP     P+F+ I  +Y +QARG +GEH+E+ G   GV+DISN+RRLGL+E+Q  ++MYDGV A++ +EK  + K     PE              +  +P   ++ +K+LT E+ D     +T  G +L  CI + V N  + C    GD +CY  F+   D ++ DYH   +   +H   +  + E +   NLDPEG++I STRIRV R++ G+   P +++ +RL +E+ +V  LSSLTG   G YYPLTGM E  +++L+ DHFLFK  D  L  AG  + WP GRGIFHNN+KTFLVW+ EED +RIISM+KG DI +VF RL + + +I+ +L F H+  +GYL+ CP+NLGT MRASVH+KIPK S+      ++CD F++QARG HGEH+ S     G++DISN+RRLGL E++   +M  GV ++++IE
Sbjct:   28 KSLVKKYLTPKVFESLKNKKTKLGITLWDCINSGVVNLDSGVGVYAGDEESYTLFGPLFDAIIEDYHSPYKLATGH-NSDM-NPAHVKAPDLDPANRYIRSTRIRVARSLKGYGLAPGVTKAHRLEIEKKVVGVLTSLTGDLAGKYYPLSGMDEKTRQQLVDDHFLFKKGDRFLEAAGINKEWPEGRGIYHNNDKTFLVWLNEEDHLRIISMEKGSDIGSVFSRLCRAVNEIDKKLGFQHTKKHGYLTSCPSNLGTGMRASVHVKIPHAKEHPDFENILTKYHIQARGIHGEHSESTGEDAGVYDISNRRRLGLSEVQCVQDMYDGVKALMELEKEAIAKKRSVFPE--------------VLKNPEVKSLLRKYLTPELFDSLKDKKTAKGISLYDCINSGVENLDSSCGVYAGDEECYTLFAPLFDKIVEDYHSPYKLANKH--TSDMNPEKVDAPNLDPEGTYIRSTRIRVARNVKGYALTPGLTRNERLDIERKVVGVLSSLTGDLAGQYYPLTGMDEATRQKLVNDHFLFKKGDRFLEAAGVNKLWPEGRGIFHNNDKTFLVWINEEDQLRIISMEKGSDIGSVFGRLCRAVNEIDKQLGFQHTDAHGYLSGCPTNLGTGMRASVHVKIPKASA-HPDFQKICDEFHIQARGIHGEHSVSTGEDAGVFDISNRRRLGLSEVQCVQDMYNGVKKLLEIE 711          

HSP 2 Score: 315.079 bits (806), Expect = 6.503e-94
Identity = 159/356 (44.66%), Postives = 229/356 (64.33%), Query Frame = 1
Query: 1216 SLEYLAKIIWNDPSND------TITKKHLTKEIVDKFNTIRTKNGSTLAHCIRNSVYN-NKAICPRTGDAKCYNCFSEYLDVVIRDYHKVKEPEVRHPNVNFGDLENLGFQNLDPEGSFIMSTRIRVGRSIDGFNFPPTISKVDRLKLEKTIVDALSSLTGIHGGTYYPLTGMKENVQKQLIEDHFLFKDDDPVLRDAGGYRDWPSGRGIFHNNEKTFLVWVCEEDHMRIISMQKGGDIAAVFTRLVQGIRQIETKLTFAHSKKYGYLTCCPSNLGTTMRASVHLKIPKLSSDKTKLNEVCDRFNLQARGFHGEHTESP---EGIYDISNKRRLGLMEIEAATEMAKGVLEMIQIE 2253
            + ++ +K  + DP ND      ++ KK+LT ++ +     +TK G TL  CI + V N +  +    GD + Y  F    D +I DYH   +    H N +  +  ++   +LDP   +I STRIRV RS+ G+   P ++K  RL++EK +V  L+SLTG   G YYPL+GM E  ++QL++DHFLFK  D  L  AG  ++WP GRGI+HNN+KTFLVW+ EEDH+RIISM+KG DI +VF+RL + + +I+ KL F H+KK+GYLT CPSNLGT MRASVH+KIP  + +      +  ++++QARG HGEH+ES     G+YDISN+RRLGL E++   +M  GV  ++++E
Sbjct:    7 AAKFKSKNAFPDPLNDPKCNPKSLVKKYLTPKVFESLKNKKTKLGITLWDCINSGVVNLDSGVGVYAGDEESYTLFGPLFDAIIEDYHSPYKLATGH-NSDM-NPAHVKAPDLDPANRYIRSTRIRVARSLKGYGLAPGVTKAHRLEIEKKVVGVLTSLTGDLAGKYYPLSGMDEKTRQQLVDDHFLFKKGDRFLEAAGINKEWPEGRGIYHNNDKTFLVWLNEEDHLRIISMEKGSDIGSVFSRLCRAVNEIDKKLGFQHTKKHGYLTSCPSNLGTGMRASVHVKIPH-AKEHPDFENILTKYHIQARGIHGEHSESTGEDAGVYDISNRRRLGLSEVQCVQDMYDGVKALMELE 359          

HSP 3 Score: 296.204 bits (757), Expect = 7.640e-87
Identity = 148/349 (42.41%), Postives = 223/349 (63.90%), Query Frame = 1
Query:  139 IYDMIYSNSENKSLAKKHLTKEIVAKYKNTKSKFGGTLAMCLNTNAYN-PRALMCRTADPDCYDVFGDYFNELIKDYH---KVATKEIEHPASDFGDIEHLPFKNMDVDKVYINSTRVRFGRTVKGFAFAPVISKEDRVTLSEQIANALKNLTGELQGNYYGLDNMTKEKQDELIKDHFLYRDDDQVLRDAGGYRDWPSGRGIFLNNEKTFVVWINEEDHIRIISMEPGGDLPKVYRRLIAGLKGLEENLEFERHKRFGFLTFCPTNLGTTMRASVHIKIPFLSMLPNFKQICEQYSLQARGTYGEHTENVG---GVFDISNQRRLGLTEIQAAKEMYDGVNAIIAIEK 1164
            ++  +  N E KSL +K+LT E+    K+ K+  G +L  C+N+   N   +      D +CY +F   F+++++DYH   K+A K      SD  + E +   N+D +  YI STR+R  R VKG+A  P +++ +R+ +  ++   L +LTG+L G YY L  M +  + +L+ DHFL++  D+ L  AG  + WP GRGIF NN+KTF+VWINEED +RIISME G D+  V+ RL   +  +++ L F+     G+L+ CPTNLGT MRASVH+KIP  S  P+F++IC+++ +QARG +GEH+ + G   GVFDISN+RRLGL+E+Q  ++MY+GV  ++ IEK
Sbjct:  369 VFPEVLKNPEVKSLLRKYLTPELFDSLKDKKTAKGISLYDCINSGVENLDSSCGVYAGDEECYTLFAPLFDKIVEDYHSPYKLANKH----TSDM-NPEKVDAPNLDPEGTYIRSTRIRVARNVKGYALTPGLTRNERLDIERKVVGVLSSLTGDLAGQYYPLTGMDEATRQKLVNDHFLFKKGDRFLEAAGVNKLWPEGRGIFHNNDKTFLVWINEEDQLRIISMEKGSDIGSVFGRLCRAVNEIDKQLGFQHTDAHGYLSGCPTNLGTGMRASVHVKIPKASAHPDFQKICDEFHIQARGIHGEHSVSTGEDAGVFDISNRRRLGLSEVQCVQDMYNGVKKLLEIEK 712          
BLAST of Taurocyamine kinase vs. UniProt/SwissProt
Match: sp|P18294|KCRF_STRPU (Creatine kinase, flagellar OS=Strongylocentrotus purpuratus OX=7668 PE=1 SV=1)

HSP 1 Score: 488.419 bits (1256), Expect = 1.645e-154
Identity = 282/721 (39.11%), Postives = 400/721 (55.48%), Query Frame = 1
Query:  193 LTKEIVAKYKNTKSKFGGTLAMCLNTNAYNPRALMCRT-----ADPDCYDVFGDYFNELIKDYHKVATKEIEHPASDFGDIEHLPFKNMD-VDKVYINSTRVRFGRTVKGFAFAPVISKEDRVTLSEQIANALKNLTGELQGNYYGLDNMTKEKQDELIKDHFLY-RDDDQVLRDAGGYRDWPSGRGIFLNNEKTFVVWINEEDHIRIISMEPGGDLPKVYRRLIAGLKGLEENL-----EFERHKRFGFLTFCPTNLGTTMRASVHIKIPFLSMLPNFKQICEQYSLQARGTYGEHTENVGGVFDISNQRRLGLTEIQAAKEMYDGVNAIIAIEK----------MLGKYNKTAPEGIPYVESLEYLAKIIWNDPSNDTITKKHLTKEIVDKFNTIRTKNGSTLAHCIRNSVYNNK-----AICPRTGDAKCYNCFSEYLDVVIRDYHKVKEPEVRHP-NVNFGDLENLGFQNLDPEGSFIMSTRIRVGRSIDGFNFPPTISKVDRLKLEKTIVDALSSLTGIHGGTYYPLTGMKENVQKQLIEDHFLF-KDDDPVLRDAGGYRDWPSGRGIFHNNEKTFLVWVCEEDHMRIISMQKGGDIAAVFTRLVQGIRQIETKL-----TFAHSKKYGYLTCCPSNLGTTMRASVHLKIPKLSSDKTKLNEVCDRFNLQARGFHGEHTESPEGIYDISNKRRLGLMEIEAATEMAKGVLEMIQIE 2253
            LT +I    K+ K+  G TL  C+ T   NP      T      D + YDVF D F+ +I   H    K+  H      +I H   K  D +D  Y+ S RVR GR++ G++  P  + E+R  +      AL    G+LQG YY L+ M+ E Q +LI DHFL+ +    +L  A  +RDWP GRGI+ N  K F+VW+NEEDHIR+ISME  G++  V++R   GL+  E+ +     EF  +K  G++  CP+NLGT +RA VH+K+P LS  P F QI     LQ RGT G  T +  G FDISN  RLG +E+Q  + + DGV  ++ +EK          +L +  +  P   P+  S +Y    + N+        K +T+EI +K   ++TK G TL  CI+  + N        +    GD +CY  F+   D VI   H     + +HP N+N  +L+  G  +LDPE  F++S R+R GR I G   PP  ++ +R ++EK   +ALS+L+G   G YYPLTGM +  Q++LIEDHFLF K   P+L  A   RDWP GRGI+HN+EK FLVWV EEDH R+ISM+K G++  VF R   G++++E  +      F  ++  GY+  CPSNLGT +RA VH+K+P LS  K   + + D   LQ RG  G  T S +G +DISN  R+G  E+    ++  GV  ++ +E
Sbjct:  448 LTYDIWKSLKDKKTPSGFTLDGCIQTGVMNPGHPHIMTVGMVAGDEESYDVFADIFDPVIDARHGGYPKDAVH----VTNINHADLKGGDNLDPKYVLSCRVRTGRSIIGYSLPPHCTVEERAAVETITIGALDKFDGDLQGKYYPLEGMSDETQTQLIDDHFLFDKPVSPLLTAARMHRDWPQGRGIWHNENKNFLVWVNEEDHIRVISMEKDGNMRAVFKRFCEGLQKFEQMIKKDGKEFMWNKHLGYVLTCPSNLGTGLRAGVHVKLPLLSKYPRFDQILRALRLQKRGTGGVDTASTDGTFDISNLDRLGSSEVQQVQFVVDGVELLVQMEKKLEKGEDIFDILPQQCRPKPPIKPF--SYDYPDFSLHNN-----WMSKCMTEEIYNKLCNLKTKGGVTLNDCIQTGIDNPGHPYIMTVGLVAGDEECYEVFAPLFDPVISARHGGYALDAKHPTNLNAAELK--GGDDLDPE--FVLSCRVRTGRCIRGLALPPCCTRAERAEVEKITTEALSTLSGPLKGKYYPLTGMTDEEQEKLIEDHFLFDKPVSPLLLCANMARDWPQGRGIWHNDEKNFLVWVNEEDHTRVISMEKSGNMKRVFERFCDGLKKVEDSIKSKGYQFMWNEHLGYVLTCPSNLGTGLRAGVHVKVPLLSQQKI-FDSILDHMRLQKRGTGGVDTASTDGTFDISNSDRIGFSEVHLVQQLVDGVKLLVNLE 1152          

HSP 2 Score: 463.381 bits (1191), Expect = 4.693e-145
Identity = 277/723 (38.31%), Postives = 399/723 (55.19%), Query Frame = 1
Query:  163 SENKSLAKKHLTKEIVAKYKNTKSKFGGTLAMCLNTNAYNPRALMCRT-----ADPDCYDVFGDYFNELIKDYHKVATKEIEHPASDFGDIEHLPFKNMDVDKVYINSTRVRFGRTVKGFAFAPVISKEDRVTLSEQIANALKNLTGELQGNYYGLDNMTKEKQDELIKDHFLY-RDDDQVLRDAGGYRDWPSGRGIFLNNEKTFVVWINEEDHIRIISMEPGGDLPKVYRRLIAGLKGLEENL-----EFERHKRFGFLTFCPTNLGTTMRASVHIKIPFLSMLPNFKQICEQYSLQARGTYGEHTENVGGVFDISNQRRLGLTEIQAAKEMYDGVNAIIAIEKMLGKYNKTAPEGIPYVESLEYLAKII--WNDPSNDTITKKH-LTKEIVDKFNTIRTKNGSTLAHCIRNSVYNNK-----AICPRTGDAKCYNCFSEYLDVVIRDYHKVKEPEVRH-PNVNFGDLENLGFQNLDPEGSFIMSTRIRVGRSIDGFNFPPTISKVDRLKLEKTIVDALSSLTGIHGGTYYPLTGMKENVQKQLIEDHFLF-KDDDPVLRDAGGYRDWPSGRGIFHNNEKTFLVWVCEEDHMRIISMQKGGDIAAVFTRLVQGIRQIETKLT-----FAHSKKYGYLTCCPSNLGTTMRASVHLKIPKLSSDKTKLNEVCDRFNLQARGFHGEHTESPEGIYDISNKRRLGLMEIEAATEMAKGVLEMIQIE 2253
            S++ +   + LT  I  K  N ++  G ++  C+ T   NP     +T      D +CYD+F D F+  I   H    +  +H  +D  + +HL   + D D  Y+ S RVR GR ++G+   P  ++ +R  + +   +AL  L G L+G YY L  MT+E QD+LI DHFL+ +    +L  A   RDWP GRGI+ N +K F+VWINEEDH R+ISME  G++  V++R   GL  +E  L     EF  ++  G++  CP+NLGT +RA VHIKIP  S    F+ I + Y LQ RGT G  T +  G FDISN  RLG +E+Q  + + DGV  +I +EK L K +  + + IP   ++    ++   + D S       H LT +I       +T +G TL  CI+  V N        +    GD + Y+ F++  D VI   H     +  H  N+N  DL+  G  NLDP+  +++S R+R GRSI G++ PP  +  +R  +E   + AL    G   G YYPL GM +  Q QLI+DHFLF K   P+L  A  +RDWP GRGI+HN  K FLVWV EEDH+R+ISM+K G++ AVF R  +G+++ E  +      F  +K  GY+  CPSNLGT +RA VH+K+P LS    + +++     LQ RG  G  T S +G +DISN  RLG  E++    +  GV  ++Q+E
Sbjct:   65 SKHNNYLAESLTPSIYNKICNLRTLSGYSVDGCMQTGVDNPGHPFIKTVGLVAGDEECYDLFADLFDPTIDKRHNGYPRNAKH-TTDL-NPDHLKGGD-DFDPKYVLSCRVRTGRCIRGYGLPPHCTRAERRDVEKVCKDALATLDGPLKGTYYPLTGMTEEMQDKLIADHFLFDKPVSPLLMSARMARDWPDGRGIWHNADKNFLVWINEEDHTRVISMETSGNMKNVFKRFCNGLNKVENALKAKGYEFSWNEHLGYVLTCPSNLGTGVRAGVHIKIPLFSKHAGFESILKHYRLQKRGTGGVDTASTDGTFDISNLDRLGTSEVQQVQSVVDGVKKLIELEKALEKGSDISGQ-IPRDPAIVRAEQVKEGYPDLSKHNNHLAHCLTYDIWKSLKDKKTPSGFTLDGCIQTGVMNPGHPHIMTVGMVAGDEESYDVFADIFDPVIDARHGGYPKDAVHVTNINHADLK--GGDNLDPK--YVLSCRVRTGRSIIGYSLPPHCTVEERAAVETITIGALDKFDGDLQGKYYPLEGMSDETQTQLIDDHFLFDKPVSPLLTAARMHRDWPQGRGIWHNENKNFLVWVNEEDHIRVISMEKDGNMRAVFKRFCEGLQKFEQMIKKDGKEFMWNKHLGYVLTCPSNLGTGLRAGVHVKLPLLSK-YPRFDQILRALRLQKRGTGGVDTASTDGTFDISNLDRLGSSEVQQVQFVVDGVELLVQME 778          

HSP 3 Score: 244.973 bits (624), Expect = 3.945e-66
Identity = 135/352 (38.35%), Postives = 199/352 (56.53%), Query Frame = 1
Query:  187 KHLTKEIVAKYKNTKSKFGGTLAMCLNTNAYNPRALMCRT-----ADPDCYDVFGDYFNELIKDYHKVATKEIEHPASDFGDIEHLPFKNMD-VDKVYINSTRVRFGRTVKGFAFAPVISKEDRVTLSEQIANALKNLTGELQGNYYGLDNMTKEKQDELIKDHFLY-RDDDQVLRDAGGYRDWPSGRGIFLNNEKTFVVWINEEDHIRIISMEPGGDLPKVYRRLIAGLKGLEENL-----EFERHKRFGFLTFCPTNLGTTMRASVHIKIPFLSMLPNFKQICEQYSLQARGTYGEHTENVGGVFDISNQRRLGLTEIQAAKEMYDGVNAIIAIEKMLGK---YNKTAPE 1197
            K +T+EI  K  N K+K G TL  C+ T   NP      T      D +CY+VF   F+ +I   H     + +HP     ++     K  D +D  ++ S RVR GR ++G A  P  ++ +R  + +    AL  L+G L+G YY L  MT E+Q++LI+DHFL+ +    +L  A   RDWP GRGI+ N+EK F+VW+NEEDH R+ISME  G++ +V+ R   GLK +E+++     +F  ++  G++  CP+NLGT +RA VH+K+P LS    F  I +   LQ RGT G  T +  G FDISN  R+G +E+   +++ DGV  ++ +EK L K    N   PE
Sbjct:  820 KCMTEEIYNKLCNLKTKGGVTLNDCIQTGIDNPGHPYIMTVGLVAGDEECYEVFAPLFDPVISARHGGYALDAKHPT----NLNAAELKGGDDLDPEFVLSCRVRTGRCIRGLALPPCCTRAERAEVEKITTEALSTLSGPLKGKYYPLTGMTDEEQEKLIEDHFLFDKPVSPLLLCANMARDWPQGRGIWHNDEKNFLVWVNEEDHTRVISMEKSGNMKRVFERFCDGLKKVEDSIKSKGYQFMWNEHLGYVLTCPSNLGTGLRAGVHVKVPLLSQQKIFDSILDHMRLQKRGTGGVDTASTDGTFDISNSDRIGFSEVHLVQQLVDGVKLLVNLEKALMKGEDINSLLPE 1167          
BLAST of Taurocyamine kinase vs. UniProt/SwissProt
Match: sp|O15990|KARG_LIOJA (Arginine kinase OS=Liolophura japonica OX=13599 PE=2 SV=1)

HSP 1 Score: 394.815 bits (1013), Expect = 6.755e-129
Identity = 188/346 (54.34%), Postives = 250/346 (72.25%), Query Frame = 1
Query:  130 LDEIYDMIYSNSENKSLAKKHLTKEIVAKYKNTKSKFGGTLAMCLNTNAYN-PRALMCRTADPDCYDVFGDYFNELIKDYHKVATKEIEHPASDFGDIEHLPFKNMDVDKVYINSTRVRFGRTVKGFAFAPVISKEDRVTLSEQIANALKNLTGELQGNYYGLDNMTKEKQDELIKDHFLYRDDDQVLRDAGGYRDWPSGRGIFLNNEKTFVVWINEEDHIRIISMEPGGDLPKVYRRLIAGLKGLEENLEFERHKRFGFLTFCPTNLGTTMRASVHIKIPFLSMLPNFKQICEQYSLQARGTYGEHTENVGGVFDISNQRRLGLTEIQAAKEMYDGVNAIIAIEK 1164
            L E+++ + SN ++KSL KKHLTKE+  K K+ K+KFGGTLA C+ + A N    +    +DP+ Y VF D    +I DYHK+   E++HPA DFGD+ +L F + D    +I STRVR GR+   F F P ++KE RV +      AL+ LTGEL+G YY L+ MT + Q +L +DHFL+ D D+ L+ A GY DWP+GRGIF N+ KTF+VW+NEEDHIRIISM+ GGDL  VY+RL+ G+K LE+ LEF R    G+LTFCP+NLGTT+RASVHIKIP ++  P FK+IC++ +LQARG +GEHTE+VGGV+DISN+RR+GL+EI+A +EM  GV  II +EK
Sbjct:    4 LAELWEKVSSNKDSKSLLKKHLTKEVYEKLKDKKTKFGGTLADCIRSGAKNLDSGVGVYASDPEAYTVFQDLLGPVILDYHKIT--ELKHPACDFGDLSNLGFGDFDPSGDWIVSTRVRVGRSHASFGFPPTLNKEQRVEMQRVTQGALEGLTGELKGKYYPLEGMTPDVQKQLTEDHFLFNDSDRFLKAASGYDDWPTGRGIFFNDNKTFLVWVNEEDHIRIISMQKGGDLAAVYKRLVGGIKELEKKLEFARLPNLGYLTFCPSNLGTTLRASVHIKIPKVAKKPEFKEICDKLNLQARGIHGEHTESVGGVYDISNKRRMGLSEIEAIQEMRKGVEEIIKLEK 347          

HSP 2 Score: 392.119 bits (1006), Expect = 7.797e-128
Identity = 193/346 (55.78%), Postives = 245/346 (70.81%), Query Frame = 1
Query: 1219 LEYLAKIIWNDPSNDTITKKHLTKEIVDKFNTIRTKNGSTLAHCIRNSVYN-NKAICPRTGDAKCYNCFSEYLDVVIRDYHKVKEPEVRHPNVNFGDLENLGFQNLDPEGSFIMSTRIRVGRSIDGFNFPPTISKVDRLKLEKTIVDALSSLTGIHGGTYYPLTGMKENVQKQLIEDHFLFKDDDPVLRDAGGYRDWPSGRGIFHNNEKTFLVWVCEEDHMRIISMQKGGDIAAVFTRLVQGIRQIETKLTFAHSKKYGYLTCCPSNLGTTMRASVHLKIPKLSSDKTKLNEVCDRFNLQARGFHGEHTESPEGIYDISNKRRLGLMEIEAATEMAKGVLEMIQIE 2253
            L  L + + ++  + ++ KKHLTKE+ +K    +TK G TLA CIR+   N +  +     D + Y  F + L  VI DYHK+ E  ++HP  +FGDL NLGF + DP G +I+STR+RVGRS   F FPPT++K  R+++++    AL  LTG   G YYPL GM  +VQKQL EDHFLF D D  L+ A GY DWP+GRGIF N+ KTFLVWV EEDH+RIISMQKGGD+AAV+ RLV GI+++E KL FA     GYLT CPSNLGTT+RASVH+KIPK++  K +  E+CD+ NLQARG HGEHTES  G+YDISNKRR+GL EIEA  EM KGV E+I++E
Sbjct:    4 LAELWEKVSSNKDSKSLLKKHLTKEVYEKLKDKKTKFGGTLADCIRSGAKNLDSGVGVYASDPEAYTVFQDLLGPVILDYHKITE--LKHPACDFGDLSNLGFGDFDPSGDWIVSTRVRVGRSHASFGFPPTLNKEQRVEMQRVTQGALEGLTGELKGKYYPLEGMTPDVQKQLTEDHFLFNDSDRFLKAASGYDDWPTGRGIFFNDNKTFLVWVNEEDHIRIISMQKGGDLAAVYKRLVGGIKELEKKLEFARLPNLGYLTFCPSNLGTTLRASVHIKIPKVAK-KPEFKEICDKLNLQARGIHGEHTESVGGVYDISNKRRMGLSEIEAIQEMRKGVEEIIKLE 346          
BLAST of Taurocyamine kinase vs. UniProt/SwissProt
Match: sp|G1ESZ9|KARG_AMPFA (Arginine kinase Oct f 2 OS=Amphioctopus fangsiao OX=515817 PE=1 SV=1)

HSP 1 Score: 381.719 bits (979), Expect = 8.196e-124
Identity = 190/345 (55.07%), Postives = 236/345 (68.41%), Query Frame = 1
Query: 1222 EYLAKIIWNDPSNDTITKKHLTKEIVDKFNTIRTKNGSTLAHCIRNSVYN-NKAICPRTGDAKCYNCFSEYLDVVIRDYHKVKEPEVRHPNVNFGDLENLGFQNLDPEGSFIMSTRIRVGRSIDGFNFPPTISKVDRLKLEKTIVDALSSLTGIHGGTYYPLTGMKENVQKQLIEDHFLFKDDDPVLRDAGGYRDWPSGRGIFHNNEKTFLVWVCEEDHMRIISMQKGGDIAAVFTRLVQGIRQIETKLTFAHSKKYGYLTCCPSNLGTTMRASVHLKIPKLSSDKTKLNEVCDRFNLQARGFHGEHTESPEGIYDISNKRRLGLMEIEAATEMAKGVLEMIQIE 2253
            E L K + N     ++ KKHLTKE  DK   ++TK G TLA CIR+   N +  +     D   Y  F+E LD VI DYHK+ +  V HP  +FGD+ NL   +LDP G+ I+STR+RVGRS D F FPP + K DR+K+E+  V+AL SL G   G+Y+PL  M  +VQKQL EDHFLF D D  L+ A GY DWP GRGI+ +  KTFL WV EEDH+R+ISMQKGG++  V+ RLV  I ++E KL FA     GYLT CPSNLGTTMRASVH+KIPKLS  ++    +CD++NLQARG HGEHTES  G+YDISNKRR+GL E EA TEM +GV E+I+ E
Sbjct:    3 EELFKTLQNAKECHSLLKKHLTKERFDKLKGLKTKFGGTLADCIRSGCKNPDSGVGIYASDPDAYTVFAEVLDAVIMDYHKIDK--VHHPIPDFGDVNNLNIGDLDPSGNMIVSTRVRVGRSHDSFGFPPVLKKDDRIKMEQVSVEALKSLDGELAGSYFPLANMSADVQKQLTEDHFLFNDSDRFLKAASGYDDWPIGRGIYFSENKTFLCWVNEEDHLRLISMQKGGNLGEVYKRLVSAINKMEKKLNFAKKDNMGYLTFCPSNLGTTMRASVHIKIPKLSQ-RSDFKSICDKYNLQARGIHGEHTESVCGVYDISNKRRMGLTEYEAVTEMMRGVNEIIREE 344          

HSP 2 Score: 360.147 bits (923), Expect = 1.767e-115
Identity = 172/344 (50.00%), Postives = 236/344 (68.60%), Query Frame = 1
Query:  133 DEIYDMIYSNSENKSLAKKHLTKEIVAKYKNTKSKFGGTLAMCLNTNAYNP-RALMCRTADPDCYDVFGDYFNELIKDYHKVATKEIEHPASDFGDIEHLPFKNMDVDKVYINSTRVRFGRTVKGFAFAPVISKEDRVTLSEQIANALKNLTGELQGNYYGLDNMTKEKQDELIKDHFLYRDDDQVLRDAGGYRDWPSGRGIFLNNEKTFVVWINEEDHIRIISMEPGGDLPKVYRRLIAGLKGLEENLEFERHKRFGFLTFCPTNLGTTMRASVHIKIPFLSMLPNFKQICEQYSLQARGTYGEHTENVGGVFDISNQRRLGLTEIQAAKEMYDGVNAIIAIE 1161
            +E++  + +  E  SL KKHLTKE   K K  K+KFGGTLA C+ +   NP   +    +DPD Y VF +  + +I DYHK+   ++ HP  DFGD+ +L   ++D     I STRVR GR+   F F PV+ K+DR+ + +    ALK+L GEL G+Y+ L NM+ + Q +L +DHFL+ D D+ L+ A GY DWP GRGI+ +  KTF+ W+NEEDH+R+ISM+ GG+L +VY+RL++ +  +E+ L F +    G+LTFCP+NLGTTMRASVHIKIP LS   +FK IC++Y+LQARG +GEHTE+V GV+DISN+RR+GLTE +A  EM  GVN II  E
Sbjct:    3 EELFKTLQNAKECHSLLKKHLTKERFDKLKGLKTKFGGTLADCIRSGCKNPDSGVGIYASDPDAYTVFAEVLDAVIMDYHKI--DKVHHPIPDFGDVNNLNIGDLDPSGNMIVSTRVRVGRSHDSFGFPPVLKKDDRIKMEQVSVEALKSLDGELAGSYFPLANMSADVQKQLTEDHFLFNDSDRFLKAASGYDDWPIGRGIYFSENKTFLCWVNEEDHLRLISMQKGGNLGEVYKRLVSAINKMEKKLNFAKKDNMGYLTFCPSNLGTTMRASVHIKIPKLSQRSDFKSICDKYNLQARGIHGEHTESVCGVYDISNKRRMGLTEYEAVTEMMRGVNEIIREE 344          
BLAST of Taurocyamine kinase vs. TrEMBL
Match: A0A5J4NZC6 (Creatine kinase OS=Paragonimus westermani OX=34504 GN=DEA37_0002063 PE=3 SV=1)

HSP 1 Score: 958.362 bits (2476), Expect = 0.000e+0
Identity = 439/713 (61.57%), Postives = 564/713 (79.10%), Query Frame = 1
Query:  115 MEYKSLDEIYDMIYSNSENKSLAKKHLTKEIVAKYKNTKSKFGGTLAMCLNTNAYNPRALMCRTADPDCYDVFGDYFNELIKDYHKVATKEIEHPASDFGDIEHLPFKNMDVDKVYINSTRVRFGRTVKGFAFAPVISKEDRVTLSEQIANALKNLTGELQGNYYGLDNMTKEKQDELIKDHFLYRDDDQVLRDAGGYRDWPSGRGIFLNNEKTFVVWINEEDHIRIISMEPGGDLPKVYRRLIAGLKGLEENLEFERHKRFGFLTFCPTNLGTTMRASVHIKIPFLSMLPNFKQICEQYSLQARGTYGEHTENVGGVFDISNQRRLGLTEIQAAKEMYDGVNAIIAIEKMLGKYNKTAPEGIPYVESLEYLAKIIWNDPSNDTITKKHLTKEIVDKFNTIRTKNGSTLAHCIRNSVYNNKAICPRTGDAKCYNCFSEYLDVVIRDYHKVKEPEVRHPNVNFGDLENLGFQNLDPEGSFIMSTRIRVGRSIDGFNFPPTISKVDRLKLEKTIVDALSSLTGIHGGTYYPLTGMKENVQKQLIEDHFLFKDDDPVLRDAGGYRDWPSGRGIFHNNEKTFLVWVCEEDHMRIISMQKGGDIAAVFTRLVQGIRQIETKLTFAHSKKYGYLTCCPSNLGTTMRASVHLKIPKLSSDKTKLNEVCDRFNLQARGFHGEHTESPEGIYDISNKRRLGLMEIEAATEMAKGVLEMIQIE 2253
            M+ +SL  + + I ++ +N SL KK+LT++IV +Y   ++ FGGTLA C+N NA NP A++ R  D + Y+ F D+F+ LIKDYHKV   EI HPAS+FGD+ +L FK+++     + STRVR GRTV+G+ F P ++KE R+ L  +IA ALKNLTGE +G Y+ L  M +E++ +L++ HFL+R+DD VLRDAGGY DWP+GRGIF+N+ + F+VWINEEDHIR+ISM+ GGDL  +Y+RL   +  L ++L+F  + RFGF+TFCP+NLGTT+RASVH ++PFLS LPNF QICE+YS+QARGT+GEHT +VGGV+D+SN+RRLGLTEI A  EMY+GV A++ +EK L  YNK AP G+  VE L YL+K++        +T+KHLT EI+ K++ +RTK+G+TLAH +RN  YN +AICPRTG+A+CY+ F +YLD VI DYH VK+   +HP   FGDLE+L F N+DP G F++STR+RVGRS+ GF FP  I K DRLKLE TI +AL+SLTG H GTYYPL+ MKE  +KQL++DHFLFK+DDPVLRDAGGYRDWP+GRGIFHNN KTFLVWVCEEDHMR+ISMQ+GGD+AAVF RL+QG++ IETKL F H+ KYGY+TCCPSNLGTTMRASV +KIPKLS+ K KL+EVC ++ LQARG HGEHTESP+GI+DISNKRRLGL E+EAA EMA+GV  +I IE
Sbjct:    1 MQVESLKLLQEKIKNDEKNNSLTKKYLTEKIVEQYVGKRTSFGGTLAQCVNNNANNPGAILPRACDLNAYETFKDFFDPLIKDYHKVQGPEISHPASNFGDLANLKFKDLNDGSDMVVSTRVRLGRTVEGYGFGPTLTKEARLELESKIATALKNLTGEYKGTYHPLTGMKEEERVKLVEQHFLFRNDDSVLRDAGGYIDWPNGRGIFINDAQNFLVWINEEDHIRVISMQKGGDLIAIYKRLAGAINELSKSLKFAFNNRFGFITFCPSNLGTTLRASVHARVPFLSSLPNFNQICEKYSIQARGTHGEHTASVGGVYDLSNKRRLGLTEIDAVTEMYNGVRALLDLEKQLASYNKDAPAGVMPVEPLAYLSKLLEAADPQKCLTRKHLTAEIIRKYDGVRTKHGATLAHMVRNCAYNPRAICPRTGEAECYSTFVDYLDAVICDYHDVKDAAFKHPAPTFGDLEHLPFGNVDPTGKFVISTRVRVGRSVQGFLFPTIIGKEDRLKLESTIANALTSLTGEHAGTYYPLSNMKEETRKQLVDDHFLFKNDDPVLRDAGGYRDWPTGRGIFHNNNKTFLVWVCEEDHMRVISMQQGGDLAAVFKRLIQGLKAIETKLKFEHNDKYGYVTCCPSNLGTTMRASVLVKIPKLSAQKDKLDEVCAKYRLQARGLHGEHTESPDGIHDISNKRRLGLTELEAAKEMAEGVAHIIAIE 713          

HSP 2 Score: 403.675 bits (1036), Expect = 7.120e-125
Identity = 191/353 (54.11%), Postives = 252/353 (71.39%), Query Frame = 1
Query:  115 MEYKSLDEIYDMIYSNSENKSLAKKHLTKEIVAKYKNTKSKFGGTLAMCLNTNAYNPRALMCRTADPDCYDVFGDYFNELIKDYHKVATKEIEHPASDFGDIEHLPFKNMDVDKVYINSTRVRFGRTVKGFAFAPVISKEDRVTLSEQIANALKNLTGELQGNYYGLDNMTKEKQDELIKDHFLYRDDDQVLRDAGGYRDWPSGRGIFLNNEKTFVVWINEEDHIRIISMEPGGDLPKVYRRLIAGLKGLEENLEFERHKRFGFLTFCPTNLGTTMRASVHIKIPFLSMLPN-FKQICEQYSLQARGTYGEHTENVGGVFDISNQRRLGLTEIQAAKEMYDGVNAIIAIEKML 1170
            M  + L  +  ++ +    K L +KHLT EI+ KY   ++K G TLA  +   AYNPRA+  RT + +CY  F DY + +I DYH V     +HPA  FGD+EHLPF N+D    ++ STRVR GR+V+GF F  +I KEDR+ L   IANAL +LTGE  G YY L NM +E + +L+ DHFL+++DD VLRDAGGYRDWP+GRGIF NN KTF+VW+ EEDH+R+ISM+ GGDL  V++RLI GLK +E  L+FE + ++G++T CP+NLGTTMRASV +KIP LS   +   ++C +Y LQARG +GEHTE+  G+ DISN+RRLGLTE++AAKEM +GV  IIAIE+ L
Sbjct:  364 MPVEPLAYLSKLLEAADPQKCLTRKHLTAEIIRKYDGVRTKHGATLAHMVRNCAYNPRAICPRTGEAECYSTFVDYLDAVICDYHDVKDAAFKHPAPTFGDLEHLPFGNVDPTGKFVISTRVRVGRSVQGFLFPTIIGKEDRLKLESTIANALTSLTGEHAGTYYPLSNMKEETRKQLVDDHFLFKNDDPVLRDAGGYRDWPTGRGIFHNNNKTFLVWVCEEDHMRVISMQQGGDLAAVFKRLIQGLKAIETKLKFEHNDKYGYVTCCPSNLGTTMRASVLVKIPKLSAQKDKLDEVCAKYRLQARGLHGEHTESPDGIHDISNKRRLGLTELEAAKEMAEGVAHIIAIEQSL 716          
BLAST of Taurocyamine kinase vs. TrEMBL
Match: C7BCG0 (Taurocyamine kinase OS=Paragonimus westermani OX=34504 PE=2 SV=1)

HSP 1 Score: 955.281 bits (2468), Expect = 0.000e+0
Identity = 438/713 (61.43%), Postives = 563/713 (78.96%), Query Frame = 1
Query:  115 MEYKSLDEIYDMIYSNSENKSLAKKHLTKEIVAKYKNTKSKFGGTLAMCLNTNAYNPRALMCRTADPDCYDVFGDYFNELIKDYHKVATKEIEHPASDFGDIEHLPFKNMDVDKVYINSTRVRFGRTVKGFAFAPVISKEDRVTLSEQIANALKNLTGELQGNYYGLDNMTKEKQDELIKDHFLYRDDDQVLRDAGGYRDWPSGRGIFLNNEKTFVVWINEEDHIRIISMEPGGDLPKVYRRLIAGLKGLEENLEFERHKRFGFLTFCPTNLGTTMRASVHIKIPFLSMLPNFKQICEQYSLQARGTYGEHTENVGGVFDISNQRRLGLTEIQAAKEMYDGVNAIIAIEKMLGKYNKTAPEGIPYVESLEYLAKIIWNDPSNDTITKKHLTKEIVDKFNTIRTKNGSTLAHCIRNSVYNNKAICPRTGDAKCYNCFSEYLDVVIRDYHKVKEPEVRHPNVNFGDLENLGFQNLDPEGSFIMSTRIRVGRSIDGFNFPPTISKVDRLKLEKTIVDALSSLTGIHGGTYYPLTGMKENVQKQLIEDHFLFKDDDPVLRDAGGYRDWPSGRGIFHNNEKTFLVWVCEEDHMRIISMQKGGDIAAVFTRLVQGIRQIETKLTFAHSKKYGYLTCCPSNLGTTMRASVHLKIPKLSSDKTKLNEVCDRFNLQARGFHGEHTESPEGIYDISNKRRLGLMEIEAATEMAKGVLEMIQIE 2253
            M+ +SL  + + I ++ +N SL KK+LT++IV +Y   ++ FGGTLA C+N NA NP A++ R  D + Y+ F D+F+ LIKDYHKV   EI HPAS+FGD+ +L FK+++     + STRVR GRTV+G+ F P ++KE R+ L  +IA ALKNLTGE +G Y+ L  M +E++ +L++ HFL+R+DD VLRDAGGY DWP+GRGIF+N+ + F+VWINEEDHIR+ISM+ GGDL  +Y+RL   +  L + L+F  + RFGF+TFCP+NLGTT+RASVH ++PFLS LPNF QICE+Y++QARGT+GEHT +VGGV+D+SN+RRLGLTEI A  EMY+GV A++ +EK L  YNK AP  +  VE L YL+K++        +T+KHLT EI+ K++ +RTK+G+TLAH +RN  YN +AICPRTG+A+CY+ F +YLD VI DYH VK+P  +HP   FGDLE+L F N+DP G F++STR+RVGRS+ GF FP  I K DRLKLE TI +AL+SLTG H GTYYPL+ MKE  +KQL++DHFLFK+DDPVLRDAGGYRDWP+GRGIFHNN KTFLVWVCEEDHMR+ISMQ+GGD+AAVF RL+QG++ IETKL F HS KYGY+TCCPSNLGTTMRASV +KIPKLS+ K KL+EVC ++ LQARG HGEHTESP+GI+DISNKRRLGL E++AA EMA+GV  +I IE
Sbjct:    1 MQVESLKLLQEKIKNDEKNNSLTKKYLTEKIVEQYVGKRTSFGGTLAQCVNNNANNPGAILPRACDLNAYETFKDFFDPLIKDYHKVRGPEISHPASNFGDLANLKFKDLNDGSDMVVSTRVRLGRTVEGYGFGPTLTKEARLELESKIATALKNLTGEYKGTYHPLTGMKEEERVKLVEQHFLFRNDDSVLRDAGGYIDWPNGRGIFINDAQNFLVWINEEDHIRVISMQKGGDLIAIYKRLAGAINELSKTLKFAFNNRFGFITFCPSNLGTTLRASVHARVPFLSSLPNFNQICEKYAIQARGTHGEHTASVGGVYDLSNKRRLGLTEIDAVTEMYNGVRALLDLEKQLVSYNKDAPADVMPVEPLAYLSKLLETADPQKCLTRKHLTAEIIRKYDGVRTKHGATLAHMVRNCAYNPRAICPRTGEAECYSTFVDYLDAVICDYHDVKDPAFKHPAPTFGDLEHLPFGNVDPTGKFVISTRVRVGRSVQGFLFPTIIGKEDRLKLESTIANALTSLTGEHAGTYYPLSNMKEETRKQLVDDHFLFKNDDPVLRDAGGYRDWPTGRGIFHNNNKTFLVWVCEEDHMRVISMQQGGDLAAVFKRLIQGLKAIETKLKFEHSDKYGYVTCCPSNLGTTMRASVLVKIPKLSAQKDKLDEVCAKYRLQARGLHGEHTESPDGIHDISNKRRLGLTELDAAKEMAEGVAHIIAIE 713          

HSP 2 Score: 401.749 bits (1031), Expect = 4.527e-124
Identity = 191/353 (54.11%), Postives = 250/353 (70.82%), Query Frame = 1
Query:  115 MEYKSLDEIYDMIYSNSENKSLAKKHLTKEIVAKYKNTKSKFGGTLAMCLNTNAYNPRALMCRTADPDCYDVFGDYFNELIKDYHKVATKEIEHPASDFGDIEHLPFKNMDVDKVYINSTRVRFGRTVKGFAFAPVISKEDRVTLSEQIANALKNLTGELQGNYYGLDNMTKEKQDELIKDHFLYRDDDQVLRDAGGYRDWPSGRGIFLNNEKTFVVWINEEDHIRIISMEPGGDLPKVYRRLIAGLKGLEENLEFERHKRFGFLTFCPTNLGTTMRASVHIKIPFLSMLPN-FKQICEQYSLQARGTYGEHTENVGGVFDISNQRRLGLTEIQAAKEMYDGVNAIIAIEKML 1170
            M  + L  +  ++ +    K L +KHLT EI+ KY   ++K G TLA  +   AYNPRA+  RT + +CY  F DY + +I DYH V     +HPA  FGD+EHLPF N+D    ++ STRVR GR+V+GF F  +I KEDR+ L   IANAL +LTGE  G YY L NM +E + +L+ DHFL+++DD VLRDAGGYRDWP+GRGIF NN KTF+VW+ EEDH+R+ISM+ GGDL  V++RLI GLK +E  L+FE   ++G++T CP+NLGTTMRASV +KIP LS   +   ++C +Y LQARG +GEHTE+  G+ DISN+RRLGLTE+ AAKEM +GV  IIAIE+ L
Sbjct:  364 MPVEPLAYLSKLLETADPQKCLTRKHLTAEIIRKYDGVRTKHGATLAHMVRNCAYNPRAICPRTGEAECYSTFVDYLDAVICDYHDVKDPAFKHPAPTFGDLEHLPFGNVDPTGKFVISTRVRVGRSVQGFLFPTIIGKEDRLKLESTIANALTSLTGEHAGTYYPLSNMKEETRKQLVDDHFLFKNDDPVLRDAGGYRDWPTGRGIFHNNNKTFLVWVCEEDHMRVISMQQGGDLAAVFKRLIQGLKAIETKLKFEHSDKYGYVTCCPSNLGTTMRASVLVKIPKLSAQKDKLDEVCAKYRLQARGLHGEHTESPDGIHDISNKRRLGLTELDAAKEMAEGVAHIIAIEQSL 716          
BLAST of Taurocyamine kinase vs. TrEMBL
Match: A0A0V0J1X0 (Taurocyamine kinase (Fragment) OS=Schistocephalus solidus OX=70667 GN=KTRC PE=3 SV=1)

HSP 1 Score: 954.125 bits (2465), Expect = 0.000e+0
Identity = 435/716 (60.75%), Postives = 553/716 (77.23%), Query Frame = 1
Query:  106 LRKMEYKSLDEIYDMIYSNSENKSLAKKHLTKEIVAKYKNTKSKFGGTLAMCLNTNAYNPRALMCRTADPDCYDVFGDYFNELIKDYHKVATKEIEHPASDFGDIEHLPFKNMDVDKVYINSTRVRFGRTVKGFAFAPVISKEDRVTLSEQIANALKNLTGELQGNYYGLDNMTKEKQDELIKDHFLYRDDDQVLRDAGGYRDWPSGRGIFLNNEKTFVVWINEEDHIRIISMEPGGDLPKVYRRLIAGLKGLEENLEFERHKRFGFLTFCPTNLGTTMRASVHIKIPFLSMLPNFKQICEQYSLQARGTYGEHTENVGGVFDISNQRRLGLTEIQAAKEMYDGVNAIIAIEKMLGKYNKTAPEGIPYVESLEYLAKIIWNDPSNDTITKKHLTKEIVDKFNTIRTKNGSTLAHCIRNSVYNNKAICPRTGDAKCYNCFSEYLDVVIRDYHKVKEPEVRHPNVNFGDLENLGFQNLDPEGSFIMSTRIRVGRSIDGFNFPPTISKVDRLKLEKTIVDALSSLTGIHGGTYYPLTGMKENVQKQLIEDHFLFKDDDPVLRDAGGYRDWPSGRGIFHNNEKTFLVWVCEEDHMRIISMQKGGDIAAVFTRLVQGIRQIETKLTFAHSKKYGYLTCCPSNLGTTMRASVHLKIPKLSSDKTKLNEVCDRFNLQARGFHGEHTESPEGIYDISNKRRLGLMEIEAATEMAKGVLEMIQIE 2253
            L +M    L ++Y  I+  SEN S+ K HLT+++V KY + K+KFGGTLA C+N NA NP AL+ R AD DCY VF D+F+ +I+DYHKV T +I HP ++FGD++HLPF ++ +    + STRVR GRTVKG+ FAPVISKEDR+ L ++I  ALK L GE  G+YY L NMTK + D L+KDHFL+RDDD VLRDAGGYRDWPSGRGIF+N +K F+VW+NEEDHIRIISM+ GG+L +VY RL      LE  LEFE+ +RFG+LTFCP+NLGTTMRASVH KIP +S LPN+KQ+CE+Y +Q+RGT+GEHT  VGGV+D+SN+RRLGLTE++A  EM  GV A++ +EKM+ +YNK  P     VE LEYL+K+I + P +  I KK+LT + + +F+  RTK G+TLAH IRN  YN +A+CPR GDA+CY  F  +++ VIRDYH+V+  ++ HP   FGDL  L F+NLDP G  I+STR+RVGRS+ G+ F  TI+K  R+KLEK + DAL  LTG H GTYY L GM E  +KQL+EDHFLFKDDD VLRDAGGYRDWP+GRGIFHN  KTFL W+ EEDH+RIISM+ GGD+A ++TRLV+GI+ IE K+ F HS  YGYLTCCPSNLGTTMRASVH ++PKLS++K K +EVC ++ +QARG HGEHTES  G+YD+SN+RRLGL E++AA EMAKG+ E+++IE
Sbjct:    2 LLRMAIPDLTKLYTTIHECSENHSITKNHLTQDVVNKYASVKTKFGGTLAQCVNHNASNPGALLPRCADSDCYTVFADFFDAVIRDYHKVTTPKISHPPANFGDLQHLPFGDLSIGNDLVISTRVRLGRTVKGYGFAPVISKEDRIALEQKIVAALKTLPGEFAGDYYSLGNMTKTEYDSLVKDHFLFRDDDSVLRDAGGYRDWPSGRGIFINKKKNFLVWVNEEDHIRIISMQQGGNLAEVYTRLAEAAGYLERQLEFEKDERFGYLTFCPSNLGTTMRASVHAKIPLVSALPNYKQLCEKYHMQSRGTFGEHTATVGGVYDLSNKRRLGLTELEAVTEMAAGVKALLTLEKMMEEYNKNMPASTWAVEPLEYLSKMILDAPDSRCICKKYLTPDTIKQFDGKRTKFGTTLAHMIRNCAYNPRALCPRLGDAECYETFKGHMEHVIRDYHRVQGDKISHPVPTFGDLSKLPFKNLDPSGKLIISTRVRVGRSVQGYQFGTTINKEARVKLEKELADALMGLTGEHAGTYYSLAGMDEATRKQLVEDHFLFKDDDSVLRDAGGYRDWPAGRGIFHNASKTFLCWIGEEDHLRIISMELGGDLAGIYTRLVKGIQAIEQKVKFCHSDNYGYLTCCPSNLGTTMRASVHARVPKLSANKAKFDEVCKKYGIQARGVHGEHTESIGGVYDLSNERRLGLTELQAACEMAKGIEEILKIE 717          

HSP 2 Score: 384.8 bits (987), Expect = 1.216e-117
Identity = 181/375 (48.27%), Postives = 253/375 (67.47%), Query Frame = 1
Query:   64 LKLFLRFPKIYSAYLRKMEYKS-----LDEIYDMIYSNSENKSLAKKHLTKEIVAKYKNTKSKFGGTLAMCLNTNAYNPRALMCRTADPDCYDVFGDYFNELIKDYHKVATKEIEHPASDFGDIEHLPFKNMDVDKVYINSTRVRFGRTVKGFAFAPVISKEDRVTLSEQIANALKNLTGELQGNYYGLDNMTKEKQDELIKDHFLYRDDDQVLRDAGGYRDWPSGRGIFLNNEKTFVVWINEEDHIRIISMEPGGDLPKVYRRLIAGLKGLEENLEFERHKRFGFLTFCPTNLGTTMRASVHIKIPFLSM-LPNFKQICEQYSLQARGTYGEHTENVGGVFDISNQRRLGLTEIQAAKEMYDGVNAIIAIEKML 1170
            +K  L   K+   Y + M   +     L+ +  MI    +++ + KK+LT + + ++   ++KFG TLA  +   AYNPRAL  R  D +CY+ F  +   +I+DYH+V   +I HP   FGD+  LPFKN+D     I STRVR GR+V+G+ F   I+KE RV L +++A+AL  LTGE  G YY L  M +  + +L++DHFL++DDD VLRDAGGYRDWP+GRGIF N  KTF+ WI EEDH+RIISME GGDL  +Y RL+ G++ +E+ ++F     +G+LT CP+NLGTTMRASVH ++P LS     F ++C++Y +QARG +GEHTE++GGV+D+SN+RRLGLTE+QAA EM  G+  I+ IE  L
Sbjct:  346 VKALLTLEKMMEEYNKNMPASTWAVEPLEYLSKMILDAPDSRCICKKYLTPDTIKQFDGKRTKFGTTLAHMIRNCAYNPRALCPRLGDAECYETFKGHMEHVIRDYHRVQGDKISHPVPTFGDLSKLPFKNLDPSGKLIISTRVRVGRSVQGYQFGTTINKEARVKLEKELADALMGLTGEHAGTYYSLAGMDEATRKQLVEDHFLFKDDDSVLRDAGGYRDWPAGRGIFHNASKTFLCWIGEEDHLRIISMELGGDLAGIYTRLVKGIQAIEQKVKFCHSDNYGYLTCCPSNLGTTMRASVHARVPKLSANKAKFDEVCKKYGIQARGVHGEHTESIGGVYDLSNERRLGLTELQAACEMAKGIEEILKIEASL 720          
BLAST of Taurocyamine kinase vs. TrEMBL
Match: S4VGM4 (Taurocyamine kinase OS=Dugesia sp. BJR-2013 OX=1350396 PE=2 SV=1)

HSP 1 Score: 939.488 bits (2427), Expect = 0.000e+0
Identity = 442/713 (61.99%), Postives = 558/713 (78.26%), Query Frame = 1
Query:  115 MEYKSLDEIYDMIYSNSENKSLAKKHLTKEIVAKYKNTKSKFGGTLAMCLNTNAYNPRALMCRTADPDCYDVFGDYFNELIKDYHKVATKEIEHPASDFGDIEHLPFKNMDVDKVYINSTRVRFGRTVKGFAFAPVISKEDRVTLSEQIANALKNLTGELQGNYYGLDNMTKEKQDELIKDHFLYRDDDQVLRDAGGYRDWPSGRGIFLNNEKTFVVWINEEDHIRIISMEPGGDLPKVYRRLIAGLKGLEENLEFERHKRFGFLTFCPTNLGTTMRASVHIKIPFLSMLPNFKQICEQYSLQARGTYGEHTENVGGVFDISNQRRLGLTEIQAAKEMYDGVNAIIAIEKMLGKYNKTAPEGIPYVESLEYLAKIIWNDPSNDTITKKHLTKEIVDKFNTIRTKNGSTLAHCIRNSVYNNKAICPRTGDAKCYNCFSEYLDVVIRDYHKVKEPEVRHPNVNFGDLENLGFQNLDPEGSFIMSTRIRVGRSIDGFNFPPTISKVDRLKLEKTIVDALSSLTGIHGGTYYPLTGMKENVQKQLIEDHFLFKDDDPVLRDAGGYRDWPSGRGIFHNNEKTFLVWVCEEDHMRIISMQKGGDIAAVFTRLVQGIRQIETKLTFAHSKKYGYLTCCPSNLGTTMRASVHLKIPKLSSDKTKLNEVCDRFNLQARGFHGEHTESPEGIYDISNKRRLGLMEIEAATEMAKGVLEMIQIE 2253
            M+  +L+E+Y  I +   +KS  KKHLTKEIV KYKN K+  GG+LA+C+ TN+ NP A++ R AD DCY+VF D+F  +IKDYHK+ T  + HP  +FG++++L + N+D    ++ STRVR GRTV+GFAFAP+I+K +R+ L ++I  AL  L+ EL GNYY L +M +   D+L+ DHF +RDDD VLRDAGGYRDWP+GRGI+LN++  F+VW+NEEDH+RIISME GGDL +VYRRL+ G+K LEENL F RH+R+G+LTFCP+NLGTTMRASVH++IP +S LPNFK+IC++Y LQARGTYGEHTE++GG++D+SNQRRLG TEI+AA+EM  GV  I+ +E  + ++NK   + +  VESLEY+ K++ N   N ++TKK+LT E + K   +RT  G++LAHC+RN  YN +A+CPRTGDA+CY  F EYLD++I DYH V +   +HP+  FGD   L F +LDP G  I+STR+RVGRSI GFNFPPTI K  RL+LE  + +AL  L G   G YYPLTGM E  QKQLI+DHFLFKDDDPVLRDAGGYRDWPSGRGIFHN  KTFLVWVCEEDH+RIISMQKGGD+  V+ RLV GIR IE K+ FAH KKYGYLTCCPSNLGTTMRASVH+KIPKLSS++ K +EVCD+++LQARG +GEHTES  G+YDISNK RLGL E++AATEMA GV  +I IE
Sbjct:    1 MDVPTLEELYHKIQNCKSSKSFTKKHLTKEIVDKYKNVKTDLGGSLALCVRTNSMNPGAMLPRCADIDCYNVFTDFFEAVIKDYHKITTPSVRHPEPNFGNLDNLGWGNLDPTGKFVVSTRVRVGRTVQGFAFAPLITKTERLELEQRIIKALNKLSEELNGNYYPLSSMNRYTYDKLVDDHFFFRDDDSVLRDAGGYRDWPTGRGIYLNHKNNFLVWVNEEDHLRIISMESGGDLSRVYRRLVKGIKTLEENLGFARHQRYGYLTFCPSNLGTTMRASVHVRIPMVSSLPNFKEICQKYQLQARGTYGEHTESLGGIYDLSNQRRLGYTEIEAAQEMAVGVKEIVELEATMQEFNKNTNKNLMLVESLEYMYKLL-NVSENKSLTKKYLTLEKIKKLKDLRTSKGTSLAHCVRNCAYNPRALCPRTGDAECYTLFQEYLDLIIMDYHLVLDKNFQHPDPFFGDTYKLPFHDLDPSGEHILSTRVRVGRSIKGFNFPPTIDKAQRLRLESIVSEALMGLPGDLSGNYYPLTGMDEKTQKQLIDDHFLFKDDDPVLRDAGGYRDWPSGRGIFHNTNKTFLVWVCEEDHIRIISMQKGGDLPQVYQRLVLGIRTIEEKMPFAHMKKYGYLTCCPSNLGTTMRASVHVKIPKLSSNQAKFSEVCDKYHLQARGLYGEHTESVGGVYDISNKHRLGLTELDAATEMANGVKAIIDIE 712          

HSP 2 Score: 407.142 bits (1045), Expect = 4.475e-126
Identity = 198/353 (56.09%), Postives = 255/353 (72.24%), Query Frame = 1
Query:  115 MEYKSLDEIYDMIYSNSENKSLAKKHLTKEIVAKYKNTKSKFGGTLAMCLNTNAYNPRALMCRTADPDCYDVFGDYFNELIKDYHKVATKEIEHPASDFGDIEHLPFKNMDVDKVYINSTRVRFGRTVKGFAFAPVISKEDRVTLSEQIANALKNLTGELQGNYYGLDNMTKEKQDELIKDHFLYRDDDQVLRDAGGYRDWPSGRGIFLNNEKTFVVWINEEDHIRIISMEPGGDLPKVYRRLIAGLKGLEENLEFERHKRFGFLTFCPTNLGTTMRASVHIKIPFLSM-LPNFKQICEQYSLQARGTYGEHTENVGGVFDISNQRRLGLTEIQAAKEMYDGVNAIIAIEKML 1170
            M  +SL+ +Y ++ + SENKSL KK+LT E + K K+ ++  G +LA C+   AYNPRAL  RT D +CY +F +Y + +I DYH V  K  +HP   FGD   LPF ++D    +I STRVR GR++KGF F P I K  R+ L   ++ AL  L G+L GNYY L  M ++ Q +LI DHFL++DDD VLRDAGGYRDWPSGRGIF N  KTF+VW+ EEDHIRIISM+ GGDLP+VY+RL+ G++ +EE + F   K++G+LT CP+NLGTTMRASVH+KIP LS     F ++C++Y LQARG YGEHTE+VGGV+DISN+ RLGLTE+ AA EM +GV AII IEK L
Sbjct:  364 MLVESLEYMYKLL-NVSENKSLTKKYLTLEKIKKLKDLRTSKGTSLAHCVRNCAYNPRALCPRTGDAECYTLFQEYLDLIIMDYHLVLDKNFQHPDPFFGDTYKLPFHDLDPSGEHILSTRVRVGRSIKGFNFPPTIDKAQRLRLESIVSEALMGLPGDLSGNYYPLTGMDEKTQKQLIDDHFLFKDDDPVLRDAGGYRDWPSGRGIFHNTNKTFLVWVCEEDHIRIISMQKGGDLPQVYQRLVLGIRTIEEKMPFAHMKKYGYLTCCPSNLGTTMRASVHVKIPKLSSNQAKFSEVCDKYHLQARGLYGEHTESVGGVYDISNKHRLGLTELDAATEMANGVKAIIDIEKSL 715          
BLAST of Taurocyamine kinase vs. TrEMBL
Match: A0A183MHL7 (Uncharacterized protein OS=Schistosoma margrebowiei OX=48269 GN=SMRZ_LOCUS15542 PE=3 SV=1)

HSP 1 Score: 936.406 bits (2419), Expect = 0.000e+0
Identity = 432/733 (58.94%), Postives = 566/733 (77.22%), Query Frame = 1
Query:   55 IHILKLFLRFPKIYSAYLRKMEYKSLDEIYDMIYSNSENKSLAKKHLTKEIVAKYKNTKSKFGGTLAMCLNTNAYNPRALMCRTADPDCYDVFGDYFNELIKDYHKVATKEIEHPASDFGDIEHLPFKNMDVDKVYINSTRVRFGRTVKGFAFAPVISKEDRVTLSEQIANALKNLTGELQGNYYGLDNMTKEKQDELIKDHFLYRDDDQVLRDAGGYRDWPSGRGIFLNNEKTFVVWINEEDHIRIISMEPGGDLPKVYRRLIAGLKGLEENLEFERHKRFGFLTFCPTNLGTTMRASVHIKIPFLSMLPNFKQICEQYSLQARGTYGEHTENVGGVFDISNQRRLGLTEIQAAKEMYDGVNAIIAIEKMLGKYNKTAPEGIPYVESLEYLAKIIWNDPSNDTITKKHLTKEIVDKFNTIRTKNGSTLAHCIRNSVYNNKAICPRTGDAKCYNCFSEYLDVVIRDYHKVKEPEVRHPNVNFGDLENLGFQNLDPEGSFIMSTRIRVGRSIDGFNFPPTISKVDRLKLEKTIVDALSSLTGIHGGTYYPLTGMKENVQKQLIEDHFLFKDDDPVLRDAGGYRDWPSGRGIFHNNEKTFLVWVCEEDHMRIISMQKGGDIAAVFTRLVQGIRQIETKLTFAHSKKYGYLTCCPSNLGTTMRASVHLKIPKLSSDKTKLNEVCDRFNLQARGFHGEHTESPEGIYDISNKRRLGLMEIEAATEMAKGVLEMIQIE 2253
            + ++++     +I S Y   M+ +SL  +   I S+  N SL KK+LT +IV KY+ TK+  GGTLA C+NTNAYNP AL+ R+ D + Y+ F D+F+ +I DYHKV + +I+HP SDFGD++ L F +++     + STRVR GRTV+GF F P ++K+ R+ L ++I+ AL+NL+GE +G YY L  M++E + +L+ DHFL+R+DD VL+DAGGY DWP+GRGIF+N +K F+VWINEEDHIR+ISM+ GGDL  VY+RL   ++ L ++L+F  + R GF+TFCP+NLGTT+RASVH KIP L+ LPNFK+ICE++ +Q RGT+GEHTE+VGG++D+SN+RRLGLTE+ A  EM+ GV A++ +E ML +YNK APEG+  VE L YLAK++         T+K+LT EI+ K++  RT +G+TLAH IRN  YN+++ICPRTG+A+CY+ F +YLD +I DYH VK+P  +HP   FGDL  L F +LDP G +I+STR+RVGRS++GF FP  +SK DR+KLE+ I  AL  LTG H GTYYPLT MKE  +KQL+EDHFLFK+DDPVLRDAGGYRDWP GRGIFHNN KTFLVWVCEEDHMRIISMQ+GGD+AAV+ RL++GI  I   + FAHS KYGY+TCCPSNLGT+MRASV LKIPKLSS   KL+E+C ++ LQARG +GEHTESP+G YDISNKRRLGL E++AA EMA+GV +MI+IE
Sbjct:   11 VRLIQVVFVSREIRSLYTINMQVESLHNLQVKIRSDERNHSLTKKYLTDDIVKKYQATKTSLGGTLAHCVNTNAYNPGALLPRSCDLNAYESFRDFFDAVIADYHKVESGKIQHPKSDFGDLKSLSFTDLNAYGNLVVSTRVRLGRTVEGFGFGPTLTKDTRIELEKKISTALRNLSGEYEGTYYPLTGMSEEDRIKLVNDHFLFRNDDNVLKDAGGYIDWPTGRGIFINKQKNFLVWINEEDHIRVISMQKGGDLIAVYKRLAGAIQELSKSLKFAFNDRLGFITFCPSNLGTTLRASVHAKIPMLASLPNFKEICEKHGIQPRGTHGEHTESVGGIYDLSNKRRLGLTELDAVTEMHSGVRALLELEVMLQEYNKGAPEGVMPVEPLTYLAKLLEGASIEKCYTRKYLTPEIIKKYDGRRTTHGATLAHMIRNGAYNHRSICPRTGEAECYSTFIDYLDPLICDYHGVKDPSFKHPAPTFGDLSKLPFGDLDPAGKYIVSTRVRVGRSVEGFLFPTIMSKTDRIKLEQVISGALKGLTGEHAGTYYPLTDMKEEDRKQLVEDHFLFKNDDPVLRDAGGYRDWPVGRGIFHNNSKTFLVWVCEEDHMRIISMQQGGDLAAVYKRLIEGINAIGKSMKFAHSDKYGYITCCPSNLGTSMRASVLLKIPKLSSQPKKLDEICAKYMLQARGLYGEHTESPDGTYDISNKRRLGLTELQAAHEMAEGVAKMIEIE 743          

HSP 2 Score: 378.252 bits (970), Expect = 7.695e-115
Identity = 182/353 (51.56%), Postives = 243/353 (68.84%), Query Frame = 1
Query:  115 MEYKSLDEIYDMIYSNSENKSLAKKHLTKEIVAKYKNTKSKFGGTLAMCLNTNAYNPRALMCRTADPDCYDVFGDYFNELIKDYHKVATKEIEHPASDFGDIEHLPFKNMDVDKVYINSTRVRFGRTVKGFAFAPVISKEDRVTLSEQIANALKNLTGELQGNYYGLDNMTKEKQDELIKDHFLYRDDDQVLRDAGGYRDWPSGRGIFLNNEKTFVVWINEEDHIRIISMEPGGDLPKVYRRLIAGLKGLEENLEFERHKRFGFLTFCPTNLGTTMRASVHIKIPFLSMLPN-FKQICEQYSLQARGTYGEHTENVGGVFDISNQRRLGLTEIQAAKEMYDGVNAIIAIEKML 1170
            M  + L  +  ++   S  K   +K+LT EI+ KY   ++  G TLA  +   AYN R++  RT + +CY  F DY + LI DYH V     +HPA  FGD+  LPF ++D    YI STRVR GR+V+GF F  ++SK DR+ L + I+ ALK LTGE  G YY L +M +E + +L++DHFL+++DD VLRDAGGYRDWP GRGIF NN KTF+VW+ EEDH+RIISM+ GGDL  VY+RLI G+  + ++++F    ++G++T CP+NLGT+MRASV +KIP LS  P    +IC +Y LQARG YGEHTE+  G +DISN+RRLGLTE+QAA EM +GV  +I IEK L
Sbjct:  394 MPVEPLTYLAKLLEGASIEKCYTRKYLTPEIIKKYDGRRTTHGATLAHMIRNGAYNHRSICPRTGEAECYSTFIDYLDPLICDYHGVKDPSFKHPAPTFGDLSKLPFGDLDPAGKYIVSTRVRVGRSVEGFLFPTIMSKTDRIKLEQVISGALKGLTGEHAGTYYPLTDMKEEDRKQLVEDHFLFKNDDPVLRDAGGYRDWPVGRGIFHNNSKTFLVWVCEEDHMRIISMQQGGDLAAVYKRLIEGINAIGKSMKFAHSDKYGYITCCPSNLGTSMRASVLLKIPKLSSQPKKLDEICAKYMLQARGLYGEHTESPDGTYDISNKRRLGLTELQAAHEMAEGVAKMIEIEKGL 746          
BLAST of Taurocyamine kinase vs. Ensembl Cavefish
Match: ckma (creatine kinase M-type [Source:NCBI gene;Acc:103045415])

HSP 1 Score: 249.595 bits (636), Expect = 2.311e-74
Identity = 143/338 (42.31%), Postives = 197/338 (58.28%), Query Frame = 1
Query: 1276 KHLTKEIVDKFNTIRTKNGSTLAHCIRNSVYNNK-----AICPRTGDAKCYNCFSEYLDVVIRDYHKVKEPEVRH-PNVNFGDLENLGFQNLDPEGSFIMSTRIRVGRSIDGFNFPPTISKVDRLKLEKTIVDALSSLTGIHGGTYYPLTGMKENVQKQLIEDHFLF-KDDDPVLRDAGGYRDWPSGRGIFHNNEKTFLVWVCEEDHMRIISMQKGGDIAAVFTRLVQGIRQIETKLT-----FAHSKKYGYLTCCPSNLGTTMRASVHLKIPKLSSDKTKLNEVCDRFNLQARGFHGEHTESPEGIYDISNKRRLGLMEIEAATEMAKGVLEMIQIE 2253
            K LTKE+  K    +T  G T+   I+  V N        +    GD + Y  F +  D +I D H   +P  +H  ++NF +L+  G  +LDP  ++++S+R+R GRSI G+  PP  S+ +R  +EK  V+AL+SL G   G YYPL  M +  Q+QLI DHFLF K   P+L  AG  RDWP  RGI+HN  KTFLVWV EEDH+R+ISMQKGG++  VF R   G+ +IE         F  ++  GY+  CPSNLGT +R  VH+K+PKLS+   K  E+  R  LQ RG  G  T S  G++DISN  R+G  E++    +  GV  M+++E
Sbjct:   32 KVLTKEMYAKLRDKQTPTGFTVDDVIQTGVDNPGHPFIMTVGCVAGDEESYEVFKDLFDPIISDRHGGYKPTDKHKTDLNFENLK--GGDDLDP--NYVLSSRVRTGRSIKGYALPPHNSRGERRAVEKLSVEALNSLDGEFKGKYYPLKAMTDAEQEQLIADHFLFDKPVSPLLLAAGMARDWPDARGIWHNENKTFLVWVNEEDHLRVISMQKGGNMKEVFKRFCVGLNKIEEVFKKHNHGFMWNEHLGYVLTCPSNLGTGLRGGVHVKLPKLST-HAKFEEILTRLRLQKRGTGGVDTASVGGVFDISNADRIGSSEVDQVQCVVDGVKLMVEME 364          

HSP 2 Score: 246.899 bits (629), Expect = 2.682e-73
Identity = 141/370 (38.11%), Postives = 211/370 (57.03%), Query Frame = 1
Query:  112 KMEYKSLDEIYDMIYSNSENKSLAKKHLTKEIVAKYKNTKSKFGGTLAMCLNTNAYNP-----RALMCRTADPDCYDVFGDYFNELIKDYHKVATKEIEHPASDFGDIEHLPFKNM----DVDKVYINSTRVRFGRTVKGFAFAPVISKEDRVTLSEQIANALKNLTGELQGNYYGLDNMTKEKQDELIKDHFLY-RDDDQVLRDAGGYRDWPSGRGIFLNNEKTFVVWINEEDHIRIISMEPGGDLPKVYRRLIAGLKGLEE-----NLEFERHKRFGFLTFCPTNLGTTMRASVHIKIPFLSMLPNFKQICEQYSLQARGTYGEHTENVGGVFDISNQRRLGLTEIQAAKEMYDGVNAIIAIEKMLGK 1176
            K+ +K  +E  D+   N+       K LTKE+ AK ++ ++  G T+   + T   NP       + C   D + Y+VF D F+ +I D H       +H          L F+N+    D+D  Y+ S+RVR GR++KG+A  P  S+ +R  + +    AL +L GE +G YY L  MT  +Q++LI DHFL+ +    +L  AG  RDWP  RGI+ N  KTF+VW+NEEDH+R+ISM+ GG++ +V++R   GL  +EE     N  F  ++  G++  CP+NLGT +R  VH+K+P LS    F++I  +  LQ RGT G  T +VGGVFDISN  R+G +E+   + + DGV  ++ +EK L K
Sbjct:   11 KLNFKVEEEYPDLTKHNNH----MAKVLTKEMYAKLRDKQTPTGFTVDDVIQTGVDNPGHPFIMTVGCVAGDEESYEVFKDLFDPIISDRHGGYKPTDKHKTD-------LNFENLKGGDDLDPNYVLSSRVRTGRSIKGYALPPHNSRGERRAVEKLSVEALNSLDGEFKGKYYPLKAMTDAEQEQLIADHFLFDKPVSPLLLAAGMARDWPDARGIWHNENKTFLVWVNEEDHLRVISMQKGGNMKEVFKRFCVGLNKIEEVFKKHNHGFMWNEHLGYVLTCPSNLGTGLRGGVHVKLPKLSTHAKFEEILTRLRLQKRGTGGVDTASVGGVFDISNADRIGSSEVDQVQCVVDGVKLMVEMEKKLEK 369          
BLAST of Taurocyamine kinase vs. Ensembl Cavefish
Match: ckma (creatine kinase M-type [Source:NCBI gene;Acc:103045415])

HSP 1 Score: 249.595 bits (636), Expect = 2.311e-74
Identity = 143/338 (42.31%), Postives = 197/338 (58.28%), Query Frame = 1
Query: 1276 KHLTKEIVDKFNTIRTKNGSTLAHCIRNSVYNNK-----AICPRTGDAKCYNCFSEYLDVVIRDYHKVKEPEVRH-PNVNFGDLENLGFQNLDPEGSFIMSTRIRVGRSIDGFNFPPTISKVDRLKLEKTIVDALSSLTGIHGGTYYPLTGMKENVQKQLIEDHFLF-KDDDPVLRDAGGYRDWPSGRGIFHNNEKTFLVWVCEEDHMRIISMQKGGDIAAVFTRLVQGIRQIETKLT-----FAHSKKYGYLTCCPSNLGTTMRASVHLKIPKLSSDKTKLNEVCDRFNLQARGFHGEHTESPEGIYDISNKRRLGLMEIEAATEMAKGVLEMIQIE 2253
            K LTKE+  K    +T  G T+   I+  V N        +    GD + Y  F +  D +I D H   +P  +H  ++NF +L+  G  +LDP  ++++S+R+R GRSI G+  PP  S+ +R  +EK  V+AL+SL G   G YYPL  M +  Q+QLI DHFLF K   P+L  AG  RDWP  RGI+HN  KTFLVWV EEDH+R+ISMQKGG++  VF R   G+ +IE         F  ++  GY+  CPSNLGT +R  VH+K+PKLS+   K  E+  R  LQ RG  G  T S  G++DISN  R+G  E++    +  GV  M+++E
Sbjct:   32 KVLTKEMYAKLRDKQTPTGFTVDDVIQTGVDNPGHPFIMTVGCVAGDEESYEVFKDLFDPIISDRHGGYKPTDKHKTDLNFENLK--GGDDLDP--NYVLSSRVRTGRSIKGYALPPHNSRGERRAVEKLSVEALNSLDGEFKGKYYPLKAMTDAEQEQLIADHFLFDKPVSPLLLAAGMARDWPDARGIWHNENKTFLVWVNEEDHLRVISMQKGGNMKEVFKRFCVGLNKIEEVFKKHNHGFMWNEHLGYVLTCPSNLGTGLRGGVHVKLPKLST-HAKFEEILTRLRLQKRGTGGVDTASVGGVFDISNADRIGSSEVDQVQCVVDGVKLMVEME 364          

HSP 2 Score: 246.899 bits (629), Expect = 2.682e-73
Identity = 141/370 (38.11%), Postives = 211/370 (57.03%), Query Frame = 1
Query:  112 KMEYKSLDEIYDMIYSNSENKSLAKKHLTKEIVAKYKNTKSKFGGTLAMCLNTNAYNP-----RALMCRTADPDCYDVFGDYFNELIKDYHKVATKEIEHPASDFGDIEHLPFKNM----DVDKVYINSTRVRFGRTVKGFAFAPVISKEDRVTLSEQIANALKNLTGELQGNYYGLDNMTKEKQDELIKDHFLY-RDDDQVLRDAGGYRDWPSGRGIFLNNEKTFVVWINEEDHIRIISMEPGGDLPKVYRRLIAGLKGLEE-----NLEFERHKRFGFLTFCPTNLGTTMRASVHIKIPFLSMLPNFKQICEQYSLQARGTYGEHTENVGGVFDISNQRRLGLTEIQAAKEMYDGVNAIIAIEKMLGK 1176
            K+ +K  +E  D+   N+       K LTKE+ AK ++ ++  G T+   + T   NP       + C   D + Y+VF D F+ +I D H       +H          L F+N+    D+D  Y+ S+RVR GR++KG+A  P  S+ +R  + +    AL +L GE +G YY L  MT  +Q++LI DHFL+ +    +L  AG  RDWP  RGI+ N  KTF+VW+NEEDH+R+ISM+ GG++ +V++R   GL  +EE     N  F  ++  G++  CP+NLGT +R  VH+K+P LS    F++I  +  LQ RGT G  T +VGGVFDISN  R+G +E+   + + DGV  ++ +EK L K
Sbjct:   11 KLNFKVEEEYPDLTKHNNH----MAKVLTKEMYAKLRDKQTPTGFTVDDVIQTGVDNPGHPFIMTVGCVAGDEESYEVFKDLFDPIISDRHGGYKPTDKHKTD-------LNFENLKGGDDLDPNYVLSSRVRTGRSIKGYALPPHNSRGERRAVEKLSVEALNSLDGEFKGKYYPLKAMTDAEQEQLIADHFLFDKPVSPLLLAAGMARDWPDARGIWHNENKTFLVWVNEEDHLRVISMQKGGNMKEVFKRFCVGLNKIEEVFKKHNHGFMWNEHLGYVLTCPSNLGTGLRGGVHVKLPKLSTHAKFEEILTRLRLQKRGTGGVDTASVGGVFDISNADRIGSSEVDQVQCVVDGVKLMVEMEKKLEK 369          
BLAST of Taurocyamine kinase vs. Ensembl Cavefish
Match: ckba (creatine kinase B-type [Source:NCBI gene;Acc:103021922])

HSP 1 Score: 247.284 bits (630), Expect = 1.610e-73
Identity = 141/338 (41.72%), Postives = 199/338 (58.88%), Query Frame = 1
Query: 1276 KHLTKEIVDKFNTIRTKNGSTLAHCIRNSVYNNK-----AICPRTGDAKCYNCFSEYLDVVIRDYHKVKEPEVRH-PNVNFGDLENLGFQNLDPEGSFIMSTRIRVGRSIDGFNFPPTISKVDRLKLEKTIVDALSSLTGIHGGTYYPLTGMKENVQKQLIEDHFLF-KDDDPVLRDAGGYRDWPSGRGIFHNNEKTFLVWVCEEDHMRIISMQKGGDIAAVFTRLVQGIRQIETKL-----TFAHSKKYGYLTCCPSNLGTTMRASVHLKIPKLSSDKTKLNEVCDRFNLQARGFHGEHTESPEGIYDISNKRRLGLMEIEAATEMAKGVLEMIQIE 2253
            K LT  + ++  + +T +G TL   I+  V N        +    GD + Y  F E LD VI D H   +P  +H  ++N  +L+  G  +LDP  ++++S+R+R GRSI GF  PP  S+ +R  +EK  V+AL SL+G   G YY L  M E  Q+QLI+DHFLF K   P+L  +G  RDWP  RGI+HN+ KTFLVWV EEDH+R+ISMQKGG++  VF R   G+ +IE        +F  ++  GY+  CPSNLGT +R  VH+K+P +S   +K  E+  +  LQ RG  G  T +  G++DISN  RLG  E+E    +  GV  +I++E
Sbjct:   32 KVLTPAMYERLRSKQTPSGFTLDDVIQTGVDNPGHPFIMTVGCVAGDEETYEVFKELLDPVIEDRHGGYKPSDKHKTDLNPDNLK--GGDDLDP--NYVLSSRVRTGRSIRGFCLPPHCSRGERRGIEKLSVEALGSLSGDLKGKYYALKNMTEAEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDSKTFLVWVNEEDHLRVISMQKGGNMKEVFNRFCTGLTKIEELFKNKGHSFMWNEHLGYVLTCPSNLGTGLRGGVHVKLPNVSK-HSKFEEILKKLRLQKRGTGGVDTAAVGGVFDISNADRLGFSEVELVQMVVDGVKLLIEME 364          

HSP 2 Score: 239.195 bits (609), Expect = 1.421e-70
Identity = 137/367 (37.33%), Postives = 211/367 (57.49%), Query Frame = 1
Query:  112 KMEYKSLDEIYDMIYSNSENKSLAKKHLTKEIVAKYKNTKSKFGGTLAMCLNTNAYNP-----RALMCRTADPDCYDVFGDYFNELIKDYHKVATKEIEHPASDFGDIEHLPFKNMD-VDKVYINSTRVRFGRTVKGFAFAPVISKEDRVTLSEQIANALKNLTGELQGNYYGLDNMTKEKQDELIKDHFLY-RDDDQVLRDAGGYRDWPSGRGIFLNNEKTFVVWINEEDHIRIISMEPGGDLPKVYRRLIAGLKGLEENLEFERH-----KRFGFLTFCPTNLGTTMRASVHIKIPFLSMLPNFKQICEQYSLQARGTYGEHTENVGGVFDISNQRRLGLTEIQAAKEMYDGVNAIIAIEKMLGK 1176
            KM+Y S  E  D+   +  N  +AK  LT  +  + ++ ++  G TL   + T   NP       + C   D + Y+VF +  + +I+D H       +H      D+     K  D +D  Y+ S+RVR GR+++GF   P  S+ +R  + +    AL +L+G+L+G YY L NMT+ +Q +LI DHFL+ +    +L  +G  RDWP  RGI+ N+ KTF+VW+NEEDH+R+ISM+ GG++ +V+ R   GL  +EE  + + H     +  G++  CP+NLGT +R  VH+K+P +S    F++I ++  LQ RGT G  T  VGGVFDISN  RLG +E++  + + DGV  +I +EK L K
Sbjct:   11 KMKYSSEAEYPDL---SKHNNHMAKV-LTPAMYERLRSKQTPSGFTLDDVIQTGVDNPGHPFIMTVGCVAGDEETYEVFKELLDPVIEDRHGGYKPSDKHKT----DLNPDNLKGGDDLDPNYVLSSRVRTGRSIRGFCLPPHCSRGERRGIEKLSVEALGSLSGDLKGKYYALKNMTEAEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDSKTFLVWVNEEDHLRVISMQKGGNMKEVFNRFCTGLTKIEELFKNKGHSFMWNEHLGYVLTCPSNLGTGLRGGVHVKLPNVSKHSKFEEILKKLRLQKRGTGGVDTAAVGGVFDISNADRLGFSEVELVQMVVDGVKLLIEMEKRLEK 369          
BLAST of Taurocyamine kinase vs. Ensembl Cavefish
Match: ckmb (creatine kinase, muscle b [Source:ZFIN;Acc:ZDB-GENE-040426-2128])

HSP 1 Score: 248.44 bits (633), Expect = 1.999e-73
Identity = 142/338 (42.01%), Postives = 199/338 (58.88%), Query Frame = 1
Query: 1276 KHLTKEIVDKFNTIRTKNGSTLAHCIRNSVYNN-----KAICPRTGDAKCYNCFSEYLDVVIRDYHKVKEP-EVRHPNVNFGDLENLGFQNLDPEGSFIMSTRIRVGRSIDGFNFPPTISKVDRLKLEKTIVDALSSLTGIHGGTYYPLTGMKENVQKQLIEDHFLF-KDDDPVLRDAGGYRDWPSGRGIFHNNEKTFLVWVCEEDHMRIISMQKGGDIAAVFTRLVQGIRQIETKLT-----FAHSKKYGYLTCCPSNLGTTMRASVHLKIPKLSSDKTKLNEVCDRFNLQARGFHGEHTESPEGIYDISNKRRLGLMEIEAATEMAKGVLEMIQIE 2253
            K LTK+I +K     T +G T+   I+  V N        +    GD + Y  F + LD VI D H   +P +  H ++N+ +L+  G  +LDP  ++++S+R+R GRS+ GF  PP  S+ +R  +EK  ++ALS L G   G YYPL  M +  Q+QLI DHFLF K   P+L  AG  RDWP  RGI+HN+ KTFLVWV EEDH+R+ISMQ GG++  VF R   G+++IE         F  ++  G++  CPSNLGT +R  VH+K+PKLS+   K  E+  R  LQ RG  G  T S  G++DISN  RLG  E++    +  GV  M+++E
Sbjct:   31 KVLTKDIYNKLRGKSTPSGFTVDDVIQTGVDNPGHPFIMTVGCVAGDEESYEVFKDLLDPVISDRHGGYKPTDKHHTDLNWENLK--GGDDLDP--NYVLSSRVRTGRSLKGFTLPPHNSRGERRAVEKLSIEALSVLDGEFKGKYYPLKDMTDKEQEQLIADHFLFDKPVSPLLLAAGMARDWPDARGIWHNDNKTFLVWVNEEDHLRVISMQLGGNMKEVFKRFCTGLQKIEETFKKHNHGFMWNEHLGFILTCPSNLGTGLRGGVHVKLPKLST-HAKFEEILTRLRLQKRGTGGVDTASVGGVFDISNADRLGSSEVQQVQLVVDGVKLMVEME 363          

HSP 2 Score: 246.128 bits (627), Expect = 1.730e-72
Identity = 141/375 (37.60%), Postives = 212/375 (56.53%), Query Frame = 1
Query:  112 KMEYKSLDEIYDMIYSNSENKSLAKKHLTKEIVAKYKNTKSKFGGTLAMCLNTNAYNP-----RALMCRTADPDCYDVFGDYFNELIKDYHKVATKEIEHPASDFGDIEHLPFKNM----DVDKVYINSTRVRFGRTVKGFAFAPVISKEDRVTLSEQIANALKNLTGELQGNYYGLDNMTKEKQDELIKDHFLY-RDDDQVLRDAGGYRDWPSGRGIFLNNEKTFVVWINEEDHIRIISMEPGGDLPKVYRRLIAGLKGLEENLEFERH-----KRFGFLTFCPTNLGTTMRASVHIKIPFLSMLPNFKQICEQYSLQARGTYGEHTENVGGVFDISNQRRLGLTEIQAAKEMYDGVNAIIAIEKMLGKYNKTA 1191
            KM++   +E  D+   N+       K LTK+I  K +   +  G T+   + T   NP       + C   D + Y+VF D  + +I D H       +H          L ++N+    D+D  Y+ S+RVR GR++KGF   P  S+ +R  + +    AL  L GE +G YY L +MT ++Q++LI DHFL+ +    +L  AG  RDWP  RGI+ N+ KTF+VW+NEEDH+R+ISM+ GG++ +V++R   GL+ +EE  +   H     +  GF+  CP+NLGT +R  VH+K+P LS    F++I  +  LQ RGT G  T +VGGVFDISN  RLG +E+Q  + + DGV  ++ +EK L K ++T 
Sbjct:   10 KMKFSLEEEFPDLSLHNNH----MAKVLTKDIYNKLRGKSTPSGFTVDDVIQTGVDNPGHPFIMTVGCVAGDEESYEVFKDLLDPVISDRHGGYKPTDKHHTD-------LNWENLKGGDDLDPNYVLSSRVRTGRSLKGFTLPPHNSRGERRAVEKLSIEALSVLDGEFKGKYYPLKDMTDKEQEQLIADHFLFDKPVSPLLLAAGMARDWPDARGIWHNDNKTFLVWVNEEDHLRVISMQLGGNMKEVFKRFCTGLQKIEETFKKHNHGFMWNEHLGFILTCPSNLGTGLRGGVHVKLPKLSTHAKFEEILTRLRLQKRGTGGVDTASVGGVFDISNADRLGSSEVQQVQLVVDGVKLMVEMEKKLEKCSRTT 373          
BLAST of Taurocyamine kinase vs. Ensembl Cavefish
Match: ckmt2b (creatine kinase S-type, mitochondrial [Source:NCBI gene;Acc:103038758])

HSP 1 Score: 247.669 bits (631), Expect = 3.060e-73
Identity = 138/340 (40.59%), Postives = 196/340 (57.65%), Query Frame = 1
Query:  193 LTKEIVAKYKNTKSKFGGTLAMCLNTNAYNPRALMCRT-----ADPDCYDVFGDYFNELIKDYHK-VATKEIEHPASDFGDIEHLPFKNMDVDKVYINSTRVRFGRTVKGFAFAPVISKEDRVTLSEQIANALKNLTGELQGNYYGLDNMTKEKQDELIKDHFLY-RDDDQVLRDAGGYRDWPSGRGIFLNNEKTFVVWINEEDHIRIISMEPGGDLPKVYRRLIAGLK---GL--EENLEFERHKRFGFLTFCPTNLGTTMRASVHIKIPFLSMLPNFKQICEQYSLQARGTYGEHTENVGGVFDISNQRRLGLTEIQAAKEMYDGVNAIIAIEKMLGK 1176
            LT  I A+ ++  +    TL  C+ T   NP     +T      D + Y+VF D FN +IKD H       + HP     D++     +   D+ Y+ S+RVR GR+++G +  P  ++ +R  +   +  AL  L G+L G YY L +MT ++Q +LI DHFL+ +    +L  AG  RDWP  RGI+ NNEKTF++WINEEDH R+ISME GG++ +V+ R   GLK   GL  E   EF  ++  G++  CP+NLGT +RA VH+++P LS  P F +I +   LQ RGT G  T  VG  FDISN  RLG +E++  + + DGVN +I  EK L K
Sbjct:   66 LTPAIYARLRDKLTPNDWTLDQCIQTGVDNPGHPFIKTVGMVAGDEESYEVFADLFNPVIKDRHNGYDPTTMRHPT----DLDSSKLTSGMFDERYVLSSRVRTGRSIRGLSLPPACTRSERREVERVVVQALSGLKGDLAGKYYSLTDMTDKEQQQLIDDHFLFDKPVSPLLTCAGMARDWPDARGIWHNNEKTFLIWINEEDHTRVISMEKGGNMKRVFERFCRGLKQVEGLIQERGWEFMWNEHLGYILTCPSNLGTGLRAGVHVRLPLLSKDPRFSKILDNLRLQKRGTGGVDTAAVGDTFDISNLDRLGKSEVELVQCVVDGVNFLIECEKRLEK 401          

HSP 2 Score: 232.261 bits (591), Expect = 1.707e-67
Identity = 135/336 (40.18%), Postives = 195/336 (58.04%), Query Frame = 1
Query: 1282 LTKEIVDKFNTIRTKNGSTLAHCIRNSVYNN-----KAICPRTGDAKCYNCFSEYLDVVIRDYHKVKEPE-VRHPNVNFGDLENLGFQNLDPEGSFIMSTRIRVGRSIDGFNFPPTISKVDRLKLEKTIVDALSSLTGIHGGTYYPLTGMKENVQKQLIEDHFLF-KDDDPVLRDAGGYRDWPSGRGIFHNNEKTFLVWVCEEDHMRIISMQKGGDIAAVFTRLVQGIRQIETKLT-----FAHSKKYGYLTCCPSNLGTTMRASVHLKIPKLSSDKTKLNEVCDRFNLQARGFHGEHTESPEGIYDISNKRRLGLMEIEAATEMAKGVLEMIQIE 2253
            LT  I  +     T N  TL  CI+  V N      K +    GD + Y  F++  + VI+D H   +P  +RHP     DL++    +   +  +++S+R+R GRSI G + PP  ++ +R ++E+ +V ALS L G   G YY LT M +  Q+QLI+DHFLF K   P+L  AG  RDWP  RGI+HNNEKTFL+W+ EEDH R+ISM+KGG++  VF R  +G++Q+E  +      F  ++  GY+  CPSNLGT +RA VH+++P LS D  + +++ D   LQ RG  G  T +    +DISN  RLG  E+E    +  GV  +I+ E
Sbjct:   66 LTPAIYARLRDKLTPNDWTLDQCIQTGVDNPGHPFIKTVGMVAGDEESYEVFADLFNPVIKDRHNGYDPTTMRHPT----DLDSSKLTSGMFDERYVLSSRVRTGRSIRGLSLPPACTRSERREVERVVVQALSGLKGDLAGKYYSLTDMTDKEQQQLIDDHFLFDKPVSPLLTCAGMARDWPDARGIWHNNEKTFLIWINEEDHTRVISMEKGGNMKRVFERFCRGLKQVEGLIQERGWEFMWNEHLGYILTCPSNLGTGLRAGVHVRLPLLSKDP-RFSKILDNLRLQKRGTGGVDTAAVGDTFDISNLDRLGKSEVELVQCVVDGVNFLIECE 396          
BLAST of Taurocyamine kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005045.1 (pep scaffold:Pmarinus_7.0:GL495569:1868:3379:-1 gene:ENSPMAG00000004586.1 transcript:ENSPMAT00000005045.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 93.9745 bits (232), Expect = 4.798e-23
Identity = 47/104 (45.19%), Postives = 63/104 (60.58%), Query Frame = 1
Query:  865 EENLEFERHKRFGFLTFCPTNLGTTMRASVHIKIPFLSMLPNFKQICEQYSLQARGTYGEHTENVGGVFDISNQRRLGLTEIQAAKEMYDGVNAIIAIEKMLGK 1176
            E   EF  ++R G++  CP+NLGT +RA VH+K+P LS    F QI +   LQ RGT G  +   G  FDISN  RLG +E++  + + DGVN +I  EK L K
Sbjct:    8 ERGWEFMWNERLGYILTCPSNLGTGLRAGVHVKLPHLSKDKRFSQILDNLRLQKRGTGGVDSATTGDTFDISNLDRLGKSEVELVQLVVDGVNYLIECEKKLEK 111          

HSP 2 Score: 77.0258 bits (188), Expect = 4.556e-17
Identity = 39/95 (41.05%), Postives = 57/95 (60.00%), Query Frame = 1
Query: 1969 FAHSKKYGYLTCCPSNLGTTMRASVHLKIPKLSSDKTKLNEVCDRFNLQARGFHGEHTESPEGIYDISNKRRLGLMEIEAATEMAKGVLEMIQIE 2253
            F  +++ GY+  CPSNLGT +RA VH+K+P LS DK + +++ D   LQ RG  G  + +    +DISN  RLG  E+E    +  GV  +I+ E
Sbjct:   13 FMWNERLGYILTCPSNLGTGLRAGVHVKLPHLSKDK-RFSQILDNLRLQKRGTGGVDSATTGDTFDISNLDRLGKSEVELVQLVVDGVNYLIECE 106          
BLAST of Taurocyamine kinase vs. Ensembl Nematostella
Match: EDO34237 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPV7])

HSP 1 Score: 600.897 bits (1548), Expect = 0.000e+0
Identity = 302/698 (43.27%), Postives = 449/698 (64.33%), Query Frame = 1
Query:  184 KKHLTKEIVAKYKNTKSKFGGTLAMCLNTNAYN-PRALMCRTADPDCYDVFGDYFNELIKDYHKVATKEIEHPASDFGDIEHLPFKNMDVDKVYINSTRVRFGRTVKGFAFAPVISKEDRVTLSEQIANALKNLTGELQGNYYGLDNMTKEKQDELIKDHFLYRDDDQVLRDAGGYRDWPSGRGIFLNNEKTFVVWINEEDHIRIISMEPGGDLPKVYRRLIAGLKGLEENLEFERHKRFGFLTFCPTNLGTTMRASVHIKIPFLSMLPNFKQICEQYSLQARGTYGEHTENVG---GVFDISNQRRLGLTEIQAAKEMYDGVNAIIAIEKMLGKYNKTAPEGIPYVESLEYLAKIIWNDPSNDTITKKHLTKEIVDKFNTIRTKNGSTLAHCIRNSVYN-NKAICPRTGDAKCYNCFSEYLDVVIRDYHKVKEPEVRHPNVNFGDLENLGFQNLDPEGSFIMSTRIRVGRSIDGFNFPPTISKVDRLKLEKTIVDALSSLTGIHGGTYYPLTGMKENVQKQLIEDHFLFKDDDPVLRDAGGYRDWPSGRGIFHNNEKTFLVWVCEEDHMRIISMQKGGDIAAVFTRLVQGIRQIETKLTFAHSKKYGYLTCCPSNLGTTMRASVHLKIPKLSSDKTKLNEVCDRFNLQARGFHGEHTESP---EGIYDISNKRRLGLMEIEAATEMAKGVLEMIQIE 2253
            KK+LT+E+  + K+ K++ G TL+ C+N+   N          D + Y +F   F+++I+DYH     E +H  SD  + E +   ++D +  +I STR+R  R +KG+A  P +SK+ R+ + E++ N  ++LTG+L G Y+ LD MT+E + +L+ DHFL++  D+ L  AG  + WP GRGIF NN+KTF+VW+NEED +RIISME G D+  V++RL   +  +++ L F+  +  G+L+ CPTNLGT MRASVH+KIP  S  P+F++IC+++ +QARG +GEH+ + G   GVFDISN+RRLGL+E+Q  ++MY+GV  ++ IE+            + + E L+         P   ++ KK+LT+++ +     +T  G+ L  CI + V N +        D +CY  F E  D +I DYH   + E  H +    D E +   NLD EG+FI STRIRV R++ G+   P +++ +R+ +E  +V  L+SLTG   G YYPL+GM E  ++QL++DHFLFK  D  L  AG  + WP GRGIFHNN+KTFLVWV EED +RIISM+ G DI +VF+RL + + +I+ +L FAH + +GYL+ CP+NLGT MRASVH+KIPK +S+     ++CD F++QARG HGEH+ S     G++DISNKRRLGL E++   +M  GV ++++IE
Sbjct:    2 KKYLTEEMFNELKDKKTELGVTLSDCINSGVENLDSGTGIYAGDEESYKLFAPLFDKIIEDYHAPYKLEQKH-TSDM-NPEKVEAPDLDPEGSFIRSTRIRVARNLKGYALTPALSKKARLEIEEKVKNVFESLTGDLAGKYHPLDGMTEETRQQLVNDHFLFKKGDRFLEAAGVNKLWPEGRGIFHNNDKTFLVWVNEEDQLRIISMEMGSDIGSVFKRLCTAVNEIDKQLGFQHTEEHGYLSSCPTNLGTGMRASVHVKIPHASAHPDFQKICDEFHIQARGIHGEHSVSTGADAGVFDISNKRRLGLSEVQCVQDMYNGVKKLLEIERA-----AIEEAHLKFPEDLK--------KPEVKSLLKKYLTEDVFNSLKEKKTSRGAGLYDCINSGVVNLDSGTGVYAADEECYEVFGELFDKIIEDYHAPYKLEENHKSDM--DPEKVDAPNLDAEGAFIRSTRIRVARNLKGYALTPGLTRKERVDVESKVVGVLNSLTGDLAGKYYPLSGMDEATRQQLVDDHFLFKKGDRFLEAAGVNKMWPEGRGIFHNNDKTFLVWVNEEDQLRIISMEMGSDIGSVFSRLCRAVNEIDKQLGFAHKETHGYLSGCPTNLGTGMRASVHVKIPK-ASEHPDFQKICDEFHIQARGIHGEHSVSTGEDAGVFDISNKRRLGLSEVQCVQDMYNGVKKLLEIE 681          

HSP 2 Score: 303.523 bits (776), Expect = 2.783e-91
Identity = 149/337 (44.21%), Postives = 220/337 (65.28%), Query Frame = 1
Query:  166 ENKSLAKKHLTKEIVAKYKNTKSKFGGTLAMCLNTNAYN-PRALMCRTADPDCYDVFGDYFNELIKDYHKVATKEIEHPASDFGDIEHLPFKNMDVDKVYINSTRVRFGRTVKGFAFAPVISKEDRVTLSEQIANALKNLTGELQGNYYGLDNMTKEKQDELIKDHFLYRDDDQVLRDAGGYRDWPSGRGIFLNNEKTFVVWINEEDHIRIISMEPGGDLPKVYRRLIAGLKGLEENLEFERHKRFGFLTFCPTNLGTTMRASVHIKIPFLSMLPNFKQICEQYSLQARGTYGEHTENVG---GVFDISNQRRLGLTEIQAAKEMYDGVNAIIAIEK 1164
            E KSL KK+LT+++    K  K+  G  L  C+N+   N         AD +CY+VFG+ F+++I+DYH     E  H  SD  D E +   N+D +  +I STR+R  R +KG+A  P +++++RV +  ++   L +LTG+L G YY L  M +  + +L+ DHFL++  D+ L  AG  + WP GRGIF NN+KTF+VW+NEED +RIISME G D+  V+ RL   +  +++ L F   +  G+L+ CPTNLGT MRASVH+KIP  S  P+F++IC+++ +QARG +GEH+ + G   GVFDISN+RRLGL+E+Q  ++MY+GV  ++ IEK
Sbjct:  348 EVKSLLKKYLTEDVFNSLKEKKTSRGAGLYDCINSGVVNLDSGTGVYAADEECYEVFGELFDKIIEDYHAPYKLEENH-KSDM-DPEKVDAPNLDAEGAFIRSTRIRVARNLKGYALTPGLTRKERVDVESKVVGVLNSLTGDLAGKYYPLSGMDEATRQQLVDDHFLFKKGDRFLEAAGVNKMWPEGRGIFHNNDKTFLVWVNEEDQLRIISMEMGSDIGSVFSRLCRAVNEIDKQLGFAHKETHGYLSGCPTNLGTGMRASVHVKIPKASEHPDFQKICDEFHIQARGIHGEHSVSTGEDAGVFDISNKRRLGLSEVQCVQDMYNGVKKLLEIEK 682          
BLAST of Taurocyamine kinase vs. Ensembl Nematostella
Match: EDO49262 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGZ5])

HSP 1 Score: 584.334 bits (1505), Expect = 0.000e+0
Identity = 303/703 (43.10%), Postives = 440/703 (62.59%), Query Frame = 1
Query:  172 KSLAKKHLTKEIVAKYKNTKSKFGGTLAMCLNTNAYN-PRALMCRTADPDCYDVFGDYFNELIKDYHKVATKEIEHPASDFGDIEHLPFKNMDVDKVYINSTRVRFGRTVKGFAFAPVISKEDRVTLSEQIANALKNLTGELQGNYYGLDNMTKEKQDELIKDHFLYRDDDQVLRDAGGYRDWPSGRGIFLNNEKTFVVWINEEDHIRIISMEPGGDLPKVYRRLIAGLKGLEENLEFERHKRFGFLTFCPTNLGTTMRASVHIKIPFLSMLPNFKQICEQYSLQARGTYGEHTENVG---GVFDISNQRRLGLTEIQAAKEMYDGVNAIIAIEKM-LGKYNKTAPEGIPYVESLEYLAKIIWNDPSNDTITKKHLTKEIVDKFNTIRTKNGSTLAHCIRNSVYNNKAICP-RTGDAKCYNCFSEYLDVVIRDYHKVKEPEVRHPNVNFGDLENLGFQNLDPEGSFIMSTRIRVGRSIDGFNFPPTISKVDRLKLEKTIVDALSSLTGIHGGTYYPLTGMKENVQKQLIEDHFLFKDDDPVLRDAGGYRDWPSGRGIFHNNEKTFLVWVCEEDHMRIISMQKGGDIAAVFTRLVQGIRQIETKLTFAHSKKYGYLTCCPSNLGTTMRASVHLKIPKLSSDKTKLNEVCDRFNLQARGFHGEHTESP---EGIYDISNKRRLGLMEIEAATEMAKGVLEMIQIE 2253
            K L KK+LT ++  + K  K+K G +L  C+N+   N          D + Y VF   F+++I+DYH     +  H +    D  + P  ++D D  +I STR+R GR +KG+  AP ++K++RV         L +LTG+L G YY L  M +  +++L+ DHFL++  D+ L  AG  ++WP GRGIF NNEKTF+VW+NEED +RIISME G D+  V+ RL   +  L++ L F+  K  G+LT CPTNLGT MRASVH+KIP     P F +ICE++ +QARG +GEH+E+ G   GV+DISN+RRLGL+E+Q  ++MY+GV +++ IE+  + K     PE +              N     ++ KK+LT E+ +     +T  G +L  CI + V N  + C    GD + Y+ FS   D ++  YH   +   +H   +  + E +   NLDP+G FI STRIRV R++ G+   P +++ +R ++EK + + L SLTG   G YYPLTGM E  +++L++DHFLFK  D  L  AG  + WP GRGIFHNN+KTFLVW+ EED +RIISM+KG DI +VF+RL + + +++ KL F H+  +GYL+ CP+NLGT MRASVH+KIPK +S+     ++CD F++QARG HGEH+ S     G++DISNKRRLGL E++   +M  GV ++++IE
Sbjct:   28 KCLLKKYLTNQVFDQLKTKKTKRGVSLWDCINSGVVNLDSGTGVYAGDEESYTVFAPLFDKVIEDYHSPYKLKDGHTSDMNPDRVNAP--DLDPDNRFIRSTRIRVGRNLKGYGLAPSLTKKERVV------GVLTSLTGDLAGKYYPLTGMDEVTREQLVNDHFLFKKGDRFLDAAGCNKEWPEGRGIFHNNEKTFLVWVNEEDQLRIISMEMGSDIGSVFSRLCRAVNELDKKLGFQHTKSHGYLTSCPTNLGTGMRASVHVKIPHAKDHPEFDKICEKFHIQARGIHGEHSESTGEDAGVYDISNKRRLGLSEVQCVQDMYNGVKSLLEIERAAIEKQRSVFPEAL--------------NKEECKSLLKKYLTAEMFNSLKDKKTAKGISLYDCINSGVVNLDSSCGVYAGDEESYSLFSPLFDKIVEHYHAPYKLADKH--TSDMNPEKVTAPNLDPDGVFIRSTRIRVARNLKGYALTPGLTRKERNEIEKKVTEVLCSLTGDLAGKYYPLTGMDEATRQKLVDDHFLFKKGDRFLEAAGVNKLWPEGRGIFHNNDKTFLVWINEEDQLRIISMEKGSDIGSVFSRLCRAVNELDKKLGFQHTDAHGYLSGCPTNLGTGMRASVHVKIPK-ASEHPDFQKICDEFHIQARGIHGEHSVSTGEDAGVFDISNKRRLGLSEVQCVQDMYNGVKKLLEIE 705          

HSP 2 Score: 287.345 bits (734), Expect = 4.787e-85
Identity = 145/346 (41.91%), Postives = 220/346 (63.58%), Query Frame = 1
Query:  139 IYDMIYSNSENKSLAKKHLTKEIVAKYKNTKSKFGGTLAMCLNTNAYN-PRALMCRTADPDCYDVFGDYFNELIKDYHKVATKEIEHPASDFGDIEHLPFKNMDVDKVYINSTRVRFGRTVKGFAFAPVISKEDRVTLSEQIANALKNLTGELQGNYYGLDNMTKEKQDELIKDHFLYRDDDQVLRDAGGYRDWPSGRGIFLNNEKTFVVWINEEDHIRIISMEPGGDLPKVYRRLIAGLKGLEENLEFERHKRFGFLTFCPTNLGTTMRASVHIKIPFLSMLPNFKQICEQYSLQARGTYGEHTENVG---GVFDISNQRRLGLTEIQAAKEMYDGVNAIIAIEK 1164
            ++    +  E KSL KK+LT E+    K+ K+  G +L  C+N+   N   +      D + Y +F   F+++++ YH    K  +   SD  + E +   N+D D V+I STR+R  R +KG+A  P +++++R  + +++   L +LTG+L G YY L  M +  + +L+ DHFL++  D+ L  AG  + WP GRGIF NN+KTF+VWINEED +RIISME G D+  V+ RL   +  L++ L F+     G+L+ CPTNLGT MRASVH+KIP  S  P+F++IC+++ +QARG +GEH+ + G   GVFDISN+RRLGL+E+Q  ++MY+GV  ++ IEK
Sbjct:  363 VFPEALNKEECKSLLKKYLTAEMFNSLKDKKTAKGISLYDCINSGVVNLDSSCGVYAGDEESYSLFSPLFDKIVEHYH-APYKLADKHTSDM-NPEKVTAPNLDPDGVFIRSTRIRVARNLKGYALTPGLTRKERNEIEKKVTEVLCSLTGDLAGKYYPLTGMDEATRQKLVDDHFLFKKGDRFLEAAGVNKLWPEGRGIFHNNDKTFLVWINEEDQLRIISMEKGSDIGSVFSRLCRAVNELDKKLGFQHTDAHGYLSGCPTNLGTGMRASVHVKIPKASEHPDFQKICDEFHIQARGIHGEHSVSTGEDAGVFDISNKRRLGLSEVQCVQDMYNGVKKLLEIEK 706          
BLAST of Taurocyamine kinase vs. Ensembl Nematostella
Match: EDO40626 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6V8])

HSP 1 Score: 462.996 bits (1190), Expect = 9.049e-147
Identity = 268/719 (37.27%), Postives = 396/719 (55.08%), Query Frame = 1
Query:  163 SENKSLAKKHLTKEIVAKYKNTKSKFGGTLAMCLNTNAYNP-----RALMCRTADPDCYDVFGDYFNELIKDYHKVATKEIEHPASDFGDIEHLPFKNMDVDKVYINSTRVRFGRTVKGFAFAPVISKEDRVTLSEQIANALKNLTGELQGNYYGLDNMTKEKQDELIKDHFLY-RDDDQVLRDAGGYRDWPSGRGIFLNNEKTFVVWINEEDHIRIISMEPGGDLPKVYRRLIAGLKGLEENL-----EFERHKRFGFLTFCPTNLGTTMRASVHIKIPFLSMLPNFKQICEQYSLQARGTYGEHTENVGGVFDISNQRRLGLTEIQAAKEMYDGVNAIIAIEKMLGKYNKTAPEGIPYVESLEYLAKIIWNDPSNDTITKKHLTKEIVDKFNTIRTKNGSTLAHCIRNSVYNN-----KAICPRTGDAKCYNCFSEYLDVVIRDYHKVKEPEVRHPNVNFGDLENLGFQNLDPEGSFIMSTRIRVGRSIDGFNFPPTISKVDRLKLEKTIVDALSSLTGIHGGTYYPLTGMKENVQKQLIEDHFLF-KDDDPVLRDAGGYRDWPSGRGIFHNNEKTFLVWVCEEDHMRIISMQKGGDIAAVFTRLVQGIRQIETKLT-----FAHSKKYGYLTCCPSNLGTTMRASVHLKIPKLSSDKTKLNEVCDRFNLQARGFHGEHTESPEGIYDISNKRRLGLMEIEAATEMAKGVLEMIQIE 2253
            S + +   K +TK++  +  N ++  G TL M + T   NP       + C   D + YDVF D F+ +I+  H    K   H  +D  + +HL     D+D+ Y+ S RVR GR+++G    P  ++ +R  + +    AL +L GE +G YY L NMT  +QD+LI DHFL+ +    +L  +   RDWP  RGI+ N+ KTF+VW+NEEDH R+ISM+ GG++ +V+ R   GL  +E+ +     EF  +K  G++  CP+NLGT +R  VH+K+P LS  P F  I     LQ RGT G  T +  G FDISN  RLG +E++  +++ DGV A+I IEK L        +GI   +  + LA    +   ++    K LT  + +  + ++T  G TL   I+  V N        +    GD + Y+ F++  D VI   H   +   +H   +    + +G  +LD +  +++S R+R GRSI G   PP  S+ +R ++EK +  AL+ L G   G YY L  M E  Q QLI+DHFLF K   P+L  +   RDWP  RGI+HN+ KTFLVWV EEDH R+ISMQKGG++  VF R   G+ ++E+ +      F  ++  GY+  CPSNLGT +R  VH+K+P LS+ +   + +     LQ RG  G  T S +G +DISN  RLG  E+E    +  GV  M+++E
Sbjct:   22 STHNNWMAKCMTKDVYQRLSNLRTPSGYTLDMAIQTGVDNPGHPFIMTVGCVAGDEESYDVFADMFDPVIEKRHDGYRKTDMH-KTDL-NPDHL-IGGDDLDEKYVLSCRVRTGRSIRGLGLPPHCTRAERREVEKVSVEALDSLDGEFKGKYYPLSNMTAAEQDQLIDDHFLFDKPVSPLLLASRMARDWPDARGIWHNDNKTFLVWVNEEDHTRVISMQKGGNMKEVFTRFCNGLNKVEKAIKSKGREFMWNKHLGYVLTCPSNLGTGLRGGVHVKLPLLSKEPRFDSILRTLRLQKRGTGGVDTASTDGTFDISNLDRLGTSEVEQVQKVIDGVKALIEIEKALEAGKPI--DGIIPRKPQKMLASNFPDLTKHNNWMAKCLTPAVYNMLSVLKTPTGYTLDMAIQTGVDNPGHPFIMTVGCVAGDEESYDVFADMFDPVIEKRHNGYKKTAKH-KTDLNPSKLIGGDDLDEK--YVLSCRVRTGRSIRGLCLPPWCSRAERREVEKIVTSALAELDGPLAGKYYSLMTMTEAEQDQLIDDHFLFDKPVSPLLLASRMARDWPDARGIWHNDNKTFLVWVNEEDHTRVISMQKGGNMKEVFARFCNGLNKVESLIKSKGYEFMWNEHLGYVLTCPSNLGTGLRGGVHVKLPLLSA-RDDFDSLLKALRLQKRGTGGVDTASTDGTFDISNADRLGTSEVEQVQTVVDGVKLMVELE 731          

HSP 2 Score: 445.277 bits (1144), Expect = 3.685e-140
Identity = 267/745 (35.84%), Postives = 403/745 (54.09%), Query Frame = 1
Query:  148 MIYSN----SENKSLAKKHLTKEIVAKYKNTKSKFGGTLAMCLNTNAYNP-----RALMCRTADPDCYDVFGDYFNELIKDYHKVATKEIEH-----PASDFGDIEHLPFKNMDVDKVYINSTRVRFGRTVKGFAFAPVISKEDRVTLSEQIANALKNLTGELQGNYYGLDNMTKEKQDELIKDHFLY-RDDDQVLRDAGGYRDWPSGRGIFLNNEKTFVVWINEEDHIRIISMEPGGDLPKVYRRLIAGLKGLE-----ENLEFERHKRFGFLTFCPTNLGTTMRASVHIKIPFLSMLPNFKQICEQYSLQARGTYGEHTENVGGVFDISNQRRLGLTEIQAAKEMYDGVNAIIAIEKMLGKYNKTAPEGIPYVESLEYLAKIIWNDPS-----------NDTITKKHLTKEIVDKFNTIRTKNGSTLAHCIRNSVYNNK-----AICPRTGDAKCYNCFSEYLDVVIRDYHKVKEPEVRH-PNVNFGDLENLGFQNLDPEGSFIMSTRIRVGRSIDGFNFPPTISKVDRLKLEKTIVDALSSLTGIHGGTYYPLTGMKENVQKQLIEDHFLF-KDDDPVLRDAGGYRDWPSGRGIFHNNEKTFLVWVCEEDHMRIISMQKGGDIAAVFTRLVQGIRQIETKLT-----FAHSKKYGYLTCCPSNLGTTMRASVHLKIPKLSSDKTKLNEVCDRFNLQARGFHGEHTESPEGIYDISNKRRLGLMEIEAATEMAKGVLEMIQIE 2253
            M+ SN    +++ +   K LT  +       K+  G TL M + T   NP       + C   D + YDVF D F+ +I+  H    K  +H     P+   G          D+D+ Y+ S RVR GR+++G    P  S+ +R  + + + +AL  L G L G YY L  MT+ +QD+LI DHFL+ +    +L  +   RDWP  RGI+ N+ KTF+VW+NEEDH R+ISM+ GG++ +V+ R   GL  +E     +  EF  ++  G++  CP+NLGT +R  VH+K+P LS   +F  + +   LQ RGT G  T +  G FDISN  RLG +E++  + + DGV  ++ +EK L + N      I + E  +   K     P+           ++    K LT+++ +K   ++T +G TL   I+  V N        +    GD + Y  F+  LD VI   H       +H  ++N  +L  +G  +LD   +F++S R+R GRSI G   PP  ++ +R ++EK  VDAL++L G   G YYPL+ M +  Q+QLI DHFLF K   P+L  A   RDWP  RGI+HN+ K FLVWV EEDH R+ISMQ+GG++  VF R   G+++IE  +      F   +  GY+  CPSNLGT +R  VH+K+P +S D  + + + ++  LQ RG  G  T S +G +DISN  R+G  E++   ++  GV  ++++E
Sbjct:  382 MLASNFPDLTKHNNWMAKCLTPAVYNMLSVLKTPTGYTLDMAIQTGVDNPGHPFIMTVGCVAGDEESYDVFADMFDPVIEKRHNGYKKTAKHKTDLNPSKLIG--------GDDLDEKYVLSCRVRTGRSIRGLCLPPWCSRAERREVEKIVTSALAELDGPLAGKYYSLMTMTEAEQDQLIDDHFLFDKPVSPLLLASRMARDWPDARGIWHNDNKTFLVWVNEEDHTRVISMQKGGNMKEVFARFCNGLNKVESLIKSKGYEFMWNEHLGYVLTCPSNLGTGLRGGVHVKLPLLSARDDFDSLLKALRLQKRGTGGVDTASTDGTFDISNADRLGTSEVEQVQTVVDGVKLMVELEKAL-EINVNVKSFI-HSEKKQSKKKQKGKKPALLCDGFPDLSKHNNYMAKFLTRDVYNKLCNLKTPSGFTLDGVIQTGVDNPGHPFIFTVGCVAGDEETYKVFAALLDPVIEARHNGYLKGAKHVTDLNPDNL--VGGDDLD--ANFVLSCRVRTGRSIRGLGLPPHCTRAERREVEKITVDALATLDGPLKGKYYPLSKMTDAEQEQLINDHFLFDKPVSPLLLSARMARDWPDARGIWHNDAKNFLVWVNEEDHTRVISMQQGGNMREVFHRFCNGLKKIEDAMKAKGKEFMWDEHLGYVLTCPSNLGTGLRGGVHVKLPMVSKD-ARFDGILEKLRLQKRGTGGVDTASTDGTFDISNLDRIGFSEVQLVQKVIDGVKILVEME 1111          

HSP 3 Score: 224.172 bits (570), Expect = 1.240e-60
Identity = 125/351 (35.61%), Postives = 192/351 (54.70%), Query Frame = 1
Query:  163 SENKSLAKKHLTKEIVAKYKNTKSKFGGTLAMCLNTNAYNPR-----ALMCRTADPDCYDVFGDYFNELIKDYHKVATKEIEHPASDFGDIEHLPFKNM----DVDKVYINSTRVRFGRTVKGFAFAPVISKEDRVTLSEQIANALKNLTGELQGNYYGLDNMTKEKQDELIKDHFLY-RDDDQVLRDAGGYRDWPSGRGIFLNNEKTFVVWINEEDHIRIISMEPGGDLPKVYRRLIAGLKGLEENL-----EFERHKRFGFLTFCPTNLGTTMRASVHIKIPFLSMLPNFKQICEQYSLQARGTYGEHTENVGGVFDISNQRRLGLTEIQAAKEMYDGVNAIIAIEKML 1170
            S++ +   K LT+++  K  N K+  G TL   + T   NP       + C   D + Y VF    + +I+  H    K  +H       +  L   N+    D+D  ++ S RVR GR+++G    P  ++ +R  + +   +AL  L G L+G YY L  MT  +Q++LI DHFL+ +    +L  A   RDWP  RGI+ N+ K F+VW+NEEDH R+ISM+ GG++ +V+ R   GLK +E+ +     EF   +  G++  CP+NLGT +R  VH+K+P +S    F  I E+  LQ RGT G  T +  G FDISN  R+G +E+Q  +++ DGV  ++ +EK L
Sbjct:  771 SKHNNYMAKFLTRDVYNKLCNLKTPSGFTLDGVIQTGVDNPGHPFIFTVGCVAGDEETYKVFAALLDPVIEARHNGYLKGAKH-------VTDLNPDNLVGGDDLDANFVLSCRVRTGRSIRGLGLPPHCTRAERREVEKITVDALATLDGPLKGKYYPLSKMTDAEQEQLINDHFLFDKPVSPLLLSARMARDWPDARGIWHNDAKNFLVWVNEEDHTRVISMQQGGNMREVFHRFCNGLKKIEDAMKAKGKEFMWDEHLGYVLTCPSNLGTGLRGGVHVKLPMVSKDARFDGILEKLRLQKRGTGGVDTASTDGTFDISNLDRIGFSEVQLVQKVIDGVKILVEMEKKL 1114          
BLAST of Taurocyamine kinase vs. Ensembl Nematostella
Match: EDO34236 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPV6])

HSP 1 Score: 301.597 bits (771), Expect = 4.358e-94
Identity = 153/333 (45.95%), Postives = 212/333 (63.66%), Query Frame = 1
Query: 1270 TKKHLTKEIVDKFNTIRTKNGSTLAHCIRNSVYN-NKAICPRTGDAKCYNCFSEYLDVVIRDYHK-VKEPEVRHPNVNFGDLENLGFQNLDPEGSFIMSTRIRVGRSIDGFNFPPTISKVDRLKLEKTIVDALSSLTGIHGGTYYPLTGMKENVQKQLIEDHFLFKDDDPVLRDAGGYRDWPSGRGIFHNNEKTFLVWVCEEDHMRIISMQKGGDIAAVFTRLVQGIRQIETKLTFAHSKKYGYLTCCPSNLGTTMRASVHLKIPKLSSDKTKLNEVCDRFNLQARGFHGEH---TESPEGIYDISNKRRLGLMEIEAATEMAKGVLEMIQIE 2253
             +K+LTKE+ ++    ++ +G TL  CI++ V N +        D +CY  F+  LD +I DYH   K  +    ++N    E +   NLDP+  FI STRIRV R++ G+   P + +  R++LE  I D L SL G   G YYPL+GM E  ++QL++DHFLFK  D  L  AG  R+WP GRGIFHNN+KTFLVWV EED +RIISM+ G DI +VF RL   + +++ KL F     +GYL+ CP+NLGT MRASVH+KIP  S+      ++CD F++QARG HGEH   T +  G++DISNKRRLGL E++   +M  GV ++++IE
Sbjct:   58 ARKYLTKELFEELKEKKSSSGVTLWDCIKSGVVNLDSGTGVYVADEECYQLFAPLLDKIIEDYHAPYKLSDGHKSDMN---PEAVDAPNLDPDNDFIRSTRIRVARNLKGYRLTPALEQDKRIELESKIKDVLESLEGDLKGKYYPLSGMDEATRQQLVDDHFLFKKGDRFLEAAGVNREWPEGRGIFHNNDKTFLVWVNEEDQLRIISMEMGSDIGSVFRRLCTAVNELDNKLGFQQLPGHGYLSSCPTNLGTGMRASVHVKIPHASA-HPDFQKICDEFHIQARGIHGEHSVSTGADAGVFDISNKRRLGLSEVQCVQDMYNGVKKLLEIE 386          

HSP 2 Score: 296.204 bits (757), Expect = 5.421e-92
Identity = 147/336 (43.75%), Postives = 216/336 (64.29%), Query Frame = 1
Query:  169 NKSLAKKHLTKEIVAKYKNTKSKFGGTLAMCLNTNAYN-PRALMCRTADPDCYDVFGDYFNELIKDYHKVATKEIEHPASDFGDIEHLPFKNMDVDKVYINSTRVRFGRTVKGFAFAPVISKEDRVTLSEQIANALKNLTGELQGNYYGLDNMTKEKQDELIKDHFLYRDDDQVLRDAGGYRDWPSGRGIFLNNEKTFVVWINEEDHIRIISMEPGGDLPKVYRRLIAGLKGLEENLEFERHKRFGFLTFCPTNLGTTMRASVHIKIPFLSMLPNFKQICEQYSLQARGTYGEHTENVG---GVFDISNQRRLGLTEIQAAKEMYDGVNAIIAIEK 1164
             K  A+K+LTKE+  + K  KS  G TL  C+ +   N         AD +CY +F    +++I+DYH    K  +   SD  + E +   N+D D  +I STR+R  R +KG+   P + ++ R+ L  +I + L++L G+L+G YY L  M +  + +L+ DHFL++  D+ L  AG  R+WP GRGIF NN+KTF+VW+NEED +RIISME G D+  V+RRL   +  L+  L F++    G+L+ CPTNLGT MRASVH+KIP  S  P+F++IC+++ +QARG +GEH+ + G   GVFDISN+RRLGL+E+Q  ++MY+GV  ++ IEK
Sbjct:   54 QKVHARKYLTKELFEELKEKKSSSGVTLWDCIKSGVVNLDSGTGVYVADEECYQLFAPLLDKIIEDYH-APYKLSDGHKSDM-NPEAVDAPNLDPDNDFIRSTRIRVARNLKGYRLTPALEQDKRIELESKIKDVLESLEGDLKGKYYPLSGMDEATRQQLVDDHFLFKKGDRFLEAAGVNREWPEGRGIFHNNDKTFLVWVNEEDQLRIISMEMGSDIGSVFRRLCTAVNELDNKLGFQQLPGHGYLSSCPTNLGTGMRASVHVKIPHASAHPDFQKICDEFHIQARGIHGEHSVSTGADAGVFDISNKRRLGLSEVQCVQDMYNGVKKLLEIEK 387          
BLAST of Taurocyamine kinase vs. Ensembl Nematostella
Match: EDO46231 (Cytoplasmic creatine kinase protein; Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQU9])

HSP 1 Score: 263.077 bits (671), Expect = 8.770e-80
Identity = 152/339 (44.84%), Postives = 197/339 (58.11%), Query Frame = 1
Query: 1276 KHLTKEIVDKFNTIRTKNGSTLAHCIRNSVYNNK-----AICPRTGDAKCYNCFSEYLDVVIRDYHKVKEPEVRHPNVNFGDL--ENLGFQNLDPEGSFIMSTRIRVGRSIDGFNFPPTISKVDRLKLEKTIVDALSSLTGIHGGTYYPLTGMKENVQKQLIEDHFLF-KDDDPVLRDAGGYRDWPSGRGIFHNNEKTFLVWVCEEDHMRIISMQKGGDIAAVFTRLVQGIRQIETKLT-----FAHSKKYGYLTCCPSNLGTTMRASVHLKIPKLSSDKTKLNEVCDRFNLQARGFHGEHTESPEGIYDISNKRRLGLMEIEAATEMAKGVLEMIQIE 2253
            K LTKEI        TKNG TL   I+  V N        +    GD + Y+ F+E LD VI   H   +   +H      DL  +NL    LDP+  +++S+R+R GRSI GF  PP  S+ +R  +EK  VDAL+ L G   G YYPL  M +  Q+QLI DHFLF K   P+L  AG  RDWP  RGI+HN  K FLVWV EEDH R+ISM+KGGD+ AVFTR   G+ ++E+ +      F  ++  GY+  CPSNLGT +RA VHLKIP LS D+ +L+ +  +  LQ RG  G  T S  G+YDISN  R+G  E+E    M  GV  +I++E
Sbjct:   29 KVLTKEIYRSLRDKSTKNGFTLDDIIQTGVDNPGHPFIMTVGCVAGDEESYDVFAELLDPVIELRHGGYKKTDKHKT----DLNPDNLKGGALDPK--YVLSSRVRTGRSIRGFCLPPHCSRAERRSVEKISVDALAKLDGEFKGKYYPLNKMTDEEQEQLINDHFLFDKPVSPLLTCAGMARDWPDARGIWHNENKNFLVWVNEEDHTRVISMEKGGDMRAVFTRFCNGLNKVESLIKEAGYEFMWNEHLGYVLTCPSNLGTGLRAGVHLKIPLLSQDEKRLDAILAKLKLQKRGTGGVDTASVGGVYDISNADRIGFSEVELVQGMVDGVGLLIEME 361          

HSP 2 Score: 239.58 bits (610), Expect = 3.382e-71
Identity = 141/372 (37.90%), Postives = 206/372 (55.38%), Query Frame = 1
Query:   91 IYSAYLRKMEYKSLDEIYDMIYSNSENKSLAKKHLTKEIVAKYKNTKSKFGGTLAMCLNTNAYNP-----RALMCRTADPDCYDVFGDYFNELIKDYHKVATKEIEHPASDFGDIEHLPFKNMDVDKVYINSTRVRFGRTVKGFAFAPVISKEDRVTLSEQIANALKNLTGELQGNYYGLDNMTKEKQDELIKDHFLY-RDDDQVLRDAGGYRDWPSGRGIFLNNEKTFVVWINEEDHIRIISMEPGGDLPKVYRRLIAGLKGLEE-----NLEFERHKRFGFLTFCPTNLGTTMRASVHIKIPFLSM-LPNFKQICEQYSLQARGTYGEHTENVGGVFDISNQRRLGLTEIQAAKEMYDGVNAIIAIEKML 1170
            + SAY    ++ + D+  D+    S++ +   K LTKEI    ++  +K G TL   + T   NP       + C   D + YDVF +  + +I+  H    K  +H      D+     K   +D  Y+ S+RVR GR+++GF   P  S+ +R ++ +   +AL  L GE +G YY L+ MT E+Q++LI DHFL+ +    +L  AG  RDWP  RGI+ N  K F+VW+NEEDH R+ISME GGD+  V+ R   GL  +E        EF  ++  G++  CP+NLGT +RA VH+KIP LS        I  +  LQ RGT G  T +VGGV+DISN  R+G +E++  + M DGV  +I +EK L
Sbjct:    4 VKSAY---KQFSADDDFPDL----SQHNNYMAKVLTKEIYRSLRDKSTKNGFTLDDIIQTGVDNPGHPFIMTVGCVAGDEESYDVFAELLDPVIELRHGGYKKTDKHKT----DLNPDNLKGGALDPKYVLSSRVRTGRSIRGFCLPPHCSRAERRSVEKISVDALAKLDGEFKGKYYPLNKMTDEEQEQLINDHFLFDKPVSPLLTCAGMARDWPDARGIWHNENKNFLVWVNEEDHTRVISMEKGGDMRAVFTRFCNGLNKVESLIKEAGYEFMWNEHLGYVLTCPSNLGTGLRAGVHLKIPLLSQDEKRLDAILAKLKLQKRGTGGVDTASVGGVYDISNADRIGFSEVELVQGMVDGVGLLIEMEKRL 364          
BLAST of Taurocyamine kinase vs. Ensembl Medaka
Match: CKM (creatine kinase M-type [Source:NCBI gene;Acc:101163677])

HSP 1 Score: 260.381 bits (664), Expect = 7.481e-78
Identity = 149/338 (44.08%), Postives = 202/338 (59.76%), Query Frame = 1
Query: 1276 KHLTKEIVDKFNTIRTKNGSTLAHCIRNSVYNNK-----AICPRTGDAKCYNCFSEYLDVVIRDYHKVKEPEVRH-PNVNFGDLENLGFQNLDPEGSFIMSTRIRVGRSIDGFNFPPTISKVDRLKLEKTIVDALSSLTGIHGGTYYPLTGMKENVQKQLIEDHFLF-KDDDPVLRDAGGYRDWPSGRGIFHNNEKTFLVWVCEEDHMRIISMQKGGDIAAVFTRLVQGIRQIETKLT-----FAHSKKYGYLTCCPSNLGTTMRASVHLKIPKLSSDKTKLNEVCDRFNLQARGFHGEHTESPEGIYDISNKRRLGLMEIEAATEMAKGVLEMIQIE 2253
            K LTKEI  K     T +G TL   I+  V N        +    GD + Y  F + LD +I D H   +P  +H  ++NF +L+  G  +LDP  ++++S+R+R GRSI GF  PP  S+ +R  +EK  ++ALSSL G   G YYPL GM +  Q+QLI DHFLF K   P+L  +G  RDWP GRGI+HN+ KTFLVWV EEDH+R+ISMQKGG++  VF R   G+++IE         F  ++  GY+  CPSNLGT +R  VH+K+PKLS+   K  E+  R  LQ RG  G  T S  G++DISN  RLG  E++    +  GV  M+++E
Sbjct:   72 KVLTKEIYGKLRGKSTPSGFTLDDVIQTGVDNPGHPFIMTVGCVAGDEESYEVFKDLLDPIISDRHGGYKPTDKHKTDLNFENLK--GGDDLDP--NYVLSSRVRTGRSIKGFTLPPHNSRGERRGIEKLSIEALSSLDGEFKGKYYPLNGMTDAEQEQLIADHFLFDKPVSPLLTCSGMARDWPDGRGIWHNDNKTFLVWVNEEDHLRVISMQKGGNMKEVFRRFCVGLQKIEEIFKKHNHGFMWNEHLGYILTCPSNLGTGLRGGVHVKLPKLST-HPKFEEILTRLRLQKRGTGGVDTASVGGVFDISNADRLGSSEVDQVQLVVDGVKLMVEME 404          

HSP 2 Score: 253.447 bits (646), Expect = 3.077e-75
Identity = 146/370 (39.46%), Postives = 215/370 (58.11%), Query Frame = 1
Query:  112 KMEYKSLDEIYDMIYSNSENKSLAKKHLTKEIVAKYKNTKSKFGGTLAMCLNTNAYNP-----RALMCRTADPDCYDVFGDYFNELIKDYHKVATKEIEHPASDFGDIEHLPFKNM----DVDKVYINSTRVRFGRTVKGFAFAPVISKEDRVTLSEQIANALKNLTGELQGNYYGLDNMTKEKQDELIKDHFLY-RDDDQVLRDAGGYRDWPSGRGIFLNNEKTFVVWINEEDHIRIISMEPGGDLPKVYRRLIAGLKGLEE-----NLEFERHKRFGFLTFCPTNLGTTMRASVHIKIPFLSMLPNFKQICEQYSLQARGTYGEHTENVGGVFDISNQRRLGLTEIQAAKEMYDGVNAIIAIEKMLGK 1176
            KM++ S+DE Y  +   S++ +   K LTKEI  K +   +  G TL   + T   NP       + C   D + Y+VF D  + +I D H       +H          L F+N+    D+D  Y+ S+RVR GR++KGF   P  S+ +R  + +    AL +L GE +G YY L+ MT  +Q++LI DHFL+ +    +L  +G  RDWP GRGI+ N+ KTF+VW+NEEDH+R+ISM+ GG++ +V+RR   GL+ +EE     N  F  ++  G++  CP+NLGT +R  VH+K+P LS  P F++I  +  LQ RGT G  T +VGGVFDISN  RLG +E+   + + DGV  ++ +EK L K
Sbjct:   51 KMKF-SVDEEYPDL---SQHNNHMAKVLTKEIYGKLRGKSTPSGFTLDDVIQTGVDNPGHPFIMTVGCVAGDEESYEVFKDLLDPIISDRHGGYKPTDKHKTD-------LNFENLKGGDDLDPNYVLSSRVRTGRSIKGFTLPPHNSRGERRGIEKLSIEALSSLDGEFKGKYYPLNGMTDAEQEQLIADHFLFDKPVSPLLTCSGMARDWPDGRGIWHNDNKTFLVWVNEEDHLRVISMQKGGNMKEVFRRFCVGLQKIEEIFKKHNHGFMWNEHLGYILTCPSNLGTGLRGGVHVKLPKLSTHPKFEEILTRLRLQKRGTGGVDTASVGGVFDISNADRLGSSEVDQVQLVVDGVKLMVEMEKKLEK 409          
BLAST of Taurocyamine kinase vs. Ensembl Medaka
Match: ENSORLT00000001794.2 (creatine kinase U-type, mitochondrial [Source:NCBI gene;Acc:101164721])

HSP 1 Score: 259.996 bits (663), Expect = 1.080e-77
Identity = 149/382 (39.01%), Postives = 218/382 (57.07%), Query Frame = 1
Query:   91 IYSAYLRKMEYKSLDEI-YDMIY-SNSENKSLAK------KHLTKEIVAKYKNTKSKFGGTLAMCLNTNAYNPRALMCRT-----ADPDCYDVFGDYFNELIKDYHK-VATKEIEHPASDFGDIEHLPFKNMDVDKVYINSTRVRFGRTVKGFAFAPVISKEDRVTLSEQIANALKNLTGELQGNYYGLDNMTKEKQDELIKDHFLY-RDDDQVLRDAGGYRDWPSGRGIFLNNEKTFVVWINEEDHIRIISMEPGGDLPKVYRRLIAGLKGLEE-----NLEFERHKRFGFLTFCPTNLGTTMRASVHIKIPFLSMLPNFKQICEQYSLQARGTYGEHTENVGGVFDISNQRRLGLTEIQAAKEMYDGVNAIIAIEKMLGK 1176
            I +A+L K E+ S   +    IY +++E   L K       HLT  I AK  +  +  G TL   + T   NP     +T      D + Y+VFGD  + +I + H     + ++HP     D++     +   D+ Y+ S+RVR GR+++G +  P  ++ +R  +   + +AL  L G+L G YY L  MT+++Q +LI DHFL+ +    +L  AG  RDWP  RGI+ NNEKTF++W+NEEDH R+ISME GG++ +V+ R   GLK +E        EF  ++R G++  CP+NLGT +RA VH+K+P LS  P F +I +   LQ RGT G  T  VGGVFDISN  RLG +E+Q  + + DGVN ++  EK L K
Sbjct:   26 ITAAFLFKREHVSAGGVPVRRIYPASAEYPDLRKHNNCMASHLTPAIYAKLCDKATPNGFTLDQAIQTGVDNPGHPFIKTVGMVAGDEESYEVFGDLLDPVITERHNGYDPRTMKHPT----DLDASKIHSGQFDERYVLSSRVRTGRSIRGLSLPPACTRAERREVERVVIDALSGLKGDLTGRYYSLTQMTEKEQQQLIDDHFLFDKPVSPLLTCAGMARDWPDARGIWHNNEKTFLIWVNEEDHTRVISMEKGGNMKRVFERFCRGLKEVERLIQERGWEFMWNERLGYILTCPSNLGTGLRAGVHVKLPLLSKDPRFSKILDNLRLQKRGTGGVDTAAVGGVFDISNLDRLGHSEVQLVQTVIDGVNYLVECEKKLEK 403          

HSP 2 Score: 252.292 bits (643), Expect = 7.328e-75
Identity = 138/337 (40.95%), Postives = 198/337 (58.75%), Query Frame = 1
Query: 1279 HLTKEIVDKFNTIRTKNGSTLAHCIRNSVYNN-----KAICPRTGDAKCYNCFSEYLDVVIRDYHKVKEPE-VRHPNVNFGDLENLGFQNLDPEGSFIMSTRIRVGRSIDGFNFPPTISKVDRLKLEKTIVDALSSLTGIHGGTYYPLTGMKENVQKQLIEDHFLF-KDDDPVLRDAGGYRDWPSGRGIFHNNEKTFLVWVCEEDHMRIISMQKGGDIAAVFTRLVQGIRQIETKLT-----FAHSKKYGYLTCCPSNLGTTMRASVHLKIPKLSSDKTKLNEVCDRFNLQARGFHGEHTESPEGIYDISNKRRLGLMEIEAATEMAKGVLEMIQIE 2253
            HLT  I  K     T NG TL   I+  V N      K +    GD + Y  F + LD VI + H   +P  ++HP     DL+     +   +  +++S+R+R GRSI G + PP  ++ +R ++E+ ++DALS L G   G YY LT M E  Q+QLI+DHFLF K   P+L  AG  RDWP  RGI+HNNEKTFL+WV EEDH R+ISM+KGG++  VF R  +G++++E  +      F  +++ GY+  CPSNLGT +RA VH+K+P LS D  + +++ D   LQ RG  G  T +  G++DISN  RLG  E++    +  GV  +++ E
Sbjct:   67 HLTPAIYAKLCDKATPNGFTLDQAIQTGVDNPGHPFIKTVGMVAGDEESYEVFGDLLDPVITERHNGYDPRTMKHPT----DLDASKIHSGQFDERYVLSSRVRTGRSIRGLSLPPACTRAERREVERVVIDALSGLKGDLTGRYYSLTQMTEKEQQQLIDDHFLFDKPVSPLLTCAGMARDWPDARGIWHNNEKTFLIWVNEEDHTRVISMEKGGNMKRVFERFCRGLKEVERLIQERGWEFMWNERLGYILTCPSNLGTGLRAGVHVKLPLLSKD-PRFSKILDNLRLQKRGTGGVDTAAVGGVFDISNLDRLGHSEVQLVQTVIDGVNYLVECE 398          
BLAST of Taurocyamine kinase vs. Ensembl Medaka
Match: CKM (creatine kinase M-type [Source:NCBI gene;Acc:101166239])

HSP 1 Score: 256.144 bits (653), Expect = 9.693e-77
Identity = 147/338 (43.49%), Postives = 200/338 (59.17%), Query Frame = 1
Query: 1276 KHLTKEIVDKFNTIRTKNGSTLAHCIRNSVYNNK-----AICPRTGDAKCYNCFSEYLDVVIRDYHKVKEPEVRH-PNVNFGDLENLGFQNLDPEGSFIMSTRIRVGRSIDGFNFPPTISKVDRLKLEKTIVDALSSLTGIHGGTYYPLTGMKENVQKQLIEDHFLF-KDDDPVLRDAGGYRDWPSGRGIFHNNEKTFLVWVCEEDHMRIISMQKGGDIAAVFTRLVQGIRQIETKLT-----FAHSKKYGYLTCCPSNLGTTMRASVHLKIPKLSSDKTKLNEVCDRFNLQARGFHGEHTESPEGIYDISNKRRLGLMEIEAATEMAKGVLEMIQIE 2253
            K LTKE+  K    +T  G TL   I+  + N        +    GD + Y  F + LD VI D H   +P  +H  ++NF +L+  G  +LDP  ++++S+R+R GRSI G+  PP  S+ +R  +EK  ++ALSSL G   G YYPL  M +  Q+QLI DHFLF K   P+L  AG  RDWP GRGI+HN+ KTFLVWV EEDH+R+ISMQKGG++  VF R   G+++IE         F  ++  GY+  CPSNLGT +R  VH+K+PKLS+   K  E+  R  LQ RG  G  T S  G++DISN  RLG  E+     +  GV  M+++E
Sbjct:   32 KVLTKELYGKMRDKQTPTGFTLDDVIQTGIDNPGHPFIMTVGCVAGDEESYEVFKDLLDPVISDRHGGYKPTDKHKTDLNFENLK--GGDDLDP--NYVLSSRVRTGRSIKGYALPPHNSRGERRAIEKLSIEALSSLDGEFKGKYYPLKSMTDAEQEQLISDHFLFDKPVSPLLTCAGMARDWPDGRGIWHNDNKTFLVWVNEEDHLRVISMQKGGNMREVFRRFCVGLQKIEEIFKKHNHGFMWNEHLGYILTCPSNLGTGLRGGVHVKLPKLST-HPKFEEILTRLRLQKRGTGGVDTASVGGVFDISNADRLGSSEVAQVQLVVDGVKLMVEME 364          

HSP 2 Score: 254.988 bits (650), Expect = 2.202e-76
Identity = 146/370 (39.46%), Postives = 215/370 (58.11%), Query Frame = 1
Query:  112 KMEYKSLDEIYDMIYSNSENKSLAKKHLTKEIVAKYKNTKSKFGGTLAMCLNTNAYNP-----RALMCRTADPDCYDVFGDYFNELIKDYHKVATKEIEHPASDFGDIEHLPFKNM----DVDKVYINSTRVRFGRTVKGFAFAPVISKEDRVTLSEQIANALKNLTGELQGNYYGLDNMTKEKQDELIKDHFLY-RDDDQVLRDAGGYRDWPSGRGIFLNNEKTFVVWINEEDHIRIISMEPGGDLPKVYRRLIAGLKGLEE-----NLEFERHKRFGFLTFCPTNLGTTMRASVHIKIPFLSMLPNFKQICEQYSLQARGTYGEHTENVGGVFDISNQRRLGLTEIQAAKEMYDGVNAIIAIEKMLGK 1176
            K+ Y   DE  D+   +  N  +AK  LTKE+  K ++ ++  G TL   + T   NP       + C   D + Y+VF D  + +I D H       +H          L F+N+    D+D  Y+ S+RVR GR++KG+A  P  S+ +R  + +    AL +L GE +G YY L +MT  +Q++LI DHFL+ +    +L  AG  RDWP GRGI+ N+ KTF+VW+NEEDH+R+ISM+ GG++ +V+RR   GL+ +EE     N  F  ++  G++  CP+NLGT +R  VH+K+P LS  P F++I  +  LQ RGT G  T +VGGVFDISN  RLG +E+   + + DGV  ++ +EK L K
Sbjct:   11 KLNYSVDDEFPDL---SKHNNHMAKV-LTKELYGKMRDKQTPTGFTLDDVIQTGIDNPGHPFIMTVGCVAGDEESYEVFKDLLDPVISDRHGGYKPTDKHKTD-------LNFENLKGGDDLDPNYVLSSRVRTGRSIKGYALPPHNSRGERRAIEKLSIEALSSLDGEFKGKYYPLKSMTDAEQEQLISDHFLFDKPVSPLLTCAGMARDWPDGRGIWHNDNKTFLVWVNEEDHLRVISMQKGGNMREVFRRFCVGLQKIEEIFKKHNHGFMWNEHLGYILTCPSNLGTGLRGGVHVKLPKLSTHPKFEEILTRLRLQKRGTGGVDTASVGGVFDISNADRLGSSEVAQVQLVVDGVKLMVEMEKKLEK 369          
BLAST of Taurocyamine kinase vs. Ensembl Medaka
Match: ENSORLT00000025242.2 (creatine kinase B-type [Source:NCBI gene;Acc:101167262])

HSP 1 Score: 253.062 bits (645), Expect = 1.123e-75
Identity = 146/375 (38.93%), Postives = 222/375 (59.20%), Query Frame = 1
Query:  112 KMEYKSLDEIYDMIYSNSENKSLAKKHLTKEIVAKYKNTKSKFGGTLAMCLNTNAYNP-----RALMCRTADPDCYDVFGDYFNELIKDYHKVATKEIEHPASDFGDIEHLPFKNMDVDKVYINSTRVRFGRTVKGFAFAPVISKEDRVTLSEQIANALKNLTGELQGNYYGLDNMTKEKQDELIKDHFLY-RDDDQVLRDAGGYRDWPSGRGIFLNNEKTFVVWINEEDHIRIISMEPGGDLPKVYRRLIAGLKGLEENL-----EFERHKRFGFLTFCPTNLGTTMRASVHIKIPFLSMLPNFKQICEQYSLQARGTYGEHTENVGGVFDISNQRRLGLTEIQAAKEMYDGVNAIIAIEKMLGKYNKTAPEGI 1203
            KM + S +E  D+    + N  +AK  LT ++ A+ ++ ++  G TL   + T   NP       + C   D + Y+VF D  + +I+D H    K  +   +D  + E+L   + D+D  Y+ S+RVR GR+++GF   P  S+ +R  + +    AL +L G+L+G YY L NMT E+Q +LI DHFL+ +    +L  +G  RDWP GRGI+ N+ KTF+VW+NEEDH+R+ISM+ GG++ +V+ R   GL  +EE       EF  ++  G++  CP+NLGT +RA VH+K+P LS    F ++ ++  LQ RGT G  T  VGGVFDISN  RLG +E++  + + DGVN ++++EK L      A EGI
Sbjct:   11 KMRFSSDEEFPDL---RAHNNHMAKV-LTPDMYARLRDKETPSGFTLDDVIQTGVDNPGHPFIMTVGCVAGDEETYEVFKDLLDPVIEDRHG-GYKPTDKHKTDL-NPENLQGGD-DLDPNYVLSSRVRTGRSIRGFCLPPHCSRGERRAIEQLSIQALDSLEGDLKGKYYALKNMTDEEQQQLIDDHFLFDKPVSPLLLSSGMARDWPDGRGIWHNDNKTFLVWVNEEDHLRVISMQKGGNMREVFNRFCTGLTKIEELFKEQGHEFMWNEHLGYVLTCPSNLGTGLRAGVHVKLPNLSKHEKFGEVLKRLRLQKRGTGGVDTAAVGGVFDISNADRLGFSEVELVQMVVDGVNLLVSMEKCL-----EAGEGI 373          

HSP 2 Score: 243.047 bits (619), Expect = 5.561e-72
Identity = 144/340 (42.35%), Postives = 194/340 (57.06%), Query Frame = 1
Query: 1276 KHLTKEIVDKFNTIRTKNGSTLAHCIRNSVYNNK-----AICPRTGDAKCYNCFSEYLDVVIRDYHKVKEPEVRHPNVNFGDL--ENL-GFQNLDPEGSFIMSTRIRVGRSIDGFNFPPTISKVDRLKLEKTIVDALSSLTGIHGGTYYPLTGMKENVQKQLIEDHFLF-KDDDPVLRDAGGYRDWPSGRGIFHNNEKTFLVWVCEEDHMRIISMQKGGDIAAVFTRLVQGIRQIETKLT-----FAHSKKYGYLTCCPSNLGTTMRASVHLKIPKLSSDKTKLNEVCDRFNLQARGFHGEHTESPEGIYDISNKRRLGLMEIEAATEMAKGVLEMIQIE 2253
            K LT ++  +     T +G TL   I+  V N        +    GD + Y  F + LD VI D H   +P  +H      DL  ENL G  +LDP  ++++S+R+R GRSI GF  PP  S+ +R  +E+  + AL SL G   G YY L  M +  Q+QLI+DHFLF K   P+L  +G  RDWP GRGI+HN+ KTFLVWV EEDH+R+ISMQKGG++  VF R   G+ +IE         F  ++  GY+  CPSNLGT +RA VH+K+P LS  + K  EV  R  LQ RG  G  T +  G++DISN  RLG  E+E    +  GV  ++ +E
Sbjct:   32 KVLTPDMYARLRDKETPSGFTLDDVIQTGVDNPGHPFIMTVGCVAGDEETYEVFKDLLDPVIEDRHGGYKPTDKHKT----DLNPENLQGGDDLDP--NYVLSSRVRTGRSIRGFCLPPHCSRGERRAIEQLSIQALDSLEGDLKGKYYALKNMTDEEQQQLIDDHFLFDKPVSPLLLSSGMARDWPDGRGIWHNDNKTFLVWVNEEDHLRVISMQKGGNMREVFNRFCTGLTKIEELFKEQGHEFMWNEHLGYVLTCPSNLGTGLRAGVHVKLPNLSKHE-KFGEVLKRLRLQKRGTGGVDTAAVGGVFDISNADRLGFSEVELVQMVVDGVNLLVSME 364          
BLAST of Taurocyamine kinase vs. Ensembl Medaka
Match: CKB (creatine kinase B [Source:NCBI gene;Acc:101174062])

HSP 1 Score: 249.21 bits (635), Expect = 4.406e-74
Identity = 144/338 (42.60%), Postives = 197/338 (58.28%), Query Frame = 1
Query: 1276 KHLTKEIVDKFNTIRTKNGSTLAHCIRNSVYNNK-----AICPRTGDAKCYNCFSEYLDVVIRDYHKVKEPEVRH-PNVNFGDLENLGFQNLDPEGSFIMSTRIRVGRSIDGFNFPPTISKVDRLKLEKTIVDALSSLTGIHGGTYYPLTGMKENVQKQLIEDHFLF-KDDDPVLRDAGGYRDWPSGRGIFHNNEKTFLVWVCEEDHMRIISMQKGGDIAAVFTRLVQGIRQIETKLT-----FAHSKKYGYLTCCPSNLGTTMRASVHLKIPKLSSDKTKLNEVCDRFNLQARGFHGEHTESPEGIYDISNKRRLGLMEIEAATEMAKGVLEMIQIE 2253
            K LT  I D+  + +T +G TL   I+  V N        +    GD + Y  F E LD VI D H   +P  +H  ++N  +L+  G  +LDP  ++++S+R+R GRSI GF  PP  S+ +R  +EK   +AL SLTG   G YY L  M +  Q+QLI+DHFLF K   P+L  +G  RDWP  RGI+HN+ KTFLVWV EEDH+R+ISMQKGG++  VF R   G+ +IE+        F  ++  GY+  CPSNLGT +RA VH+K+P +S    K  EV  R  LQ RG  G  T +  G++DISN  RLG  E+E    +  GV  + ++E
Sbjct:   40 KVLTPAIYDRLRSKQTPSGFTLDDVIQTGVDNPGHPFIMTVGCVAGDEETYEVFKELLDPVIEDRHGGYKPSDKHKTDLNPDNLK--GGDDLDP--NYVLSSRVRTGRSIRGFCLPPHCSRGERRMVEKLSNEALDSLTGDLKGKYYALKNMTDAEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKTFLVWVNEEDHLRVISMQKGGNMKEVFNRFCTGLTKIESLFKEKGHEFMWNEHLGYVLTCPSNLGTGLRAGVHMKLPNMSK-HAKFEEVLKRLRLQKRGTGGVDTAAVGGVFDISNADRLGFSEVELVQMVVDGVKLLTEME 372          

HSP 2 Score: 237.654 bits (605), Expect = 8.052e-70
Identity = 137/367 (37.33%), Postives = 209/367 (56.95%), Query Frame = 1
Query:  112 KMEYKSLDEIYDMIYSNSENKSLAKKHLTKEIVAKYKNTKSKFGGTLAMCLNTNAYNP-----RALMCRTADPDCYDVFGDYFNELIKDYHKVATKEIEHPASDFGDIEHLPFKNMD-VDKVYINSTRVRFGRTVKGFAFAPVISKEDRVTLSEQIANALKNLTGELQGNYYGLDNMTKEKQDELIKDHFLY-RDDDQVLRDAGGYRDWPSGRGIFLNNEKTFVVWINEEDHIRIISMEPGGDLPKVYRRLIAGLKGLE-----ENLEFERHKRFGFLTFCPTNLGTTMRASVHIKIPFLSMLPNFKQICEQYSLQARGTYGEHTENVGGVFDISNQRRLGLTEIQAAKEMYDGVNAIIAIEKMLGK 1176
            KM Y +  E  D+   +  N  +AK  LT  I  + ++ ++  G TL   + T   NP       + C   D + Y+VF +  + +I+D H       +H      D+     K  D +D  Y+ S+RVR GR+++GF   P  S+ +R  + +    AL +LTG+L+G YY L NMT  +Q +LI DHFL+ +    +L  +G  RDWP  RGI+ N+ KTF+VW+NEEDH+R+ISM+ GG++ +V+ R   GL  +E     +  EF  ++  G++  CP+NLGT +RA VH+K+P +S    F+++ ++  LQ RGT G  T  VGGVFDISN  RLG +E++  + + DGV  +  +EK L K
Sbjct:   19 KMNYSAEQEYPDL---SKHNNHMAKV-LTPAIYDRLRSKQTPSGFTLDDVIQTGVDNPGHPFIMTVGCVAGDEETYEVFKELLDPVIEDRHGGYKPSDKHKT----DLNPDNLKGGDDLDPNYVLSSRVRTGRSIRGFCLPPHCSRGERRMVEKLSNEALDSLTGDLKGKYYALKNMTDAEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKTFLVWVNEEDHLRVISMQKGGNMKEVFNRFCTGLTKIESLFKEKGHEFMWNEHLGYVLTCPSNLGTGLRAGVHMKLPNMSKHAKFEEVLKRLRLQKRGTGGVDTAAVGGVFDISNADRLGFSEVELVQMVVDGVKLLTEMEKRLEK 377          
BLAST of Taurocyamine kinase vs. Planmine SMEST
Match: SMESG000069023.1 (SMESG000069023.1)

HSP 1 Score: 1490.71 bits (3858), Expect = 0.000e+0
Identity = 713/713 (100.00%), Postives = 713/713 (100.00%), Query Frame = 1
Query:  115 MEYKSLDEIYDMIYSNSENKSLAKKHLTKEIVAKYKNTKSKFGGTLAMCLNTNAYNPRALMCRTADPDCYDVFGDYFNELIKDYHKVATKEIEHPASDFGDIEHLPFKNMDVDKVYINSTRVRFGRTVKGFAFAPVISKEDRVTLSEQIANALKNLTGELQGNYYGLDNMTKEKQDELIKDHFLYRDDDQVLRDAGGYRDWPSGRGIFLNNEKTFVVWINEEDHIRIISMEPGGDLPKVYRRLIAGLKGLEENLEFERHKRFGFLTFCPTNLGTTMRASVHIKIPFLSMLPNFKQICEQYSLQARGTYGEHTENVGGVFDISNQRRLGLTEIQAAKEMYDGVNAIIAIEKMLGKYNKTAPEGIPYVESLEYLAKIIWNDPSNDTITKKHLTKEIVDKFNTIRTKNGSTLAHCIRNSVYNNKAICPRTGDAKCYNCFSEYLDVVIRDYHKVKEPEVRHPNVNFGDLENLGFQNLDPEGSFIMSTRIRVGRSIDGFNFPPTISKVDRLKLEKTIVDALSSLTGIHGGTYYPLTGMKENVQKQLIEDHFLFKDDDPVLRDAGGYRDWPSGRGIFHNNEKTFLVWVCEEDHMRIISMQKGGDIAAVFTRLVQGIRQIETKLTFAHSKKYGYLTCCPSNLGTTMRASVHLKIPKLSSDKTKLNEVCDRFNLQARGFHGEHTESPEGIYDISNKRRLGLMEIEAATEMAKGVLEMIQIE 2253
            MEYKSLDEIYDMIYSNSENKSLAKKHLTKEIVAKYKNTKSKFGGTLAMCLNTNAYNPRALMCRTADPDCYDVFGDYFNELIKDYHKVATKEIEHPASDFGDIEHLPFKNMDVDKVYINSTRVRFGRTVKGFAFAPVISKEDRVTLSEQIANALKNLTGELQGNYYGLDNMTKEKQDELIKDHFLYRDDDQVLRDAGGYRDWPSGRGIFLNNEKTFVVWINEEDHIRIISMEPGGDLPKVYRRLIAGLKGLEENLEFERHKRFGFLTFCPTNLGTTMRASVHIKIPFLSMLPNFKQICEQYSLQARGTYGEHTENVGGVFDISNQRRLGLTEIQAAKEMYDGVNAIIAIEKMLGKYNKTAPEGIPYVESLEYLAKIIWNDPSNDTITKKHLTKEIVDKFNTIRTKNGSTLAHCIRNSVYNNKAICPRTGDAKCYNCFSEYLDVVIRDYHKVKEPEVRHPNVNFGDLENLGFQNLDPEGSFIMSTRIRVGRSIDGFNFPPTISKVDRLKLEKTIVDALSSLTGIHGGTYYPLTGMKENVQKQLIEDHFLFKDDDPVLRDAGGYRDWPSGRGIFHNNEKTFLVWVCEEDHMRIISMQKGGDIAAVFTRLVQGIRQIETKLTFAHSKKYGYLTCCPSNLGTTMRASVHLKIPKLSSDKTKLNEVCDRFNLQARGFHGEHTESPEGIYDISNKRRLGLMEIEAATEMAKGVLEMIQIE
Sbjct:    1 MEYKSLDEIYDMIYSNSENKSLAKKHLTKEIVAKYKNTKSKFGGTLAMCLNTNAYNPRALMCRTADPDCYDVFGDYFNELIKDYHKVATKEIEHPASDFGDIEHLPFKNMDVDKVYINSTRVRFGRTVKGFAFAPVISKEDRVTLSEQIANALKNLTGELQGNYYGLDNMTKEKQDELIKDHFLYRDDDQVLRDAGGYRDWPSGRGIFLNNEKTFVVWINEEDHIRIISMEPGGDLPKVYRRLIAGLKGLEENLEFERHKRFGFLTFCPTNLGTTMRASVHIKIPFLSMLPNFKQICEQYSLQARGTYGEHTENVGGVFDISNQRRLGLTEIQAAKEMYDGVNAIIAIEKMLGKYNKTAPEGIPYVESLEYLAKIIWNDPSNDTITKKHLTKEIVDKFNTIRTKNGSTLAHCIRNSVYNNKAICPRTGDAKCYNCFSEYLDVVIRDYHKVKEPEVRHPNVNFGDLENLGFQNLDPEGSFIMSTRIRVGRSIDGFNFPPTISKVDRLKLEKTIVDALSSLTGIHGGTYYPLTGMKENVQKQLIEDHFLFKDDDPVLRDAGGYRDWPSGRGIFHNNEKTFLVWVCEEDHMRIISMQKGGDIAAVFTRLVQGIRQIETKLTFAHSKKYGYLTCCPSNLGTTMRASVHLKIPKLSSDKTKLNEVCDRFNLQARGFHGEHTESPEGIYDISNKRRLGLMEIEAATEMAKGVLEMIQIE 713          

HSP 2 Score: 394.815 bits (1013), Expect = 5.051e-125
Identity = 186/350 (53.14%), Postives = 255/350 (72.86%), Query Frame = 1
Query:  124 KSLDEIYDMIYSNSENKSLAKKHLTKEIVAKYKNTKSKFGGTLAMCLNTNAYNPRALMCRTADPDCYDVFGDYFNELIKDYHKVATKEIEHPASDFGDIEHLPFKNMDVDKVYINSTRVRFGRTVKGFAFAPVISKEDRVTLSEQIANALKNLTGELQGNYYGLDNMTKEKQDELIKDHFLYRDDDQVLRDAGGYRDWPSGRGIFLNNEKTFVVWINEEDHIRIISMEPGGDLPKVYRRLIAGLKGLEENLEFERHKRFGFLTFCPTNLGTTMRASVHIKIPFLSM-LPNFKQICEQYSLQARGTYGEHTENVGGVFDISNQRRLGLTEIQAAKEMYDGVNAIIAIEKML 1170
            +SL+ +  +I+++  N ++ KKHLTKEIV K+   ++K G TLA C+  + YN +A+  RT D  CY+ F +Y + +I+DYHKV   E+ HP  +FGD+E+L F+N+D +  +I STR+R GR++ GF F P ISK DR+ L + I +AL +LTG   G YY L  M +  Q +LI+DHFL++DDD VLRDAGGYRDWPSGRGIF NNEKTF+VW+ EEDH+RIISM+ GGD+  V+ RL+ G++ +E  L F   K++G+LT CP+NLGTTMRASVH+KIP LS       ++C++++LQARG +GEHTE+  G++DISN+RRLGL EI+AA EM  GV  +I IEK L
Sbjct:  367 ESLEYLAKIIWNDPSNDTITKKHLTKEIVDKFNTIRTKNGSTLAHCIRNSVYNNKAICPRTGDAKCYNCFSEYLDVVIRDYHKVKEPEVRHPNVNFGDLENLGFQNLDPEGSFIMSTRIRVGRSIDGFNFPPTISKVDRLKLEKTIVDALSSLTGIHGGTYYPLTGMKENVQKQLIEDHFLFKDDDPVLRDAGGYRDWPSGRGIFHNNEKTFLVWVCEEDHMRIISMQKGGDIAAVFTRLVQGIRQIETKLTFAHSKKYGYLTCCPSNLGTTMRASVHLKIPKLSSDKTKLNEVCDRFNLQARGFHGEHTESPEGIYDISNKRRLGLMEIEAATEMAKGVLEMIQIEKSL 716          
BLAST of Taurocyamine kinase vs. Planmine SMEST
Match: SMESG000069023.1 (SMESG000069023.1)

HSP 1 Score: 1467.98 bits (3799), Expect = 0.000e+0
Identity = 702/702 (100.00%), Postives = 702/702 (100.00%), Query Frame = 1
Query:  148 MIYSNSENKSLAKKHLTKEIVAKYKNTKSKFGGTLAMCLNTNAYNPRALMCRTADPDCYDVFGDYFNELIKDYHKVATKEIEHPASDFGDIEHLPFKNMDVDKVYINSTRVRFGRTVKGFAFAPVISKEDRVTLSEQIANALKNLTGELQGNYYGLDNMTKEKQDELIKDHFLYRDDDQVLRDAGGYRDWPSGRGIFLNNEKTFVVWINEEDHIRIISMEPGGDLPKVYRRLIAGLKGLEENLEFERHKRFGFLTFCPTNLGTTMRASVHIKIPFLSMLPNFKQICEQYSLQARGTYGEHTENVGGVFDISNQRRLGLTEIQAAKEMYDGVNAIIAIEKMLGKYNKTAPEGIPYVESLEYLAKIIWNDPSNDTITKKHLTKEIVDKFNTIRTKNGSTLAHCIRNSVYNNKAICPRTGDAKCYNCFSEYLDVVIRDYHKVKEPEVRHPNVNFGDLENLGFQNLDPEGSFIMSTRIRVGRSIDGFNFPPTISKVDRLKLEKTIVDALSSLTGIHGGTYYPLTGMKENVQKQLIEDHFLFKDDDPVLRDAGGYRDWPSGRGIFHNNEKTFLVWVCEEDHMRIISMQKGGDIAAVFTRLVQGIRQIETKLTFAHSKKYGYLTCCPSNLGTTMRASVHLKIPKLSSDKTKLNEVCDRFNLQARGFHGEHTESPEGIYDISNKRRLGLMEIEAATEMAKGVLEMIQIE 2253
            MIYSNSENKSLAKKHLTKEIVAKYKNTKSKFGGTLAMCLNTNAYNPRALMCRTADPDCYDVFGDYFNELIKDYHKVATKEIEHPASDFGDIEHLPFKNMDVDKVYINSTRVRFGRTVKGFAFAPVISKEDRVTLSEQIANALKNLTGELQGNYYGLDNMTKEKQDELIKDHFLYRDDDQVLRDAGGYRDWPSGRGIFLNNEKTFVVWINEEDHIRIISMEPGGDLPKVYRRLIAGLKGLEENLEFERHKRFGFLTFCPTNLGTTMRASVHIKIPFLSMLPNFKQICEQYSLQARGTYGEHTENVGGVFDISNQRRLGLTEIQAAKEMYDGVNAIIAIEKMLGKYNKTAPEGIPYVESLEYLAKIIWNDPSNDTITKKHLTKEIVDKFNTIRTKNGSTLAHCIRNSVYNNKAICPRTGDAKCYNCFSEYLDVVIRDYHKVKEPEVRHPNVNFGDLENLGFQNLDPEGSFIMSTRIRVGRSIDGFNFPPTISKVDRLKLEKTIVDALSSLTGIHGGTYYPLTGMKENVQKQLIEDHFLFKDDDPVLRDAGGYRDWPSGRGIFHNNEKTFLVWVCEEDHMRIISMQKGGDIAAVFTRLVQGIRQIETKLTFAHSKKYGYLTCCPSNLGTTMRASVHLKIPKLSSDKTKLNEVCDRFNLQARGFHGEHTESPEGIYDISNKRRLGLMEIEAATEMAKGVLEMIQIE
Sbjct:    1 MIYSNSENKSLAKKHLTKEIVAKYKNTKSKFGGTLAMCLNTNAYNPRALMCRTADPDCYDVFGDYFNELIKDYHKVATKEIEHPASDFGDIEHLPFKNMDVDKVYINSTRVRFGRTVKGFAFAPVISKEDRVTLSEQIANALKNLTGELQGNYYGLDNMTKEKQDELIKDHFLYRDDDQVLRDAGGYRDWPSGRGIFLNNEKTFVVWINEEDHIRIISMEPGGDLPKVYRRLIAGLKGLEENLEFERHKRFGFLTFCPTNLGTTMRASVHIKIPFLSMLPNFKQICEQYSLQARGTYGEHTENVGGVFDISNQRRLGLTEIQAAKEMYDGVNAIIAIEKMLGKYNKTAPEGIPYVESLEYLAKIIWNDPSNDTITKKHLTKEIVDKFNTIRTKNGSTLAHCIRNSVYNNKAICPRTGDAKCYNCFSEYLDVVIRDYHKVKEPEVRHPNVNFGDLENLGFQNLDPEGSFIMSTRIRVGRSIDGFNFPPTISKVDRLKLEKTIVDALSSLTGIHGGTYYPLTGMKENVQKQLIEDHFLFKDDDPVLRDAGGYRDWPSGRGIFHNNEKTFLVWVCEEDHMRIISMQKGGDIAAVFTRLVQGIRQIETKLTFAHSKKYGYLTCCPSNLGTTMRASVHLKIPKLSSDKTKLNEVCDRFNLQARGFHGEHTESPEGIYDISNKRRLGLMEIEAATEMAKGVLEMIQIE 702          

HSP 2 Score: 395.201 bits (1014), Expect = 3.288e-125
Identity = 186/350 (53.14%), Postives = 255/350 (72.86%), Query Frame = 1
Query:  124 KSLDEIYDMIYSNSENKSLAKKHLTKEIVAKYKNTKSKFGGTLAMCLNTNAYNPRALMCRTADPDCYDVFGDYFNELIKDYHKVATKEIEHPASDFGDIEHLPFKNMDVDKVYINSTRVRFGRTVKGFAFAPVISKEDRVTLSEQIANALKNLTGELQGNYYGLDNMTKEKQDELIKDHFLYRDDDQVLRDAGGYRDWPSGRGIFLNNEKTFVVWINEEDHIRIISMEPGGDLPKVYRRLIAGLKGLEENLEFERHKRFGFLTFCPTNLGTTMRASVHIKIPFLSM-LPNFKQICEQYSLQARGTYGEHTENVGGVFDISNQRRLGLTEIQAAKEMYDGVNAIIAIEKML 1170
            +SL+ +  +I+++  N ++ KKHLTKEIV K+   ++K G TLA C+  + YN +A+  RT D  CY+ F +Y + +I+DYHKV   E+ HP  +FGD+E+L F+N+D +  +I STR+R GR++ GF F P ISK DR+ L + I +AL +LTG   G YY L  M +  Q +LI+DHFL++DDD VLRDAGGYRDWPSGRGIF NNEKTF+VW+ EEDH+RIISM+ GGD+  V+ RL+ G++ +E  L F   K++G+LT CP+NLGTTMRASVH+KIP LS       ++C++++LQARG +GEHTE+  G++DISN+RRLGL EI+AA EM  GV  +I IEK L
Sbjct:  356 ESLEYLAKIIWNDPSNDTITKKHLTKEIVDKFNTIRTKNGSTLAHCIRNSVYNNKAICPRTGDAKCYNCFSEYLDVVIRDYHKVKEPEVRHPNVNFGDLENLGFQNLDPEGSFIMSTRIRVGRSIDGFNFPPTISKVDRLKLEKTIVDALSSLTGIHGGTYYPLTGMKENVQKQLIEDHFLFKDDDPVLRDAGGYRDWPSGRGIFHNNEKTFLVWVCEEDHMRIISMQKGGDIAAVFTRLVQGIRQIETKLTFAHSKKYGYLTCCPSNLGTTMRASVHLKIPKLSSDKTKLNEVCDRFNLQARGFHGEHTESPEGIYDISNKRRLGLMEIEAATEMAKGVLEMIQIEKSL 705          
BLAST of Taurocyamine kinase vs. Planmine SMEST
Match: SMESG000063979.1 (SMESG000063979.1)

HSP 1 Score: 961.444 bits (2484), Expect = 0.000e+0
Identity = 438/713 (61.43%), Postives = 559/713 (78.40%), Query Frame = 1
Query:  115 MEYKSLDEIYDMIYSNSENKSLAKKHLTKEIVAKYKNTKSKFGGTLAMCLNTNAYNPRALMCRTADPDCYDVFGDYFNELIKDYHKVATKEIEHPASDFGDIEHLPFKNMDVDKVYINSTRVRFGRTVKGFAFAPVISKEDRVTLSEQIANALKNLTGELQGNYYGLDNMTKEKQDELIKDHFLYRDDDQVLRDAGGYRDWPSGRGIFLNNEKTFVVWINEEDHIRIISMEPGGDLPKVYRRLIAGLKGLEENLEFERHKRFGFLTFCPTNLGTTMRASVHIKIPFLSMLPNFKQICEQYSLQARGTYGEHTENVGGVFDISNQRRLGLTEIQAAKEMYDGVNAIIAIEKMLGKYNKTAPEGIPYVESLEYLAKIIWNDPSNDTITKKHLTKEIVDKFNTIRTKNGSTLAHCIRNSVYNNKAICPRTGDAKCYNCFSEYLDVVIRDYHKVKEPEVRHPNVNFGDLENLGFQNLDPEGSFIMSTRIRVGRSIDGFNFPPTISKVDRLKLEKTIVDALSSLTGIHGGTYYPLTGMKENVQKQLIEDHFLFKDDDPVLRDAGGYRDWPSGRGIFHNNEKTFLVWVCEEDHMRIISMQKGGDIAAVFTRLVQGIRQIETKLTFAHSKKYGYLTCCPSNLGTTMRASVHLKIPKLSSDKTKLNEVCDRFNLQARGFHGEHTESPEGIYDISNKRRLGLMEIEAATEMAKGVLEMIQIE 2253
            ++   L+E+Y  I++   NKS  KKHLT+EIV KYKN K+  GGTLA+C+ TNA NP A++ R AD DCY+VF D+F+ +IKDYH++ T ++ HP  +FG++++L + N+D  + +I STRVR GRTV+GFAFAP+I+K +R+ L ++I  A   L+ EL GNYY L +M +   D+L+ DHFL+RDDD VLRDAGGYRDWPSGRGI+LN++  F+VW+NEEDH+RIISME GGDL KVYRRL+ G+K +E+ L F RH R+G+LTFCP+NLGTTMRASVH KIP LS LPNFK+IC++Y LQARGTYGEHTE++ G++D+SNQRRLG TEI A  EM  GV AI+ +E ++ ++N   P+ +  VE LEY+  ++ N P N ++TKK+L+ ++V K+  +RT  G++LAHC+RN  YN +A+CPRTGD +CY+ F EYLD++I DYH V +   +HP+ +FGD+  L F +LDP G +++STR+RVGRSI GFNFPPTI K  RL+LE  + D L  L G   G YYPLTGM E  QKQLI+DHFLFKDDDPVLRDAGGYRDWPSGRGIFHN +KTFLVWVCEEDH+RIISMQ GGD+  V+ RLV GI+ IE KL+F+H KKYGYLTCCPSNLGTTMRASVH+KIPKLSSDKT   ++CD+++LQARGF+GEHTES  GIYDISNK RLGL E++A TEMA GV  +I IE
Sbjct:   24 LDVPPLEELYHKIHNCKANKSFTKKHLTREIVDKYKNVKTASGGTLALCVRTNAMNPGAMLPRCADFDCYNVFTDFFDAVIKDYHQITTSKVHHPEPNFGNLDNLGWGNLDPTEKFIVSTRVRVGRTVQGFAFAPLITKTERMELEQRIVKAFNQLSEELNGNYYPLSSMNRYTYDKLVADHFLFRDDDSVLRDAGGYRDWPSGRGIYLNHKNNFLVWVNEEDHLRIISMEAGGDLAKVYRRLVKGIKTMEDKLGFARHGRYGYLTFCPSNLGTTMRASVHAKIPMLSTLPNFKEICQKYQLQARGTYGEHTESLNGIYDLSNQRRLGYTEIDAVNEMAIGVKAIVELEALMQRFNVNIPKYLMVVEPLEYMYNLL-NVPENKSLTKKYLSMDMVKKYKDLRTSKGTSLAHCVRNCAYNPRALCPRTGDVECYSLFQEYLDLIIMDYHLVLDKNFQHPSPHFGDVFKLPFHDLDPSGDYVISTRVRVGRSIKGFNFPPTIDKAQRLRLESVVSDILMGLQGDLAGNYYPLTGMDEKTQKQLIDDHFLFKDDDPVLRDAGGYRDWPSGRGIFHNTKKTFLVWVCEEDHIRIISMQMGGDLVQVYQRLVLGIKAIEEKLSFSHMKKYGYLTCCPSNLGTTMRASVHVKIPKLSSDKTTFTDICDKYHLQARGFYGEHTESAGGIYDISNKHRLGLTELDAVTEMANGVKAIIDIE 735          

HSP 2 Score: 412.535 bits (1059), Expect = 1.650e-131
Identity = 196/358 (54.75%), Postives = 255/358 (71.23%), Query Frame = 1
Query: 1180 NKTAPEGIPYVESLEYLAKIIWNDPSNDTITKKHLTKEIVDKFNTIRTKNGSTLAHCIRNSVYNNKAICPRTGDAKCYNCFSEYLDVVIRDYHKVKEPEVRHPNVNFGDLENLGFQNLDPEGSFIMSTRIRVGRSIDGFNFPPTISKVDRLKLEKTIVDALSSLTGIHGGTYYPLTGMKENVQKQLIEDHFLFKDDDPVLRDAGGYRDWPSGRGIFHNNEKTFLVWVCEEDHMRIISMQKGGDIAAVFTRLVQGIRQIETKLTFAHSKKYGYLTCCPSNLGTTMRASVHLKIPKLSSDKTKLNEVCDRFNLQARGFHGEHTESPEGIYDISNKRRLGLMEIEAATEMAKGVLEMIQIE 2253
            N +   G   V  LE L   I N  +N + TKKHLT+EIVDK+  ++T +G TLA C+R +  N  A+ PR  D  CYN F+++ D VI+DYH++   +V HP  NFG+L+NLG+ NLDP   FI+STR+RVGR++ GF F P I+K +R++LE+ IV A + L+    G YYPL+ M      +L+ DHFLF+DDD VLRDAGGYRDWPSGRGI+ N++  FLVWV EEDH+RIISM+ GGD+A V+ RLV+GI+ +E KL FA   +YGYLT CPSNLGTTMRASVH KIP LS+      E+C ++ LQARG +GEHTES  GIYD+SN+RRLG  EI+A  EMA GV  ++++E
Sbjct:   16 NSSIESGPLDVPPLEELYHKIHNCKANKSFTKKHLTREIVDKYKNVKTASGGTLALCVRTNAMNPGAMLPRCADFDCYNVFTDFFDAVIKDYHQITTSKVHHPEPNFGNLDNLGWGNLDPTEKFIVSTRVRVGRTVQGFAFAPLITKTERMELEQRIVKAFNQLSEELNGNYYPLSSMNRYTYDKLVADHFLFRDDDSVLRDAGGYRDWPSGRGIYLNHKNNFLVWVNEEDHLRIISMEAGGDLAKVYRRLVKGIKTMEDKLGFARHGRYGYLTFCPSNLGTTMRASVHAKIPMLST-LPNFKEICQKYQLQARGTYGEHTESLNGIYDLSNQRRLGYTEIDAVNEMAIGVKAIVELE 372          

HSP 3 Score: 402.134 bits (1032), Expect = 1.660e-127
Identity = 198/373 (53.08%), Postives = 261/373 (69.97%), Query Frame = 1
Query:   55 IHILKLFLRFPKIYSAYLRKMEYKSLDEIYDMIYSNSENKSLAKKHLTKEIVAKYKNTKSKFGGTLAMCLNTNAYNPRALMCRTADPDCYDVFGDYFNELIKDYHKVATKEIEHPASDFGDIEHLPFKNMDVDKVYINSTRVRFGRTVKGFAFAPVISKEDRVTLSEQIANALKNLTGELQGNYYGLDNMTKEKQDELIKDHFLYRDDDQVLRDAGGYRDWPSGRGIFLNNEKTFVVWINEEDHIRIISMEPGGDLPKVYRRLIAGLKGLEENLEFERHKRFGFLTFCPTNLGTTMRASVHIKIPFLSM-LPNFKQICEQYSLQARGTYGEHTENVGGVFDISNQRRLGLTEIQAAKEMYDGVNAIIAIEKML 1170
            + +  L  RF      YL  M  + L+ +Y+++ +  ENKSL KK+L+ ++V KYK+ ++  G +LA C+   AYNPRAL  RT D +CY +F +Y + +I DYH V  K  +HP+  FGD+  LPF ++D    Y+ STRVR GR++KGF F P I K  R+ L   +++ L  L G+L GNYY L  M ++ Q +LI DHFL++DDD VLRDAGGYRDWPSGRGIF N +KTF+VW+ EEDHIRIISM+ GGDL +VY+RL+ G+K +EE L F   K++G+LT CP+NLGTTMRASVH+KIP LS     F  IC++Y LQARG YGEHTE+ GG++DISN+ RLGLTE+ A  EM +GV AII IE  L
Sbjct:  369 VELEALMQRFNVNIPKYL--MVVEPLEYMYNLL-NVPENKSLTKKYLSMDMVKKYKDLRTSKGTSLAHCVRNCAYNPRALCPRTGDVECYSLFQEYLDLIIMDYHLVLDKNFQHPSPHFGDVFKLPFHDLDPSGDYVISTRVRVGRSIKGFNFPPTIDKAQRLRLESVVSDILMGLQGDLAGNYYPLTGMDEKTQKQLIDDHFLFKDDDPVLRDAGGYRDWPSGRGIFHNTKKTFLVWVCEEDHIRIISMQMGGDLVQVYQRLVLGIKAIEEKLSFSHMKKYGYLTCCPSNLGTTMRASVHVKIPKLSSDKTTFTDICDKYHLQARGFYGEHTESAGGIYDISNKHRLGLTELDAVTEMANGVKAIIDIEMSL 738          
BLAST of Taurocyamine kinase vs. Planmine SMEST
Match: SMESG000063979.1 (SMESG000063979.1)

HSP 1 Score: 908.286 bits (2346), Expect = 0.000e+0
Identity = 420/713 (58.91%), Postives = 541/713 (75.88%), Query Frame = 1
Query:  115 MEYKSLDEIYDMIYSNSENKSLAKKHLTKEIVAKYKNTKSKFGGTLAMCLNTNAYNPRALMCRTADPDCYDVFGDYFNELIKDYHKVATKEIEHPASDFGDIEHLPFKNMDVDKVYINSTRVRFGRTVKGFAFAPVISKEDRVTLSEQIANALKNLTGELQGNYYGLDNMTKEKQDELIKDHFLYRDDDQVLRDAGGYRDWPSGRGIFLNNEKTFVVWINEEDHIRIISMEPGGDLPKVYRRLIAGLKGLEENLEFERHKRFGFLTFCPTNLGTTMRASVHIKIPFLSMLPNFKQICEQYSLQARGTYGEHTENVGGVFDISNQRRLGLTEIQAAKEMYDGVNAIIAIEKMLGKYNKTAPEGIPYVESLEYLAKIIWNDPSNDTITKKHLTKEIVDKFNTIRTKNGSTLAHCIRNSVYNNKAICPRTGDAKCYNCFSEYLDVVIRDYHKVKEPEVRHPNVNFGDLENLGFQNLDPEGSFIMSTRIRVGRSIDGFNFPPTISKVDRLKLEKTIVDALSSLTGIHGGTYYPLTGMKENVQKQLIEDHFLFKDDDPVLRDAGGYRDWPSGRGIFHNNEKTFLVWVCEEDHMRIISMQKGGDIAAVFTRLVQGIRQIETKLTFAHSKKYGYLTCCPSNLGTTMRASVHLKIPKLSSDKTKLNEVCDRFNLQARGFHGEHTESPEGIYDISNKRRLGLMEIEAATEMAKGVLEMIQIE 2253
            ++   L+E+Y  I++   NKS  KKHLT+EIV KYKN K+  GGTLA+C+ TNA NP A++ R AD DCY+VF D+F+ +IKDYH++ T ++ HP  +FG++++L + N+D  + +I STRVR GRTV+GFAFAP+I+K +R+ L ++I  A   L+ EL GNYY L +M +   D+L+ DHFL+RDDD+++                   E  F+VW+NEEDH+RIISME GGDL KVYRRL+ G+K +E+ L F RH R+G+LTFCP+NLGTTMRASVH KIP LS LPNFK+IC++Y LQARGTYGEHTE++ G++D+SNQRRLG TEI A  EM  GV AI+ +E ++ ++N   P+ +  VE LEY+  ++ N P N ++TKK+L+ ++V K+  +RT  G++LAHC+RN  YN +A+CPRTGD +CY+ F EYLD++I DYH V +   +HP+ +FGD+  L F +LDP G +++STR+RVGRSI GFNFPPTI K  RL+LE  + D L  L G   G YYPLTGM E  QKQLI+DHFLFKDDDPVLRDAGGYRDWPSGRGIFHN +KTFLVWVCEEDH+RIISMQ GGD+  V+ RLV GI+ IE KL+F+H KKYGYLTCCPSNLGTTMRASVH+KIPKLSSDKT   ++CD+++LQARGF+GEHTES  GIYDISNK RLGL E++A TEMA GV  +I IE
Sbjct:   24 LDVPPLEELYHKIHNCKANKSFTKKHLTREIVDKYKNVKTASGGTLALCVRTNAMNPGAMLPRCADFDCYNVFTDFFDAVIKDYHQITTSKVHHPEPNFGNLDNLGWGNLDPTEKFIVSTRVRVGRTVQGFAFAPLITKTERMELEQRIVKAFNQLSEELNGNYYPLSSMNRYTYDKLVADHFLFRDDDRIIL------------AFCEMLENNFLVWVNEEDHLRIISMEAGGDLAKVYRRLVKGIKTMEDKLGFARHGRYGYLTFCPSNLGTTMRASVHAKIPMLSTLPNFKEICQKYQLQARGTYGEHTESLNGIYDLSNQRRLGYTEIDAVNEMAIGVKAIVELEALMQRFNVNIPKYLMVVEPLEYMYNLL-NVPENKSLTKKYLSMDMVKKYKDLRTSKGTSLAHCVRNCAYNPRALCPRTGDVECYSLFQEYLDLIIMDYHLVLDKNFQHPSPHFGDVFKLPFHDLDPSGDYVISTRVRVGRSIKGFNFPPTIDKAQRLRLESVVSDILMGLQGDLAGNYYPLTGMDEKTQKQLIDDHFLFKDDDPVLRDAGGYRDWPSGRGIFHNTKKTFLVWVCEEDHIRIISMQMGGDLVQVYQRLVLGIKAIEEKLSFSHMKKYGYLTCCPSNLGTTMRASVHVKIPKLSSDKTTFTDICDKYHLQARGFYGEHTESAGGIYDISNKHRLGLTELDAVTEMANGVKAIIDIE 723          

HSP 2 Score: 402.134 bits (1032), Expect = 1.064e-127
Identity = 198/373 (53.08%), Postives = 261/373 (69.97%), Query Frame = 1
Query:   55 IHILKLFLRFPKIYSAYLRKMEYKSLDEIYDMIYSNSENKSLAKKHLTKEIVAKYKNTKSKFGGTLAMCLNTNAYNPRALMCRTADPDCYDVFGDYFNELIKDYHKVATKEIEHPASDFGDIEHLPFKNMDVDKVYINSTRVRFGRTVKGFAFAPVISKEDRVTLSEQIANALKNLTGELQGNYYGLDNMTKEKQDELIKDHFLYRDDDQVLRDAGGYRDWPSGRGIFLNNEKTFVVWINEEDHIRIISMEPGGDLPKVYRRLIAGLKGLEENLEFERHKRFGFLTFCPTNLGTTMRASVHIKIPFLSM-LPNFKQICEQYSLQARGTYGEHTENVGGVFDISNQRRLGLTEIQAAKEMYDGVNAIIAIEKML 1170
            + +  L  RF      YL  M  + L+ +Y+++ +  ENKSL KK+L+ ++V KYK+ ++  G +LA C+   AYNPRAL  RT D +CY +F +Y + +I DYH V  K  +HP+  FGD+  LPF ++D    Y+ STRVR GR++KGF F P I K  R+ L   +++ L  L G+L GNYY L  M ++ Q +LI DHFL++DDD VLRDAGGYRDWPSGRGIF N +KTF+VW+ EEDHIRIISM+ GGDL +VY+RL+ G+K +EE L F   K++G+LT CP+NLGTTMRASVH+KIP LS     F  IC++Y LQARG YGEHTE+ GG++DISN+ RLGLTE+ A  EM +GV AII IE  L
Sbjct:  357 VELEALMQRFNVNIPKYL--MVVEPLEYMYNLL-NVPENKSLTKKYLSMDMVKKYKDLRTSKGTSLAHCVRNCAYNPRALCPRTGDVECYSLFQEYLDLIIMDYHLVLDKNFQHPSPHFGDVFKLPFHDLDPSGDYVISTRVRVGRSIKGFNFPPTIDKAQRLRLESVVSDILMGLQGDLAGNYYPLTGMDEKTQKQLIDDHFLFKDDDPVLRDAGGYRDWPSGRGIFHNTKKTFLVWVCEEDHIRIISMQMGGDLVQVYQRLVLGIKAIEEKLSFSHMKKYGYLTCCPSNLGTTMRASVHVKIPKLSSDKTTFTDICDKYHLQARGFYGEHTESAGGIYDISNKHRLGLTELDAVTEMANGVKAIIDIEMSL 726          

HSP 3 Score: 361.688 bits (927), Expect = 2.518e-112
Identity = 179/358 (50.00%), Postives = 237/358 (66.20%), Query Frame = 1
Query: 1180 NKTAPEGIPYVESLEYLAKIIWNDPSNDTITKKHLTKEIVDKFNTIRTKNGSTLAHCIRNSVYNNKAICPRTGDAKCYNCFSEYLDVVIRDYHKVKEPEVRHPNVNFGDLENLGFQNLDPEGSFIMSTRIRVGRSIDGFNFPPTISKVDRLKLEKTIVDALSSLTGIHGGTYYPLTGMKENVQKQLIEDHFLFKDDDPVLRDAGGYRDWPSGRGIFHNNEKTFLVWVCEEDHMRIISMQKGGDIAAVFTRLVQGIRQIETKLTFAHSKKYGYLTCCPSNLGTTMRASVHLKIPKLSSDKTKLNEVCDRFNLQARGFHGEHTESPEGIYDISNKRRLGLMEIEAATEMAKGVLEMIQIE 2253
            N +   G   V  LE L   I N  +N + TKKHLT+EIVDK+  ++T +G TLA C+R +  N  A+ PR  D  CYN F+++ D VI+DYH++   +V HP  NFG+L+NLG+ NLDP   FI+STR+RVGR++ GF F P I+K +R++LE+ IV A + L+    G YYPL+ M      +L+ DHFLF+DDD ++                   E  FLVWV EEDH+RIISM+ GGD+A V+ RLV+GI+ +E KL FA   +YGYLT CPSNLGTTMRASVH KIP LS+      E+C ++ LQARG +GEHTES  GIYD+SN+RRLG  EI+A  EMA GV  ++++E
Sbjct:   16 NSSIESGPLDVPPLEELYHKIHNCKANKSFTKKHLTREIVDKYKNVKTASGGTLALCVRTNAMNPGAMLPRCADFDCYNVFTDFFDAVIKDYHQITTSKVHHPEPNFGNLDNLGWGNLDPTEKFIVSTRVRVGRTVQGFAFAPLITKTERMELEQRIVKAFNQLSEELNGNYYPLSSMNRYTYDKLVADHFLFRDDDRII------------LAFCEMLENNFLVWVNEEDHLRIISMEAGGDLAKVYRRLVKGIKTMEDKLGFARHGRYGYLTFCPSNLGTTMRASVHAKIPMLST-LPNFKEICQKYQLQARGTYGEHTESLNGIYDLSNQRRLGYTEIDAVNEMAIGVKAIVELE 360          
BLAST of Taurocyamine kinase vs. Planmine SMEST
Match: SMESG000022010.1 (SMESG000022010.1)

HSP 1 Score: 237.269 bits (604), Expect = 7.114e-66
Identity = 187/734 (25.48%), Postives = 345/734 (47.00%), Query Frame = 1
Query:  124 KSLDEIYDMIYSNSENKSLAKKHLTKEIVAKYKNTKSKFGGTLAMCLNTNAYNPRALMCRTADPDCYDVFGDYFNELIKDYHKVATKEIE-HPASDFGDIEHLPFKNMDV-----DKVYINSTRVRFGRTVKGFAFAPVISKEDRVTLSEQIANALKNLTGELQGNYYGLDNMTKEKQDELIKDHFLYRDDDQVLRDAGGYRDWPSGRGIFL-NNEKTFV--VWINEEDHIRIISMEPGGDLPKVYRRLIAGLKGLE-ENLEFERHKRFGFLTFCPTNLGTTMRASVHIKIPFLSMLPNFKQICEQYSLQARGTYGEHTENVGGVFDISNQRRLGLTEIQAAKEMYDGVNAIIAIEKMLGKYNKTAPEGI----PYVESLEYLAKIIWNDPSNDTITKKHLTKEIVDKFNTIRTKNGSTLAHCIRNSVYNNKAICPRTGDAKCYNCFSEYLDVVIRDYHKVKEPEVRHPNV-NFGDLENLGFQNLDPEGSFIMSTRIRVGRSIDGFNFPPTISKVDRLKLEKTIVDALSSLTGIHGGTYYPLTGMKENVQKQLIEDHFLFKDDDPVLRDAGGYRDWPSGRGIFH-----NNEKTFLVWVCE-EDHMRIISMQKGG-DIAAVFTRLVQGIRQIETKL--TFAHSKKYGYLTCCPSNLGTTMRASVHLKIPKLSSDKTKLNEVCDRFNLQARGFHGEHTESPEGIYDISNKRRLGLMEIEAATEMAKGVLEMIQIE 2253
            K+L E  ++I ++S+NKSL K+ LTKE+  +++  +      L  C+  N YN   ++   + PDCY++F ++F  +++  H +  KE+  HP   FG+++     +++       +V  + T  R  R ++   F P ++  DR+ +  Q+   ++ +      N   +  +  E +  + K           L D G   D+P  R + +  ++  F     +N +DH+  I+    G + +++ R+   +   + + +++  H  FG LT  P ++GT     V  K PF+S + +   + + +         E  +   G+  +   + L  TE +   +     N I  +E  L     T+P  I       E++E L  II    S  + TKK LT+ I+ +++ ++T  G+ L +CIR++ Y+  ++ PR  D+  Y  F  + + +I + + V     +HP   N+G  E+  FQ      S I+S R+   R+I+ F FP  +S  DR++LE+ ++D +        G Y PL  +K +V  + I  H      + V +  G Y DWP  RG+F      N    FLV +    DH+++IS+   G  +   + R V  ++ +  +L   +A+   YGYLT  PS++G  MR S  +K+  L  ++  L + C       RG  G  + + + ++D+S K  L + EI      A+ + ++I +E
Sbjct:   58 KNLVEYQEIIANDSQNKSLTKEILTKEMAKEFEFIRGHEKEGLGQCIYPNVYNTNCVIPYASGPDCYNIFAEFFGYIVERIHGLPDKEVSLHP--HFGNLKRHALTDLNSYTRRRQRVIYSETMTR--RNLQDIHFTPYVNHSDRINVISQMEPKIRAIC----ENLIEIPILPLEWEQRMNK-------VTNELDDCGSMLDFPEDRLMLVFKDDDNFYQGAILNFDDHVEFINSANNGKIGELFVRMHDFVHHEQFKEVDYAAHAVFGHLTLSPAHIGTGFSIRVLAKFPFISRMADANSLVKPFDC---AISNELDDQNNGMIVLYTIKSLNKTEAEIFGDFILAFNKISLMEDEL---ELTSPMAIQQDCAIAENIETLMNIIQETESK-SYTKKFLTRNIIQQYDGVKTNFGTFLNNCIRHNAYHPHSLFPRACDSDSYTVFQSFFNPIILETNNVV--GFKHPKTPNYGSTEHKLFQ---LRHSSILSYRVSFTRNINAFPFPIMMSTKDRMELEEMMIDLIDEFPVEMEGHYVPLKSLKSSVYYEEIIKHKFIPSINEVNKSCGLYSDWPRHRGVFFAQKNINYPNIFLVILVNFIDHIKVISLDPNGKKLNLCYDRAVNVMKFLNLRLHEKYAYRWGYGYLTTVPSSVGCAMRISALVKLVHLGKNREILEKHCKAMQFAYRGTSGYGSVAVDNVFDLSLKLNLNVTEIWLLMMFAQRLKDLILLE 764          

HSP 2 Score: 159.073 bits (401), Expect = 9.754e-40
Identity = 107/349 (30.66%), Postives = 171/349 (49.00%), Query Frame = 1
Query:  151 IYSNSENKSLAKKHLTKEIVAKYKNTKSKFGGTLAMCLNTNAYNPRALMCRTADPDCYDVFGDYFNELIKDYHKVATKEIEHPAS-DFGDIEHLPFKNMDVDKVYINSTRVRFGRTVKGFAFAPVISKEDRVTLSEQIANALKNLTGELQGNYYGLDNMTKEKQDELIKDHFLYRDDDQVLRDAGGYRDWPSGRGIFLNNEKT------FVVWINEEDHIRIISMEPGGD-LPKVYRRLIAGLKGLEENLEFERHKR--FGFLTFCPTNLGTTMRASVHIKIPFLSMLPN-FKQICEQYSLQARGTYGEHTENVGGVFDISNQRRLGLTEIQAAKEMYDGVNAIIAIEK 1164
            I   +E+KS  KK LT+ I+ +Y   K+ FG  L  C+  NAY+P +L  R  D D Y VF  +FN +I + + V     +HP + ++G  EH  F+   +    I S RV F R +  F F  ++S +DR+ L E + + +     E++G+Y  L ++      E I  H      ++V +  G Y DWP  RG+F   +         V+ +N  DHI++IS++P G  L   Y R +  +K L   L  +   R  +G+LT  P+++G  MR S  +K+  L       ++ C+      RGT G  +  V  VFD+S +  L +TEI         +  +I +E+
Sbjct:  422 IIQETESKSYTKKFLTRNIIQQYDGVKTNFGTFLNNCIRHNAYHPHSLFPRACDSDSYTVFQSFFNPIILETNNVVG--FKHPKTPNYGSTEHKLFQ---LRHSSILSYRVSFTRNINAFPFPIMMSTKDRMELEEMMIDLIDEFPVEMEGHYVPLKSLKSSVYYEEIIKHKFIPSINEVNKSCGLYSDWPRHRGVFFAQKNINYPNIFLVILVNFIDHIKVISLDPNGKKLNLCYDRAVNVMKFLNLRLHEKYAYRWGYGYLTTVPSSVGCAMRISALVKLVHLGKNREILEKHCKAMQFAYRGTSGYGSVAVDNVFDLSLKLNLNVTEIWLLMMFAQRLKDLILLER 765          
The following BLAST results are available for this feature:
BLAST of Taurocyamine kinase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CKB2.161e-7542.90creatine kinase B [Source:HGNC Symbol;Acc:HGNC:199... [more]
CKMT1A4.300e-7337.47creatine kinase, mitochondrial 1A [Source:HGNC Sym... [more]
CKMT1A4.300e-7337.47creatine kinase, mitochondrial 1A [Source:HGNC Sym... [more]
CKMT1B4.300e-7337.47creatine kinase, mitochondrial 1B [Source:HGNC Sym... [more]
CKMT1B4.300e-7337.47creatine kinase, mitochondrial 1B [Source:HGNC Sym... [more]
back to top
BLAST of Taurocyamine kinase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
W10C8.51.744e-10549.10pep chromosome:WBcel235:I:2853975:2855715:-1 gene:... [more]
W10C8.51.744e-10549.10pep chromosome:WBcel235:I:2853975:2855732:-1 gene:... [more]
F32B5.13.328e-10549.10pep chromosome:WBcel235:I:2700420:2702158:1 gene:W... [more]
F46H5.33.794e-10445.53Probable arginine kinase F46H5.3 [Source:UniProtK... [more]
F46H5.33.794e-10445.53Probable arginine kinase F46H5.3 [Source:UniProtK... [more]
back to top
BLAST of Taurocyamine kinase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Argk2.906e-10747.11gene:FBgn0000116 transcript:FBtr0331550[more]
Argk2.906e-10747.11gene:FBgn0000116 transcript:FBtr0076545[more]
Argk2.906e-10747.11gene:FBgn0000116 transcript:FBtr0345030[more]
Argk6.487e-10747.11gene:FBgn0000116 transcript:FBtr0112791[more]
Argk1.351e-10647.11gene:FBgn0000116 transcript:FBtr0076546[more]
back to top
BLAST of Taurocyamine kinase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ckmb1.542e-7843.49creatine kinase, muscle b [Source:ZFIN;Acc:ZDB-GEN... [more]
ckmb1.542e-7843.49creatine kinase, muscle b [Source:ZFIN;Acc:ZDB-GEN... [more]
ckma3.822e-7438.92creatine kinase, muscle a [Source:ZFIN;Acc:ZDB-GEN... [more]
ckma3.822e-7438.92creatine kinase, muscle a [Source:ZFIN;Acc:ZDB-GEN... [more]
ckba5.087e-7442.60creatine kinase, brain a [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of Taurocyamine kinase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
aldh1l28.755e-8039.37aldehyde dehydrogenase 1 family member L2 [Source:... [more]
aldh1l22.748e-7939.37aldehyde dehydrogenase 1 family member L2 [Source:... [more]
aldh1l23.024e-7939.37aldehyde dehydrogenase 1 family member L2 [Source:... [more]
aldh1l21.505e-7841.35aldehyde dehydrogenase 1 family member L2 [Source:... [more]
aldh1l21.983e-7841.35aldehyde dehydrogenase 1 family member L2 [Source:... [more]
back to top
BLAST of Taurocyamine kinase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ckb4.915e-7541.74creatine kinase, brain [Source:MGI Symbol;Acc:MGI:... [more]
Ckm3.980e-7338.15creatine kinase, muscle [Source:MGI Symbol;Acc:MGI... [more]
Ckmt21.642e-7240.71creatine kinase, mitochondrial 2 [Source:MGI Symbo... [more]
Ckmt17.989e-7138.64creatine kinase, mitochondrial 1, ubiquitous [Sour... [more]
Ckmt17.989e-7138.64creatine kinase, mitochondrial 1, ubiquitous [Sour... [more]
back to top
BLAST of Taurocyamine kinase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P16641|KTRC_SCHMA3.521e-11558.66Taurocyamine kinase OS=Schistosoma mansoni OX=6183... [more]
sp|O15992|KARG_ANTJA6.503e-9443.39Arginine kinase OS=Anthopleura japonica OX=67755 P... [more]
sp|P18294|KCRF_STRPU1.645e-15439.11Creatine kinase, flagellar OS=Strongylocentrotus p... [more]
sp|O15990|KARG_LIOJA6.755e-12954.34Arginine kinase OS=Liolophura japonica OX=13599 PE... [more]
sp|G1ESZ9|KARG_AMPFA8.196e-12455.07Arginine kinase Oct f 2 OS=Amphioctopus fangsiao O... [more]
back to top
BLAST of Taurocyamine kinase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5J4NZC67.120e-12561.57Creatine kinase OS=Paragonimus westermani OX=34504... [more]
C7BCG04.527e-12461.43Taurocyamine kinase OS=Paragonimus westermani OX=3... [more]
A0A0V0J1X01.216e-11760.75Taurocyamine kinase (Fragment) OS=Schistocephalus ... [more]
S4VGM44.475e-12661.99Taurocyamine kinase OS=Dugesia sp. BJR-2013 OX=135... [more]
A0A183MHL77.695e-11558.94Uncharacterized protein OS=Schistosoma margrebowie... [more]
back to top
BLAST of Taurocyamine kinase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ckma2.311e-7442.31creatine kinase M-type [Source:NCBI gene;Acc:10304... [more]
ckma2.311e-7442.31creatine kinase M-type [Source:NCBI gene;Acc:10304... [more]
ckba1.610e-7341.72creatine kinase B-type [Source:NCBI gene;Acc:10302... [more]
ckmb1.999e-7342.01creatine kinase, muscle b [Source:ZFIN;Acc:ZDB-GEN... [more]
ckmt2b3.060e-7340.59creatine kinase S-type, mitochondrial [Source:NCBI... [more]
back to top
BLAST of Taurocyamine kinase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000005045.14.798e-2345.19pep scaffold:Pmarinus_7.0:GL495569:1868:3379:-1 ge... [more]
back to top
BLAST of Taurocyamine kinase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Taurocyamine kinase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO342372.783e-9143.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO492624.787e-8543.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO406269.049e-14737.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO342364.358e-9445.95Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO462318.770e-8044.84Cytoplasmic creatine kinase protein; Predicted pro... [more]
back to top
BLAST of Taurocyamine kinase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CKM7.481e-7844.08creatine kinase M-type [Source:NCBI gene;Acc:10116... [more]
ENSORLT00000001794.21.080e-7739.01creatine kinase U-type, mitochondrial [Source:NCBI... [more]
CKM9.693e-7743.49creatine kinase M-type [Source:NCBI gene;Acc:10116... [more]
ENSORLT00000025242.21.123e-7538.93creatine kinase B-type [Source:NCBI gene;Acc:10116... [more]
CKB4.406e-7442.60creatine kinase B [Source:NCBI gene;Acc:101174062][more]
back to top
BLAST of Taurocyamine kinase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000069023.15.051e-125100.00SMESG000069023.1[more]
SMESG000069023.13.288e-125100.00SMESG000069023.1[more]
SMESG000063979.11.650e-13161.43SMESG000063979.1[more]
SMESG000063979.11.064e-12758.91SMESG000063979.1[more]
SMESG000022010.17.114e-6625.48SMESG000022010.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028062 ID=SMED30028062|Name=Taurocyamine kinase|organism=Schmidtea mediterranea sexual|type=transcript|length=2727bp
ATTTATTGGAAATCCATTTTAAAATTTTAGCAGTTACCGCTAGAAATATA
ATTTATTCATATTTTGAAATTATTCTTGCGTTTTCCCAAAATTTATAGCG
CATATTTACGGAAAATGGAATATAAATCGCTAGACGAAATCTACGATATG
ATATACAGCAACTCGGAAAACAAATCTTTAGCAAAAAAGCATCTGACTAA
AGAAATTGTTGCAAAATATAAAAACACTAAAAGCAAATTTGGCGGAACTT
TAGCAATGTGTTTAAACACAAATGCGTACAATCCAAGAGCTTTAATGTGC
AGGACTGCTGACCCTGATTGCTACGATGTTTTTGGGGATTATTTCAATGA
GCTGATTAAGGATTATCATAAGGTAGCAACAAAAGAAATTGAACATCCAG
CTAGTGATTTTGGGGATATAGAACATTTACCTTTTAAGAATATGGATGTT
GATAAAGTTTATATTAATTCAACTCGTGTACGATTTGGTAGAACTGTTAA
AGGATTTGCATTTGCACCGGTCATTTCAAAGGAAGACAGAGTAACATTAT
CGGAACAAATCGCAAACGCTCTTAAAAACTTAACAGGTGAATTGCAGGGA
AATTATTATGGATTAGACAATATGACAAAAGAGAAACAAGACGAATTAAT
AAAAGATCACTTTTTATATAGAGATGATGATCAAGTTCTAAGAGACGCCG
GAGGTTATCGCGATTGGCCTAGTGGAAGAGGAATATTTTTAAACAACGAG
AAAACATTTGTAGTATGGATAAATGAAGAAGATCACATTAGAATCATCTC
TATGGAGCCTGGAGGAGATTTGCCAAAAGTCTATCGAAGGCTAATAGCTG
GACTAAAAGGCCTTGAAGAGAATTTAGAATTTGAAAGACACAAAAGATTC
GGTTTCTTGACTTTCTGTCCGACAAATTTGGGTACAACAATGAGAGCAAG
TGTTCATATTAAAATACCATTTTTGTCAATGCTTCCAAATTTCAAGCAAA
TATGTGAGCAATATAGCTTACAAGCTCGTGGGACCTATGGTGAACATACT
GAAAATGTTGGTGGCGTATTTGATATTAGTAATCAAAGACGACTGGGTCT
AACAGAAATCCAGGCAGCAAAAGAAATGTATGATGGAGTAAATGCTATAA
TAGCAATTGAAAAAATGTTAGGCAAATATAATAAAACAGCGCCAGAAGGA
ATACCTTATGTTGAATCACTCGAATACTTAGCTAAAATTATTTGGAACGA
TCCAAGCAACGATACGATAACAAAAAAACATTTAACTAAAGAAATTGTTG
ACAAATTTAATACAATTCGTACCAAAAATGGAAGTACTTTAGCCCACTGC
ATTAGAAATAGTGTCTATAATAACAAGGCTATATGTCCGAGAACTGGAGA
TGCCAAATGTTACAATTGCTTTTCTGAATATTTAGATGTGGTAATAAGAG
ATTATCACAAAGTTAAAGAACCTGAAGTCAGACATCCAAATGTAAATTTC
GGTGATCTTGAGAATTTAGGATTTCAAAATCTAGATCCAGAAGGCTCCTT
TATTATGAGTACTCGAATTAGAGTAGGAAGAAGTATAGATGGATTTAATT
TCCCTCCAACCATCAGTAAAGTAGATCGGCTTAAACTTGAAAAAACAATA
GTGGATGCTTTATCTAGTTTGACTGGAATTCATGGTGGAACTTACTACCC
ACTTACGGGTATGAAGGAAAATGTACAAAAACAACTCATAGAAGATCATT
TTCTTTTCAAAGATGATGATCCAGTTTTAAGAGATGCCGGTGGTTATCGA
GATTGGCCAAGTGGGCGAGGAATTTTTCATAATAATGAAAAGACGTTTTT
GGTTTGGGTTTGTGAAGAAGATCACATGAGAATTATTTCAATGCAAAAGG
GAGGAGATATCGCTGCCGTCTTTACTCGACTTGTTCAAGGTATACGACAA
ATTGAAACAAAACTAACTTTTGCTCACAGTAAAAAATATGGATATTTAAC
TTGCTGCCCAAGCAATCTGGGGACGACTATGCGAGCTAGTGTACATTTAA
AAATTCCCAAGCTTAGTTCTGACAAAACGAAGTTAAATGAAGTCTGCGAT
AGATTCAATCTTCAAGCCAGAGGTTTTCATGGTGAACATACAGAATCTCC
TGAAGGTATTTATGACATCAGTAACAAGCGACGGCTGGGCTTAATGGAAA
TAGAAGCAGCTACCGAAATGGCGAAAGGTGTTCTTGAAATGATTCAAATT
GAAAAATCTTTAAAATAAATATGATTGCTTTTAAAGAATTAATTTAAGGA
AAAATTTTATTCAAATATTAATTATAAATAATTTTTGAAAAATGAATAGA
ATATCAGCAACTAGAGTAATATACGATGGGGAGACCTCAAATCCAGAAAA
ATCAGGTGGGACAATCAAAAATAGTGATGCAGAGCAACCAACAAGTGCCA
AATTATTTCAGGAAAGAAAACTTGGAAATGTAATGTCTATGAAAATATTG
GAAGGAAATCGAAAAATTGATATCTTGGAAGATTGGAAAAGAAGAAATGA
GTTAAATTTTTAAAAAATATTTAAAATTTCATAAATGTGAAGCGTTGTTG
ATAAGGTTTTAGATCCAAAAATTGTGAAGACTGCTGCAAATACGCACCTT
TTGAATGTTTAACATATGGTTTGGTTGTTAAATTTTTGGTGTCTGAATTT
TTGTTGTAGTTTTCAAATGTATTGCGG
back to top

protein sequence of SMED30028062-orf-1

>SMED30028062-orf-1 ID=SMED30028062-orf-1|Name=SMED30028062-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=718bp
MEYKSLDEIYDMIYSNSENKSLAKKHLTKEIVAKYKNTKSKFGGTLAMCL
NTNAYNPRALMCRTADPDCYDVFGDYFNELIKDYHKVATKEIEHPASDFG
DIEHLPFKNMDVDKVYINSTRVRFGRTVKGFAFAPVISKEDRVTLSEQIA
NALKNLTGELQGNYYGLDNMTKEKQDELIKDHFLYRDDDQVLRDAGGYRD
WPSGRGIFLNNEKTFVVWINEEDHIRIISMEPGGDLPKVYRRLIAGLKGL
EENLEFERHKRFGFLTFCPTNLGTTMRASVHIKIPFLSMLPNFKQICEQY
SLQARGTYGEHTENVGGVFDISNQRRLGLTEIQAAKEMYDGVNAIIAIEK
MLGKYNKTAPEGIPYVESLEYLAKIIWNDPSNDTITKKHLTKEIVDKFNT
IRTKNGSTLAHCIRNSVYNNKAICPRTGDAKCYNCFSEYLDVVIRDYHKV
KEPEVRHPNVNFGDLENLGFQNLDPEGSFIMSTRIRVGRSIDGFNFPPTI
SKVDRLKLEKTIVDALSSLTGIHGGTYYPLTGMKENVQKQLIEDHFLFKD
DDPVLRDAGGYRDWPSGRGIFHNNEKTFLVWVCEEDHMRIISMQKGGDIA
AVFTRLVQGIRQIETKLTFAHSKKYGYLTCCPSNLGTTMRASVHLKIPKL
SSDKTKLNEVCDRFNLQARGFHGEHTESPEGIYDISNKRRLGLMEIEAAT
EMAKGVLEMIQIEKSLK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0004111creatine kinase activity
GO:0016491oxidoreductase activity
GO:0046872metal ion binding
GO:0050324taurocyamine kinase activity
GO:0003824catalytic activity
GO:0016301kinase activity
GO:0016772transferase activity, transferring phosphorus-containing groups
GO:0000166nucleotide binding
GO:0004054arginine kinase activity
GO:0005524ATP binding
GO:0016740transferase activity
Vocabulary: biological process
TermDefinition
GO:0046314phosphocreatine biosynthetic process
GO:0055114oxidation-reduction process
GO:0016310phosphorylation
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000208testis
PLANA:0000429neoblast
PLANA:0002030early male germ cell
PLANA:0002089reproductive organ
PLANA:0002109X1 cell
PLANA:0003304testis primordium
Vocabulary: INTERPRO
TermDefinition
IPR036802ATP-guanido_PTrfase_N_sf
IPR000749ATP-guanido_PTrfase
IPR014746Gln_synth/guanido_kin_cat_dom
IPR022413ATP-guanido_PTrfase_N
IPR022414ATP-guanido_PTrfase_cat
IPR022415ATP-guanido_PTrfase_AS
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR022413ATP:guanido phosphotransferase, N-terminalPFAMPF02807ATP-gua_PtransNcoord: 382..445
e-value: 5.4E-15
score: 55.5
coord: 17..82
e-value: 8.0E-14
score: 51.8
IPR022413ATP:guanido phosphotransferase, N-terminalPROSITEPS51509PHOSPHAGEN_KINASE_Ncoord: 5..86
score: 22.609
IPR022413ATP:guanido phosphotransferase, N-terminalPROSITEPS51509PHOSPHAGEN_KINASE_Ncoord: 368..449
score: 20.899
IPR022414ATP:guanido phosphotransferase, catalytic domainPFAMPF00217ATP-gua_Ptranscoord: 508..715
e-value: 2.9E-78
score: 262.2
coord: 146..351
e-value: 2.0E-81
score: 272.5
IPR022414ATP:guanido phosphotransferase, catalytic domainPROSITEPS51510PHOSPHAGEN_KINASE_Ccoord: 479..716
score: 84.808
IPR022414ATP:guanido phosphotransferase, catalytic domainPROSITEPS51510PHOSPHAGEN_KINASE_Ccoord: 116..352
score: 79.093
IPR036802ATP:guanido phosphotransferase, N-terminal domain superfamilyGENE3DG3DSA:1.10.135.10coord: 2..87
e-value: 6.0E-19
score: 70.3
IPR036802ATP:guanido phosphotransferase, N-terminal domain superfamilyGENE3DG3DSA:1.10.135.10coord: 375..454
e-value: 3.1E-16
score: 61.3
IPR036802ATP:guanido phosphotransferase, N-terminal domain superfamilySUPERFAMILYSSF48034Guanido kinase N-terminal domaincoord: 9..95
IPR036802ATP:guanido phosphotransferase, N-terminal domain superfamilySUPERFAMILYSSF48034Guanido kinase N-terminal domaincoord: 365..453
NoneNo IPR availableGENE3DG3DSA:3.30.590.10coord: 456..716
e-value: 9.0E-106
score: 354.8
coord: 93..352
e-value: 4.6E-99
score: 332.8
NoneNo IPR availablePANTHERPTHR11547:SF55coord: 15..351
coord: 378..715
NoneNo IPR availableCDDcd07932arginine_kinase_likecoord: 365..716
e-value: 0.0
score: 561.165
IPR000749ATP:guanido phosphotransferasePANTHERPTHR11547ARGININE OR CREATINE KINASEcoord: 15..351
coord: 378..715
IPR022415ATP:guanido phosphotransferase active sitePROSITEPS00112PHOSPHAGEN_KINASEcoord: 268..274
IPR022415ATP:guanido phosphotransferase active sitePROSITEPS00112PHOSPHAGEN_KINASEcoord: 631..637
IPR014746Glutamine synthetase/guanido kinase, catalytic domainSUPERFAMILYSSF55931Glutamine synthetase/guanido kinasecoord: 470..716
IPR014746Glutamine synthetase/guanido kinase, catalytic domainSUPERFAMILYSSF55931Glutamine synthetase/guanido kinasecoord: 98..355