Telomere repeat binding factor 2-1

Overview
NameTelomere repeat binding factor 2-1
Smed IDSMED30028055
Length (bp)1583
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Telomere repeat binding factor 2-1 (SMED30028055) t-SNE clustered cells

Violin plots show distribution of expression levels for Telomere repeat binding factor 2-1 (SMED30028055) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Telomere repeat binding factor 2-1 (SMED30028055) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Telomere repeat binding factor 2-1 (SMED30028055) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028055

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30028055SMESG000012908.1 Contig3122GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30028055SMESG000064518.1 Contig3122GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
testisSMED30028055SMESG000064518.1 KU852673smed_ncbi_20200123PMID:27330085
Iyer et al., 2016
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
male germ cellSMED30028055SMESG000064518.1 KU852673smed_ncbi_20200123PMID:27330085
Iyer et al., 2016
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Telomere repeat binding factor 2-1 vs. Ensembl Human
Match: TBP (TATA-box binding protein [Source:HGNC Symbol;Acc:HGNC:11588])

HSP 1 Score: 329.717 bits (844), Expect = 1.119e-109
Identity = 155/198 (78.28%), Postives = 178/198 (89.90%), Query Frame = -3
Query:  748 TPVTPHTPSTPMIDKEIVMPTPQLQNIVCTVNLGCKLDLKSIALHARNAEYNPKRFAAVIMRIRTPRTTALIFSSGKMVCTGAKSEDEAKLAARKFARIIQKLDFDAKFMNFKIQNMVGSCDVKFPIRLEGICLSHTQFATYEPELFPGLIYRMGKPKIVLLIFVSGKIVLTGAKVREEIYEAFKNIYPILKTFMNTS 1341
            TP+TP TP+TP  +   ++P  QLQNIV TVNLGCKLDLK+IAL ARNAEYNPKRFAAVIMRIR PRTTALIFSSGKMVCTGAKSE++++LAARK+AR++QKL F AKF++FKIQNMVGSCDVKFPIRLEG+ L+H QF++YEPELFPGLIYRM KP+IVLLIFVSGK+VLTGAKVR EIYEAF+NIYPILK F  T+
Sbjct:   93 TPMTPITPATPASESSGIVP--QLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVRAEIYEAFENIYPILKGFRKTT 288          
BLAST of Telomere repeat binding factor 2-1 vs. Ensembl Human
Match: TBP (TATA-box binding protein [Source:HGNC Symbol;Acc:HGNC:11588])

HSP 1 Score: 328.176 bits (840), Expect = 9.628e-109
Identity = 155/198 (78.28%), Postives = 178/198 (89.90%), Query Frame = -3
Query:  748 TPVTPHTPSTPMIDKEIVMPTPQLQNIVCTVNLGCKLDLKSIALHARNAEYNPKRFAAVIMRIRTPRTTALIFSSGKMVCTGAKSEDEAKLAARKFARIIQKLDFDAKFMNFKIQNMVGSCDVKFPIRLEGICLSHTQFATYEPELFPGLIYRMGKPKIVLLIFVSGKIVLTGAKVREEIYEAFKNIYPILKTFMNTS 1341
            TP+TP TP+TP  +   ++P  QLQNIV TVNLGCKLDLK+IAL ARNAEYNPKRFAAVIMRIR PRTTALIFSSGKMVCTGAKSE++++LAARK+AR++QKL F AKF++FKIQNMVGSCDVKFPIRLEG+ L+H QF++YEPELFPGLIYRM KP+IVLLIFVSGK+VLTGAKVR EIYEAF+NIYPILK F  T+
Sbjct:  124 TPMTPITPATPASESSGIVP--QLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVRAEIYEAFENIYPILKGFRKTT 319          
BLAST of Telomere repeat binding factor 2-1 vs. Ensembl Human
Match: TBP (TATA-box binding protein [Source:HGNC Symbol;Acc:HGNC:11588])

HSP 1 Score: 328.946 bits (842), Expect = 9.690e-109
Identity = 155/198 (78.28%), Postives = 178/198 (89.90%), Query Frame = -3
Query:  748 TPVTPHTPSTPMIDKEIVMPTPQLQNIVCTVNLGCKLDLKSIALHARNAEYNPKRFAAVIMRIRTPRTTALIFSSGKMVCTGAKSEDEAKLAARKFARIIQKLDFDAKFMNFKIQNMVGSCDVKFPIRLEGICLSHTQFATYEPELFPGLIYRMGKPKIVLLIFVSGKIVLTGAKVREEIYEAFKNIYPILKTFMNTS 1341
            TP+TP TP+TP  +   ++P  QLQNIV TVNLGCKLDLK+IAL ARNAEYNPKRFAAVIMRIR PRTTALIFSSGKMVCTGAKSE++++LAARK+AR++QKL F AKF++FKIQNMVGSCDVKFPIRLEG+ L+H QF++YEPELFPGLIYRM KP+IVLLIFVSGK+VLTGAKVR EIYEAF+NIYPILK F  T+
Sbjct:  144 TPMTPITPATPASESSGIVP--QLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVRAEIYEAFENIYPILKGFRKTT 339          
BLAST of Telomere repeat binding factor 2-1 vs. Ensembl Human
Match: TBP (TATA-box binding protein [Source:HGNC Symbol;Acc:HGNC:11588])

HSP 1 Score: 328.946 bits (842), Expect = 9.690e-109
Identity = 155/198 (78.28%), Postives = 178/198 (89.90%), Query Frame = -3
Query:  748 TPVTPHTPSTPMIDKEIVMPTPQLQNIVCTVNLGCKLDLKSIALHARNAEYNPKRFAAVIMRIRTPRTTALIFSSGKMVCTGAKSEDEAKLAARKFARIIQKLDFDAKFMNFKIQNMVGSCDVKFPIRLEGICLSHTQFATYEPELFPGLIYRMGKPKIVLLIFVSGKIVLTGAKVREEIYEAFKNIYPILKTFMNTS 1341
            TP+TP TP+TP  +   ++P  QLQNIV TVNLGCKLDLK+IAL ARNAEYNPKRFAAVIMRIR PRTTALIFSSGKMVCTGAKSE++++LAARK+AR++QKL F AKF++FKIQNMVGSCDVKFPIRLEG+ L+H QF++YEPELFPGLIYRM KP+IVLLIFVSGK+VLTGAKVR EIYEAF+NIYPILK F  T+
Sbjct:  144 TPMTPITPATPASESSGIVP--QLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVRAEIYEAFENIYPILKGFRKTT 339          
BLAST of Telomere repeat binding factor 2-1 vs. Ensembl Human
Match: TBPL2 (TATA-box binding protein like 2 [Source:HGNC Symbol;Acc:HGNC:19841])

HSP 1 Score: 317.005 bits (811), Expect = 1.595e-103
Identity = 149/192 (77.60%), Postives = 170/192 (88.54%), Query Frame = -3
Query:  760 VTPHTPSTPMIDKEIVMPTPQLQNIVCTVNLGCKLDLKSIALHARNAEYNPKRFAAVIMRIRTPRTTALIFSSGKMVCTGAKSEDEAKLAARKFARIIQKLDFDAKFMNFKIQNMVGSCDVKFPIRLEGICLSHTQFATYEPELFPGLIYRMGKPKIVLLIFVSGKIVLTGAKVREEIYEAFKNIYPILKTF 1335
            +TP TP TP+   E     PQLQNIV TVNL CKLDLK IALHA+NAEYNPKRFAAVIMRIR PRTTALIFSSGKMVCTGAKSE++++LAARK+AR++QKL F A+F++FKIQNMVGSCDV+FPIRLEG+ L+H QF++YEPELFPGLIYRM KP+IVLLIFVSGK+VLTGAK R EIYEAF+NIYPILK F
Sbjct:  183 ITPMTPMTPI--SECCGIVPQLQNIVSTVNLACKLDLKKIALHAKNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPARFLDFKIQNMVGSCDVRFPIRLEGLVLTHQQFSSYEPELFPGLIYRMVKPRIVLLIFVSGKVVLTGAKERSEIYEAFENIYPILKGF 372          
BLAST of Telomere repeat binding factor 2-1 vs. Ensembl Celegans
Match: tbp-1 (TATA-box-binding protein [Source:UniProtKB/Swiss-Prot;Acc:P32085])

HSP 1 Score: 301.597 bits (771), Expect = 1.875e-98
Identity = 139/187 (74.33%), Postives = 163/187 (87.17%), Query Frame = -3
Query:  760 PSTPMIDKEIVMPTPQLQNIVCTVNLGCKLDLKSIALHARNAEYNPKRFAAVIMRIRTPRTTALIFSSGKMVCTGAKSEDEAKLAARKFARIIQKLDFDAKFMNFKIQNMVGSCDVKFPIRLEGICLSHTQFATYEPELFPGLIYRMGKPKIVLLIFVSGKIVLTGAKVREEIYEAFKNIYPILKTF 1320
            P+TP    ++ +P P LQNIV TVNLG +LDLK IALHARNAEYNPKRFAAVIMRIR PRTTALIFSSGKMVCTGAKSE+ ++LAARK+ARI+QKL F AKF  F +QNMVGSCDV+FPI+LEG+C++H+QF+TYEPELFPGLIYRM KP++VLLIFVSGK+V+TGAK + +I EAF  IYPILK F
Sbjct:  154 PATPA--SQLDIPMPALQNIVSTVNLGVQLDLKKIALHARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEASRLAARKYARIVQKLGFQAKFTEFMVQNMVGSCDVRFPIQLEGLCITHSQFSTYEPELFPGLIYRMVKPRVVLLIFVSGKVVITGAKTKRDIDEAFGQIYPILKGF 338          
BLAST of Telomere repeat binding factor 2-1 vs. Ensembl Celegans
Match: ech-2 (Enoyl-CoA Hydratase [Source:UniProtKB/TrEMBL;Acc:D1MN80])

HSP 1 Score: 170.244 bits (430), Expect = 8.169e-49
Identity = 82/165 (49.70%), Postives = 107/165 (64.85%), Query Frame = 1
Query:   61 QLMKIIENYFIPVIVSIQGTAAAAGCQLVASCDIAICGQSSLFSTPGILAGLFCSTPGVAVGRVLPRKIALEMLYTGEPISAETALKYGLVNHVVEDSKIDETSEKIANKIASLSSSTMKLGKKCFIEQMKLEKEKAYELASNVMVENLQFTDCKEGIKAFLEKR 555
             +M  I N  +PVI  + GTAAAAG QLVASCD+ + G+SS F  PG   GLFCSTPG+A+ R +PRK+A++ML T +PI +E AL+ GLV+ VVED ++   +  +A +I   S S   LGK  F  Q +L    AY   S VMV NL+  DC+EGI AF+ KR
Sbjct:  102 DMMNFIRNMKVPVIAEVNGTAAAAGLQLVASCDVVVAGKSSKFLVPGQKLGLFCSTPGIALVRAVPRKVAMDMLLTAQPIDSEAALRSGLVSRVVEDDQVKFEALNVAEQIGHFSRSVTALGKAFFYTQAELSTVDAYRYGSRVMVGNLKLKDCQEGISAFIGKR 266          
BLAST of Telomere repeat binding factor 2-1 vs. Ensembl Celegans
Match: ech-2 (Enoyl-CoA Hydratase [Source:UniProtKB/TrEMBL;Acc:D1MN80])

HSP 1 Score: 170.244 bits (430), Expect = 8.169e-49
Identity = 82/165 (49.70%), Postives = 107/165 (64.85%), Query Frame = 1
Query:   61 QLMKIIENYFIPVIVSIQGTAAAAGCQLVASCDIAICGQSSLFSTPGILAGLFCSTPGVAVGRVLPRKIALEMLYTGEPISAETALKYGLVNHVVEDSKIDETSEKIANKIASLSSSTMKLGKKCFIEQMKLEKEKAYELASNVMVENLQFTDCKEGIKAFLEKR 555
             +M  I N  +PVI  + GTAAAAG QLVASCD+ + G+SS F  PG   GLFCSTPG+A+ R +PRK+A++ML T +PI +E AL+ GLV+ VVED ++   +  +A +I   S S   LGK  F  Q +L    AY   S VMV NL+  DC+EGI AF+ KR
Sbjct:  102 DMMNFIRNMKVPVIAEVNGTAAAAGLQLVASCDVVVAGKSSKFLVPGQKLGLFCSTPGIALVRAVPRKVAMDMLLTAQPIDSEAALRSGLVSRVVEDDQVKFEALNVAEQIGHFSRSVTALGKAFFYTQAELSTVDAYRYGSRVMVGNLKLKDCQEGISAFIGKR 266          
BLAST of Telomere repeat binding factor 2-1 vs. Ensembl Celegans
Match: ech-2 (Enoyl-CoA Hydratase [Source:UniProtKB/TrEMBL;Acc:D1MN80])

HSP 1 Score: 170.244 bits (430), Expect = 1.299e-48
Identity = 82/165 (49.70%), Postives = 107/165 (64.85%), Query Frame = 1
Query:   61 QLMKIIENYFIPVIVSIQGTAAAAGCQLVASCDIAICGQSSLFSTPGILAGLFCSTPGVAVGRVLPRKIALEMLYTGEPISAETALKYGLVNHVVEDSKIDETSEKIANKIASLSSSTMKLGKKCFIEQMKLEKEKAYELASNVMVENLQFTDCKEGIKAFLEKR 555
             +M  I N  +PVI  + GTAAAAG QLVASCD+ + G+SS F  PG   GLFCSTPG+A+ R +PRK+A++ML T +PI +E AL+ GLV+ VVED ++   +  +A +I   S S   LGK  F  Q +L    AY   S VMV NL+  DC+EGI AF+ KR
Sbjct:  116 DMMNFIRNMKVPVIAEVNGTAAAAGLQLVASCDVVVAGKSSKFLVPGQKLGLFCSTPGIALVRAVPRKVAMDMLLTAQPIDSEAALRSGLVSRVVEDDQVKFEALNVAEQIGHFSRSVTALGKAFFYTQAELSTVDAYRYGSRVMVGNLKLKDCQEGISAFIGKR 280          
BLAST of Telomere repeat binding factor 2-1 vs. Ensembl Celegans
Match: tlf-1 (TBP-like factor [Source:UniProtKB/TrEMBL;Acc:G5EC52])

HSP 1 Score: 115.161 bits (287), Expect = 3.712e-27
Identity = 60/177 (33.90%), Postives = 100/177 (56.50%), Query Frame = -3
Query:  760 QLQNIVCTVNLGCKLDLKSIALHARNAEYNPKRFAAVIMRI-RTPRTTALIFSSGKMVCTGAKSEDEAKLAARKFARIIQKLDFDAK----FMNFKIQNMVGSCDVKFPIRLEGICLSHTQFATYEPELFPGLIYRMGKPKIVLLIFVSGKIVLTGAKVREEIYEAFKNIYPILKTF 1275
            Q++N+VC   L   +DL+ +A++  N  Y  +R   V+M+  R+P     ++SSGK+   G +SE + K AAR  AR +Q++    K      N+++ N++ +C + F I++E +   +   +TYEPEL  GL++R   PK  L I  +G I +TGA+   ++ E    IYPI+  F
Sbjct:  266 QIRNVVCNYTLPLHIDLRKLAMNTHNVTY--EREKGVMMKQKRSPGCYIKVYSSGKVYIVGCRSEADCKRAARSIARHVQRVMGKTKERVSIRNYRVNNVLATCRLPFGIKIEEVAAKYPSESTYEPELSVGLVWRSVTPKATLRIHTTGSITVTGAQSEADVLEVLSKIYPIVLEF 440          
BLAST of Telomere repeat binding factor 2-1 vs. Ensembl Fly
Match: Tbp (gene:FBgn0003687 transcript:FBtr0071679)

HSP 1 Score: 318.546 bits (815), Expect = 8.832e-105
Identity = 155/198 (78.28%), Postives = 172/198 (86.87%), Query Frame = -3
Query:  748 PVTPHTPSTP-MIDKEIVMPTPQLQNIVCTVNLGCKLDLKSIALHARNAEYNPKRFAAVIMRIRTPRTTALIFSSGKMVCTGAKSEDEAKLAARKFARIIQKLDFDAKFMNFKIQNMVGSCDVKFPIRLEGICLSHTQFATYEPELFPGLIYRMGKPKIVLLIFVSGKIVLTGAKVREEIYEAFKNIYPILKTFMNTS 1338
            P TP TP+TP   D  IV   PQLQNIV TVNL CKLDLK IALHARNAEYNPKRFAAVIMRIR PRTTALIFSSGKMVCTGAKSED+++LAARK+ARIIQKL F AKF++FKIQNMVGSCDVKFPIRLEG+ L+H  F++YEPELFPGLIYRM +P+IVLLIFVSGK+VLTGAKVR+EIY+AF  I+PILK F   S
Sbjct:  159 PSTPMTPATPGSADPGIV---PQLQNIVSTVNLCCKLDLKKIALHARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEDDSRLAARKYARIIQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHCNFSSYEPELFPGLIYRMVRPRIVLLIFVSGKVVLTGAKVRQEIYDAFDKIFPILKKFKKQS 353          
BLAST of Telomere repeat binding factor 2-1 vs. Ensembl Fly
Match: Trf (gene:FBgn0010287 transcript:FBtr0079542)

HSP 1 Score: 225.713 bits (574), Expect = 1.248e-70
Identity = 108/198 (54.55%), Postives = 144/198 (72.73%), Query Frame = -3
Query:  751 PHTPSTPMIDKEIVMPTP-----QLQNIVCTVNLGCKLDLKSIALHARNAEYNPKRFAAVIMRIRTPRTTALIFSSGKMVCTGAKSEDEAKLAARKFARIIQKLDFDAKFMNFKIQNMVGSCDVKFPIRLEGICLSHTQFATYEPELFPGLIYRMGKPKIVLLIFVSGKIVLTGAKVREEIYEAFKNIYPILKTFMNT 1329
            PH    P     +V P       +LQNIV T ++ C+LDLK+I    RN+EY+PKRF  VIMR+ +PR TALIF +GK++CTGA++E EA + +RKFARI+QKL F  KFM +K+QN+V + D++FPIRLE +   H QF++YEPE+FPGLIYRM KP+IVLLIFV+GK+V TGAK R++I +  + I PIL +F  T
Sbjct:   27 PHAALQPQQPVALVEPKDAQHEIRLQNIVATFSVNCELDLKAINSRTRNSEYSPKRFRGVIMRMHSPRCTALIFRTGKVICTGARNEIEADIGSRKFARILQKLGFPVKFMEYKLQNIVATVDLRFPIRLENLNHVHGQFSSYEPEMFPGLIYRMVKPRIVLLIFVNGKVVFTGAKSRKDIMDCLEAISPILLSFRKT 224          
BLAST of Telomere repeat binding factor 2-1 vs. Ensembl Fly
Match: CG6984 (gene:FBgn0034191 transcript:FBtr0086979)

HSP 1 Score: 150.214 bits (378), Expect = 3.381e-41
Identity = 72/164 (43.90%), Postives = 103/164 (62.80%), Query Frame = 1
Query:   76 IENYFIPVIVSIQGTAAAAGCQLVASCDIAICGQSSLFSTPGILAGLFCSTPGVAVGRVLPRKIALEMLYTGEPISAETALKYGLVNHVVEDSKIDETSEKIANKIASLSSSTMKLGKKCFIEQMKLEKEKAYELASNVMVENLQFTDCKEGIKAFLEKRKPRW 567
            I+   +PV+  + G AAAAGCQLV SCD+ +C ++S FSTPG   G+FCSTPGVAV R++ R  +  ML TG P++ E A   G+V   V   ++D+  E+I N I + S + + LGK+ + +Q+ + + +A+  A   M EN Q  D KEGI +F EKR P W
Sbjct:  119 IQRLPVPVLGKVNGYAAAAGCQLVVSCDMVVCTKNSKFSTPGAGVGVFCSTPGVAVARIMSRPKSAYMLMTGLPVTGEEAYISGMVTKAVPAEELDKEIEEITNAIKAKSRAVISLGKEFYYKQLAMSQAEAFSAAQEKMCENFQLGDTKEGIASFFEKRPPNW 282          
BLAST of Telomere repeat binding factor 2-1 vs. Ensembl Fly
Match: Trf2 (gene:FBgn0261793 transcript:FBtr0333811)

HSP 1 Score: 152.525 bits (384), Expect = 1.868e-39
Identity = 73/173 (42.20%), Postives = 111/173 (64.16%), Query Frame = -3
Query:  760 LQNIVCTVNLGCKLDLKSIALHARNAEYNPKRFAAVIMRIRTPRTTALIFSSGKMVCTGAKSEDEAKLAARKFARIIQKLDFDAKFMNFKIQNMVGSCDVKFPIRLEGICLSHTQFATYEPELFPGLIYRMG--KPKIVLLIFVSGKIVLTGAKVREEIYEAFKNIYPILKTF 1272
            + N+VC+ ++GC L L+ IAL   N EY  +    V M++R P TTA I+SSG++ CTGA SE  AK+AAR++AR + KL F  +F+NF+I N++G+C + + I++      H + A+YEPEL PG+ Y+M    PK  L IF +G + +T A V   +  A ++IYP++  F
Sbjct:  204 INNVVCSFSVGCHLKLREIALQGSNVEYR-RENGMVTMKLRHPYTTASIWSSGRITCTGATSESMAKVAARRYARCLGKLGFPTRFLNFRIVNVLGTCSMPWAIKIVNFSERHRENASYEPELHPGVTYKMRDPDPKATLKIFSTGSVTVTAASV-NHVESAIQHIYPLVFDF 374          
BLAST of Telomere repeat binding factor 2-1 vs. Ensembl Fly
Match: Trf2 (gene:FBgn0261793 transcript:FBtr0330106)

HSP 1 Score: 152.525 bits (384), Expect = 1.868e-39
Identity = 73/173 (42.20%), Postives = 111/173 (64.16%), Query Frame = -3
Query:  760 LQNIVCTVNLGCKLDLKSIALHARNAEYNPKRFAAVIMRIRTPRTTALIFSSGKMVCTGAKSEDEAKLAARKFARIIQKLDFDAKFMNFKIQNMVGSCDVKFPIRLEGICLSHTQFATYEPELFPGLIYRMG--KPKIVLLIFVSGKIVLTGAKVREEIYEAFKNIYPILKTF 1272
            + N+VC+ ++GC L L+ IAL   N EY  +    V M++R P TTA I+SSG++ CTGA SE  AK+AAR++AR + KL F  +F+NF+I N++G+C + + I++      H + A+YEPEL PG+ Y+M    PK  L IF +G + +T A V   +  A ++IYP++  F
Sbjct:  204 INNVVCSFSVGCHLKLREIALQGSNVEYR-RENGMVTMKLRHPYTTASIWSSGRITCTGATSESMAKVAARRYARCLGKLGFPTRFLNFRIVNVLGTCSMPWAIKIVNFSERHRENASYEPELHPGVTYKMRDPDPKATLKIFSTGSVTVTAASV-NHVESAIQHIYPLVFDF 374          
BLAST of Telomere repeat binding factor 2-1 vs. Ensembl Zebrafish
Match: tbp (TATA box binding protein [Source:NCBI gene;Acc:368882])

HSP 1 Score: 330.102 bits (845), Expect = 6.593e-110
Identity = 156/198 (78.79%), Postives = 178/198 (89.90%), Query Frame = -3
Query:  748 TPVTPHTPSTPMIDKEIVMPTPQLQNIVCTVNLGCKLDLKSIALHARNAEYNPKRFAAVIMRIRTPRTTALIFSSGKMVCTGAKSEDEAKLAARKFARIIQKLDFDAKFMNFKIQNMVGSCDVKFPIRLEGICLSHTQFATYEPELFPGLIYRMGKPKIVLLIFVSGKIVLTGAKVREEIYEAFKNIYPILKTFMNTS 1341
            TP+TP TP+TP  +   ++P  QLQNIV TVNLGCKLDLK+IAL ARNAEYNPKRFAAVIMRIR PRTTALIFSSGKMVCTGAKSE++++LAARK+AR++QKL F AKF++FKIQNMVGSCDVKFPIRLEG+ L+H QF++YEPELFPGLIYRM KP+IVLLIFVSGK+VLTGAKVR EIYEAF+NIYPILK F  TS
Sbjct:  107 TPMTPITPATPASESSGIVP--QLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVRGEIYEAFENIYPILKGFRKTS 302          
BLAST of Telomere repeat binding factor 2-1 vs. Ensembl Zebrafish
Match: tbp (TATA box binding protein [Source:NCBI gene;Acc:368882])

HSP 1 Score: 330.102 bits (845), Expect = 6.593e-110
Identity = 156/198 (78.79%), Postives = 178/198 (89.90%), Query Frame = -3
Query:  748 TPVTPHTPSTPMIDKEIVMPTPQLQNIVCTVNLGCKLDLKSIALHARNAEYNPKRFAAVIMRIRTPRTTALIFSSGKMVCTGAKSEDEAKLAARKFARIIQKLDFDAKFMNFKIQNMVGSCDVKFPIRLEGICLSHTQFATYEPELFPGLIYRMGKPKIVLLIFVSGKIVLTGAKVREEIYEAFKNIYPILKTFMNTS 1341
            TP+TP TP+TP  +   ++P  QLQNIV TVNLGCKLDLK+IAL ARNAEYNPKRFAAVIMRIR PRTTALIFSSGKMVCTGAKSE++++LAARK+AR++QKL F AKF++FKIQNMVGSCDVKFPIRLEG+ L+H QF++YEPELFPGLIYRM KP+IVLLIFVSGK+VLTGAKVR EIYEAF+NIYPILK F  TS
Sbjct:  107 TPMTPITPATPASESSGIVP--QLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVRGEIYEAFENIYPILKGFRKTS 302          
BLAST of Telomere repeat binding factor 2-1 vs. Ensembl Zebrafish
Match: tbpl2 (TATA box binding protein like 2 [Source:NCBI gene;Acc:407713])

HSP 1 Score: 308.916 bits (790), Expect = 1.690e-101
Identity = 143/173 (82.66%), Postives = 159/173 (91.91%), Query Frame = -3
Query:  760 PQLQNIVCTVNLGCKLDLKSIALHARNAEYNPKRFAAVIMRIRTPRTTALIFSSGKMVCTGAKSEDEAKLAARKFARIIQKLDFDAKFMNFKIQNMVGSCDVKFPIRLEGICLSHTQFATYEPELFPGLIYRMGKPKIVLLIFVSGKIVLTGAKVREEIYEAFKNIYPILKTF 1278
            PQLQNIV TVNL C LDLKSIAL ARNAEYNPKRFAAVIMRIR PRTTALIFSSGKMVCTGAKSE++++LAARK+AR++QKL F AKF++FKIQNMVGSCDV FPIRLEG+ L+H QF++YEPELFPGLIYRM KP+IVLLIFVSGK+VLTGAK R EIYEAF+NIYPILK F
Sbjct:  137 PQLQNIVSTVNLACPLDLKSIALQARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVCFPIRLEGLVLTHQQFSSYEPELFPGLIYRMVKPRIVLLIFVSGKVVLTGAKERSEIYEAFENIYPILKGF 309          
BLAST of Telomere repeat binding factor 2-1 vs. Ensembl Zebrafish
Match: tbpl1 (TBP-like 1 [Source:NCBI gene;Acc:403035])

HSP 1 Score: 136.732 bits (343), Expect = 3.636e-37
Identity = 68/168 (40.48%), Postives = 103/168 (61.31%), Query Frame = -3
Query:  769 LQNIVCTVNLGCKLDLKSIALHARNAEYNPKRFAAVIMRIRTPRTTALIFSSGKMVCTGAKSEDEAKLAARKFARIIQKLDFDAKFMNFKIQNMVGSCDVKFPIRLEGICLSHTQFATYEPELFPGLIYRMGKPKIVLLIFVSGKIVLTGAKVREEIYEAFKNIYPIL 1272
            + N+V      C L+L++I L   N  Y P+    V+M++R PR TA I+SSGK++CTGA SE+EAKL AR+ AR +QK+ F  +F +FK+ N++  C + F IRL     ++   A+YEPEL P   YR+   +  + +F +G I +TG  V + +  A + IYP+L
Sbjct:   13 VTNVVSVFRTRCHLNLRTIGLEGTNVIYKPE-VGKVLMKLRKPRITASIWSSGKIICTGATSEEEAKLGARRLARCLQKMGFKVRFSDFKVVNVLAVCSMPFQIRLIEFTKNNRPIASYEPELHPAASYRIKNLRSTVQVFSTGNITVTGPNV-QSVASAVEEIYPLL 178          
BLAST of Telomere repeat binding factor 2-1 vs. Ensembl Zebrafish
Match: tbpl1 (TBP-like 1 [Source:NCBI gene;Acc:403035])

HSP 1 Score: 136.732 bits (343), Expect = 3.636e-37
Identity = 68/168 (40.48%), Postives = 103/168 (61.31%), Query Frame = -3
Query:  769 LQNIVCTVNLGCKLDLKSIALHARNAEYNPKRFAAVIMRIRTPRTTALIFSSGKMVCTGAKSEDEAKLAARKFARIIQKLDFDAKFMNFKIQNMVGSCDVKFPIRLEGICLSHTQFATYEPELFPGLIYRMGKPKIVLLIFVSGKIVLTGAKVREEIYEAFKNIYPIL 1272
            + N+V      C L+L++I L   N  Y P+    V+M++R PR TA I+SSGK++CTGA SE+EAKL AR+ AR +QK+ F  +F +FK+ N++  C + F IRL     ++   A+YEPEL P   YR+   +  + +F +G I +TG  V + +  A + IYP+L
Sbjct:   13 VTNVVSVFRTRCHLNLRTIGLEGTNVIYKPE-VGKVLMKLRKPRITASIWSSGKIICTGATSEEEAKLGARRLARCLQKMGFKVRFSDFKVVNVLAVCSMPFQIRLIEFTKNNRPIASYEPELHPAASYRIKNLRSTVQVFSTGNITVTGPNV-QSVASAVEEIYPLL 178          
BLAST of Telomere repeat binding factor 2-1 vs. Ensembl Xenopus
Match: tbp (TATA-box binding protein [Source:NCBI gene;Acc:549093])

HSP 1 Score: 328.561 bits (841), Expect = 3.692e-109
Identity = 155/198 (78.28%), Postives = 178/198 (89.90%), Query Frame = -3
Query:  748 TPVTPHTPSTPMIDKEIVMPTPQLQNIVCTVNLGCKLDLKSIALHARNAEYNPKRFAAVIMRIRTPRTTALIFSSGKMVCTGAKSEDEAKLAARKFARIIQKLDFDAKFMNFKIQNMVGSCDVKFPIRLEGICLSHTQFATYEPELFPGLIYRMGKPKIVLLIFVSGKIVLTGAKVREEIYEAFKNIYPILKTFMNTS 1341
            TP+TP TP+TP  +   ++P  QLQNIV TVNLGCKLDLK+IAL ARNAEYNPKRFAAVIMRIR PRTTALIFSSGKMVCTGAKSE++++LAARK+AR++QKL F AKF++FKIQNMVGSCDVKFPIRLEG+ L+H QF++YEPELFPGLIYRM KP+IVLLIFVSGK+VLTGAKVR EIYEAF+NIYPILK F  T+
Sbjct:  102 TPMTPITPATPASESSGIVP--QLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVRAEIYEAFENIYPILKGFRKTT 297          
BLAST of Telomere repeat binding factor 2-1 vs. Ensembl Xenopus
Match: tbp (TATA-box binding protein [Source:NCBI gene;Acc:549093])

HSP 1 Score: 327.791 bits (839), Expect = 6.853e-109
Identity = 155/198 (78.28%), Postives = 178/198 (89.90%), Query Frame = -3
Query:  748 TPVTPHTPSTPMIDKEIVMPTPQLQNIVCTVNLGCKLDLKSIALHARNAEYNPKRFAAVIMRIRTPRTTALIFSSGKMVCTGAKSEDEAKLAARKFARIIQKLDFDAKFMNFKIQNMVGSCDVKFPIRLEGICLSHTQFATYEPELFPGLIYRMGKPKIVLLIFVSGKIVLTGAKVREEIYEAFKNIYPILKTFMNTS 1341
            TP+TP TP+TP  +   ++P  QLQNIV TVNLGCKLDLK+IAL ARNAEYNPKRFAAVIMRIR PRTTALIFSSGKMVCTGAKSE++++LAARK+AR++QKL F AKF++FKIQNMVGSCDVKFPIRLEG+ L+H QF++YEPELFPGLIYRM KP+IVLLIFVSGK+VLTGAKVR EIYEAF+NIYPILK F  T+
Sbjct:  102 TPMTPITPATPASESSGIVP--QLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVRAEIYEAFENIYPILKGFRKTT 297          
BLAST of Telomere repeat binding factor 2-1 vs. Ensembl Xenopus
Match: pa2g4 (proliferation-associated 2G4 [Source:Xenbase;Acc:XB-GENE-943133])

HSP 1 Score: 314.309 bits (804), Expect = 3.254e-103
Identity = 145/177 (81.92%), Postives = 163/177 (92.09%), Query Frame = -3
Query:  748 PQLQNIVCTVNLGCKLDLKSIALHARNAEYNPKRFAAVIMRIRTPRTTALIFSSGKMVCTGAKSEDEAKLAARKFARIIQKLDFDAKFMNFKIQNMVGSCDVKFPIRLEGICLSHTQFATYEPELFPGLIYRMGKPKIVLLIFVSGKIVLTGAKVREEIYEAFKNIYPILKTFMNTS 1278
            PQLQNIV TVNL CKLDLK IALHARNAEYNPKRFAAVIMRIR PRTTALIFSSGKMVCTGAKSE++++LAARK+AR++QKL F AKF++FKIQNMVGSCDV+FPIRLEG+ L+H QF++YEPELFPGLIYRM KP+IVLLIFVSGK+VLTGAK R EIYEAF+NIYPILK F  T+
Sbjct:  146 PQLQNIVSTVNLACKLDLKKIALHARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVRFPIRLEGLVLTHQQFSSYEPELFPGLIYRMVKPRIVLLIFVSGKVVLTGAKERSEIYEAFENIYPILKGFKKTT 322          
BLAST of Telomere repeat binding factor 2-1 vs. Ensembl Xenopus
Match: tbp (TATA-box binding protein [Source:NCBI gene;Acc:549093])

HSP 1 Score: 291.582 bits (745), Expect = 5.108e-95
Identity = 136/176 (77.27%), Postives = 159/176 (90.34%), Query Frame = -3
Query:  814 TPVTPHTPSTPMIDKEIVMPTPQLQNIVCTVNLGCKLDLKSIALHARNAEYNPKRFAAVIMRIRTPRTTALIFSSGKMVCTGAKSEDEAKLAARKFARIIQKLDFDAKFMNFKIQNMVGSCDVKFPIRLEGICLSHTQFATYEPELFPGLIYRMGKPKIVLLIFVSGKIVLTGAKV 1341
            TP+TP TP+TP  +   ++P  QLQNIV TVNLGCKLDLK+IAL ARNAEYNPKRFAAVIMRIR PRTTALIFSSGKMVCTGAKSE++++LAARK+AR++QKL F AKF++FKIQNMVGSCDVKFPIRLEG+ L+H QF++YEPELFPGLIYRM KP+IVLLIFVSGK+VLTG ++
Sbjct:  102 TPMTPITPATPASESSGIVP--QLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGKQI 275          
BLAST of Telomere repeat binding factor 2-1 vs. Ensembl Xenopus
Match: pa2g4 (proliferation-associated 2G4 [Source:Xenbase;Acc:XB-GENE-943133])

HSP 1 Score: 222.246 bits (565), Expect = 8.632e-68
Identity = 103/129 (79.84%), Postives = 117/129 (90.70%), Query Frame = -3
Query:  895 PQLQNIVCTVNLGCKLDLKSIALHARNAEYNPKRFAAVIMRIRTPRTTALIFSSGKMVCTGAKSEDEAKLAARKFARIIQKLDFDAKFMNFKIQNMVGSCDVKFPIRLEGICLSHTQFATYEPELF-PG 1278
            PQLQNIV TVNL CKLDLK IALHARNAEYNPKRFAAVIMRIR PRTTALIFSSGKMVCTGAKSE++++LAARK+AR++QKL F AKF++FKIQNMVGSCDV+FPIRLEG+ L+H QF+ Y  E+F PG
Sbjct:  145 PQLQNIVSTVNLACKLDLKKIALHARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVRFPIRLEGLVLTHQQFSRYISEIFWPG 273          

HSP 2 Score: 50.447 bits (119), Expect = 3.123e-6
Identity = 26/67 (38.81%), Postives = 42/67 (62.69%), Query Frame = -3
Query:  805 KIQNMVGSCDVKFPIRLEGICLSHTQFATYEPELFPGLIYRMGKPKIVLLIFVSGKIVLTGAKVREE 1005
            ++QN+V + ++   + L+ I L H + A Y P+ F  +I R+ +P+   LIF SGK+V TGAK  E+
Sbjct:  146 QLQNIVSTVNLACKLDLKKIAL-HARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQ 211          
BLAST of Telomere repeat binding factor 2-1 vs. Ensembl Mouse
Match: Tbp (TATA box binding protein [Source:MGI Symbol;Acc:MGI:101838])

HSP 1 Score: 329.717 bits (844), Expect = 1.545e-109
Identity = 155/198 (78.28%), Postives = 178/198 (89.90%), Query Frame = -3
Query:  748 TPVTPHTPSTPMIDKEIVMPTPQLQNIVCTVNLGCKLDLKSIALHARNAEYNPKRFAAVIMRIRTPRTTALIFSSGKMVCTGAKSEDEAKLAARKFARIIQKLDFDAKFMNFKIQNMVGSCDVKFPIRLEGICLSHTQFATYEPELFPGLIYRMGKPKIVLLIFVSGKIVLTGAKVREEIYEAFKNIYPILKTFMNTS 1341
            TP+TP TP+TP  +   ++P  QLQNIV TVNLGCKLDLK+IAL ARNAEYNPKRFAAVIMRIR PRTTALIFSSGKMVCTGAKSE++++LAARK+AR++QKL F AKF++FKIQNMVGSCDVKFPIRLEG+ L+H QF++YEPELFPGLIYRM KP+IVLLIFVSGK+VLTGAKVR EIYEAF+NIYPILK F  T+
Sbjct:  121 TPMTPITPATPASESSGIVP--QLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVRAEIYEAFENIYPILKGFRKTT 316          
BLAST of Telomere repeat binding factor 2-1 vs. Ensembl Mouse
Match: Tbp (TATA box binding protein [Source:MGI Symbol;Acc:MGI:101838])

HSP 1 Score: 329.717 bits (844), Expect = 1.545e-109
Identity = 155/198 (78.28%), Postives = 178/198 (89.90%), Query Frame = -3
Query:  748 TPVTPHTPSTPMIDKEIVMPTPQLQNIVCTVNLGCKLDLKSIALHARNAEYNPKRFAAVIMRIRTPRTTALIFSSGKMVCTGAKSEDEAKLAARKFARIIQKLDFDAKFMNFKIQNMVGSCDVKFPIRLEGICLSHTQFATYEPELFPGLIYRMGKPKIVLLIFVSGKIVLTGAKVREEIYEAFKNIYPILKTFMNTS 1341
            TP+TP TP+TP  +   ++P  QLQNIV TVNLGCKLDLK+IAL ARNAEYNPKRFAAVIMRIR PRTTALIFSSGKMVCTGAKSE++++LAARK+AR++QKL F AKF++FKIQNMVGSCDVKFPIRLEG+ L+H QF++YEPELFPGLIYRM KP+IVLLIFVSGK+VLTGAKVR EIYEAF+NIYPILK F  T+
Sbjct:  121 TPMTPITPATPASESSGIVP--QLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVRAEIYEAFENIYPILKGFRKTT 316          
BLAST of Telomere repeat binding factor 2-1 vs. Ensembl Mouse
Match: Tbp (TATA box binding protein [Source:MGI Symbol;Acc:MGI:101838])

HSP 1 Score: 329.717 bits (844), Expect = 1.545e-109
Identity = 155/198 (78.28%), Postives = 178/198 (89.90%), Query Frame = -3
Query:  748 TPVTPHTPSTPMIDKEIVMPTPQLQNIVCTVNLGCKLDLKSIALHARNAEYNPKRFAAVIMRIRTPRTTALIFSSGKMVCTGAKSEDEAKLAARKFARIIQKLDFDAKFMNFKIQNMVGSCDVKFPIRLEGICLSHTQFATYEPELFPGLIYRMGKPKIVLLIFVSGKIVLTGAKVREEIYEAFKNIYPILKTFMNTS 1341
            TP+TP TP+TP  +   ++P  QLQNIV TVNLGCKLDLK+IAL ARNAEYNPKRFAAVIMRIR PRTTALIFSSGKMVCTGAKSE++++LAARK+AR++QKL F AKF++FKIQNMVGSCDVKFPIRLEG+ L+H QF++YEPELFPGLIYRM KP+IVLLIFVSGK+VLTGAKVR EIYEAF+NIYPILK F  T+
Sbjct:  121 TPMTPITPATPASESSGIVP--QLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVRAEIYEAFENIYPILKGFRKTT 316          
BLAST of Telomere repeat binding factor 2-1 vs. Ensembl Mouse
Match: Tbpl2 (TATA box binding protein like 2 [Source:MGI Symbol;Acc:MGI:2684058])

HSP 1 Score: 291.582 bits (745), Expect = 3.638e-94
Identity = 138/204 (67.65%), Postives = 168/204 (82.35%), Query Frame = -3
Query:  760 TPVTPHTPSTPMIDKEIVMP----------TPQLQNIVCTVNLGCKLDLKSIALHARNAEYNPKRFAAVIMRIRTPRTTALIFSSGKMVCTGAKSEDEAKLAARKFARIIQKLDFDAKFMNFKIQNMVGSCDVKFPIRLEGICLSHTQFATYEPELFPGLIYRMGKPKIVLLIFVSGKIVLTGAKVREEIYEAFKNIYPILKTF 1341
            +P TP++ + P+     +MP           PQLQN+V T NL CKLDL+ IAL+A+N EYNPKRFAAVIMRIR PRTTALIFSSGK+VCTGAKSE+E++LAARK+AR++QKL F  +F NFKIQNMVGSCDVKFPIRLE + L+H QF++YEPELFPGLIY+M KP++VLLIF SGK+VLTGAK R EIYEAF+N+YPIL++F
Sbjct:  142 SPETPNSNALPVALIASMMPMNPVPGFSGIVPQLQNVVSTANLACKLDLRKIALNAKNTEYNPKRFAAVIMRIREPRTTALIFSSGKVVCTGAKSEEESRLAARKYARVVQKLGFPVRFFNFKIQNMVGSCDVKFPIRLEILALTHRQFSSYEPELFPGLIYKMVKPQVVLLIFASGKVVLTGAKERSEIYEAFENMYPILESF 345          
BLAST of Telomere repeat binding factor 2-1 vs. Ensembl Mouse
Match: Tbpl2 (TATA box binding protein like 2 [Source:MGI Symbol;Acc:MGI:2684058])

HSP 1 Score: 287.345 bits (734), Expect = 1.807e-92
Identity = 138/205 (67.32%), Postives = 168/205 (81.95%), Query Frame = -3
Query:  760 TPVTPHTPSTPMIDKEIVMP----------TPQLQNIVCTVNLGCKLDLKSIALHARNAEYNPKRFAAVIMRIRTPRTTALIFSSGKMVCTGAKSEDEAKLAARKFARIIQKLDFDAKFMNFKIQNMVGSCDVKFPIRLEGICLSHTQF-ATYEPELFPGLIYRMGKPKIVLLIFVSGKIVLTGAKVREEIYEAFKNIYPILKTF 1341
            +P TP++ + P+     +MP           PQLQN+V T NL CKLDL+ IAL+A+N EYNPKRFAAVIMRIR PRTTALIFSSGK+VCTGAKSE+E++LAARK+AR++QKL F  +F NFKIQNMVGSCDVKFPIRLE + L+H QF ++YEPELFPGLIY+M KP++VLLIF SGK+VLTGAK R EIYEAF+N+YPIL++F
Sbjct:  143 SPETPNSNALPVALIASMMPMNPVPGFSGIVPQLQNVVSTANLACKLDLRKIALNAKNTEYNPKRFAAVIMRIREPRTTALIFSSGKVVCTGAKSEEESRLAARKYARVVQKLGFPVRFFNFKIQNMVGSCDVKFPIRLEILALTHRQFSSSYEPELFPGLIYKMVKPQVVLLIFASGKVVLTGAKERSEIYEAFENMYPILESF 347          
BLAST of Telomere repeat binding factor 2-1 vs. UniProt/SwissProt
Match: sp|Q7SXL3|TBP_DANRE (TATA-box-binding protein OS=Danio rerio OX=7955 GN=tbp PE=1 SV=1)

HSP 1 Score: 330.102 bits (845), Expect = 4.977e-109
Identity = 156/198 (78.79%), Postives = 178/198 (89.90%), Query Frame = -3
Query:  748 TPVTPHTPSTPMIDKEIVMPTPQLQNIVCTVNLGCKLDLKSIALHARNAEYNPKRFAAVIMRIRTPRTTALIFSSGKMVCTGAKSEDEAKLAARKFARIIQKLDFDAKFMNFKIQNMVGSCDVKFPIRLEGICLSHTQFATYEPELFPGLIYRMGKPKIVLLIFVSGKIVLTGAKVREEIYEAFKNIYPILKTFMNTS 1341
            TP+TP TP+TP  +   ++P  QLQNIV TVNLGCKLDLK+IAL ARNAEYNPKRFAAVIMRIR PRTTALIFSSGKMVCTGAKSE++++LAARK+AR++QKL F AKF++FKIQNMVGSCDVKFPIRLEG+ L+H QF++YEPELFPGLIYRM KP+IVLLIFVSGK+VLTGAKVR EIYEAF+NIYPILK F  TS
Sbjct:  107 TPMTPITPATPASESSGIVP--QLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVRGEIYEAFENIYPILKGFRKTS 302          
BLAST of Telomere repeat binding factor 2-1 vs. UniProt/SwissProt
Match: sp|Q92117|TBP_PROFL (TATA-box-binding protein OS=Protobothrops flavoviridis OX=88087 GN=TBP PE=3 SV=1)

HSP 1 Score: 329.717 bits (844), Expect = 6.437e-109
Identity = 155/198 (78.28%), Postives = 178/198 (89.90%), Query Frame = -3
Query:  748 TPVTPHTPSTPMIDKEIVMPTPQLQNIVCTVNLGCKLDLKSIALHARNAEYNPKRFAAVIMRIRTPRTTALIFSSGKMVCTGAKSEDEAKLAARKFARIIQKLDFDAKFMNFKIQNMVGSCDVKFPIRLEGICLSHTQFATYEPELFPGLIYRMGKPKIVLLIFVSGKIVLTGAKVREEIYEAFKNIYPILKTFMNTS 1341
            TP+TP TP+TP  +   ++P  QLQNIV TVNLGCKLDLK+IAL ARNAEYNPKRFAAVIMRIR PRTTALIFSSGKMVCTGAKSE++++LAARK+AR++QKL F AKF++FKIQNMVGSCDVKFPIRLEG+ L+H QF++YEPELFPGLIYRM KP+IVLLIFVSGK+VLTGAKVR EIYEAF+NIYPILK F  T+
Sbjct:  105 TPMTPITPATPASESSGIVP--QLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVRGEIYEAFENIYPILKGFRKTT 300          
BLAST of Telomere repeat binding factor 2-1 vs. UniProt/SwissProt
Match: sp|Q92146|TBP_TRIGA (TATA-box-binding protein OS=Trimeresurus gramineus OX=8767 GN=TBP PE=3 SV=1)

HSP 1 Score: 329.717 bits (844), Expect = 6.888e-109
Identity = 155/198 (78.28%), Postives = 178/198 (89.90%), Query Frame = -3
Query:  748 TPVTPHTPSTPMIDKEIVMPTPQLQNIVCTVNLGCKLDLKSIALHARNAEYNPKRFAAVIMRIRTPRTTALIFSSGKMVCTGAKSEDEAKLAARKFARIIQKLDFDAKFMNFKIQNMVGSCDVKFPIRLEGICLSHTQFATYEPELFPGLIYRMGKPKIVLLIFVSGKIVLTGAKVREEIYEAFKNIYPILKTFMNTS 1341
            TP+TP TP+TP  +   ++P  QLQNIV TVNLGCKLDLK+IAL ARNAEYNPKRFAAVIMRIR PRTTALIFSSGKMVCTGAKSE++++LAARK+AR++QKL F AKF++FKIQNMVGSCDVKFPIRLEG+ L+H QF++YEPELFPGLIYRM KP+IVLLIFVSGK+VLTGAKVR EIYEAF+NIYPILK F  T+
Sbjct:  107 TPMTPITPATPASESSGIVP--QLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVRGEIYEAFENIYPILKGFRKTT 302          
BLAST of Telomere repeat binding factor 2-1 vs. UniProt/SwissProt
Match: sp|P53360|TBP_MESAU (TATA-box-binding protein OS=Mesocricetus auratus OX=10036 GN=TBP PE=2 SV=1)

HSP 1 Score: 330.102 bits (845), Expect = 1.015e-108
Identity = 155/198 (78.28%), Postives = 178/198 (89.90%), Query Frame = -3
Query:  748 TPVTPHTPSTPMIDKEIVMPTPQLQNIVCTVNLGCKLDLKSIALHARNAEYNPKRFAAVIMRIRTPRTTALIFSSGKMVCTGAKSEDEAKLAARKFARIIQKLDFDAKFMNFKIQNMVGSCDVKFPIRLEGICLSHTQFATYEPELFPGLIYRMGKPKIVLLIFVSGKIVLTGAKVREEIYEAFKNIYPILKTFMNTS 1341
            TP+TP TP+TP  +   ++P  QLQNIV TVNLGCKLDLK+IAL ARNAEYNPKRFAAVIMRIR PRTTALIFSSGKMVCTGAKSE++++LAARK+AR++QKL F AKF++FKIQNMVGSCDVKFPIRLEG+ L+H QF++YEPELFPGLIYRM KP+IVLLIFVSGK+VLTGAKVR EIYEAF+NIYPILK F  T+
Sbjct:  123 TPMTPITPATPASESSGIVP--QLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVRAEIYEAFENIYPILKGFRKTT 318          
BLAST of Telomere repeat binding factor 2-1 vs. UniProt/SwissProt
Match: sp|O13270|TBP_CHICK (TATA-box-binding protein OS=Gallus gallus OX=9031 GN=TBP PE=2 SV=1)

HSP 1 Score: 329.331 bits (843), Expect = 1.028e-108
Identity = 155/198 (78.28%), Postives = 178/198 (89.90%), Query Frame = -3
Query:  748 TPVTPHTPSTPMIDKEIVMPTPQLQNIVCTVNLGCKLDLKSIALHARNAEYNPKRFAAVIMRIRTPRTTALIFSSGKMVCTGAKSEDEAKLAARKFARIIQKLDFDAKFMNFKIQNMVGSCDVKFPIRLEGICLSHTQFATYEPELFPGLIYRMGKPKIVLLIFVSGKIVLTGAKVREEIYEAFKNIYPILKTFMNTS 1341
            TP+TP TP+TP  +   ++P  QLQNIV TVNLGCKLDLK+IAL ARNAEYNPKRFAAVIMRIR PRTTALIFSSGKMVCTGAKSE++++LAARK+AR++QKL F AKF++FKIQNMVGSCDVKFPIRLEG+ L+H QF++YEPELFPGLIYRM KP+IVLLIFVSGK+VLTGAKVR EIYEAF+NIYPILK F  T+
Sbjct:  107 TPMTPITPATPASESSGIVP--QLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVRAEIYEAFENIYPILKGFRKTT 302          
BLAST of Telomere repeat binding factor 2-1 vs. TrEMBL
Match: A0A172RW06 (Telomere repeat binding factor 2-2 (Fragment) OS=Schmidtea mediterranea OX=79327 GN=TRF2-2 PE=2 SV=1)

HSP 1 Score: 397.512 bits (1020), Expect = 1.032e-134
Identity = 191/191 (100.00%), Postives = 191/191 (100.00%), Query Frame = -3
Query:  736 MIDKEIVMPTPQLQNIVCTVNLGCKLDLKSIALHARNAEYNPKRFAAVIMRIRTPRTTALIFSSGKMVCTGAKSEDEAKLAARKFARIIQKLDFDAKFMNFKIQNMVGSCDVKFPIRLEGICLSHTQFATYEPELFPGLIYRMGKPKIVLLIFVSGKIVLTGAKVREEIYEAFKNIYPILKTFMNTSQTPK 1308
            MIDKEIVMPTPQLQNIVCTVNLGCKLDLKSIALHARNAEYNPKRFAAVIMRIRTPRTTALIFSSGKMVCTGAKSEDEAKLAARKFARIIQKLDFDAKFMNFKIQNMVGSCDVKFPIRLEGICLSHTQFATYEPELFPGLIYRMGKPKIVLLIFVSGKIVLTGAKVREEIYEAFKNIYPILKTFMNTSQTPK
Sbjct:    1 MIDKEIVMPTPQLQNIVCTVNLGCKLDLKSIALHARNAEYNPKRFAAVIMRIRTPRTTALIFSSGKMVCTGAKSEDEAKLAARKFARIIQKLDFDAKFMNFKIQNMVGSCDVKFPIRLEGICLSHTQFATYEPELFPGLIYRMGKPKIVLLIFVSGKIVLTGAKVREEIYEAFKNIYPILKTFMNTSQTPK 191          
BLAST of Telomere repeat binding factor 2-1 vs. TrEMBL
Match: A0A172RVR7 (Telomere repeat binding factor 2-1 (Fragment) OS=Schmidtea mediterranea OX=79327 GN=TRF2-1 PE=2 SV=1)

HSP 1 Score: 348.591 bits (893), Expect = 6.577e-115
Identity = 169/170 (99.41%), Postives = 169/170 (99.41%), Query Frame = 1
Query:   61 QLMKIIENYFIPVIVSIQGTAAAAGCQLVASCDIAICGQSSLFSTPGILAGLFCSTPGVAVGRVLPRKIALEMLYTGEPISAETALKYGLVNHVVEDSKIDETSEKIANKIASLSSSTMKLGKKCFIEQMKLEKEKAYELASNVMVENLQFTDCKEGIKAFLEKRKPRWN 570
             LMKIIENYFIPVIVSIQGTAAAAGCQLVASCDIAICGQSSLFSTPGILAGLFCSTPGVAVGRVLPRKIALEMLYTGEPISAETALKYGLVNHVVEDSKIDETSEKIANKIASLSSSTMKLGKKCFIEQMKLEKEKAYELASNVMVENLQFTDCKEGIKAFLEKRKPRWN
Sbjct:   55 NLMKIIENYFIPVIVSIQGTAAAAGCQLVASCDIAICGQSSLFSTPGILAGLFCSTPGVAVGRVLPRKIALEMLYTGEPISAETALKYGLVNHVVEDSKIDETSEKIANKIASLSSSTMKLGKKCFIEQMKLEKEKAYELASNVMVENLQFTDCKEGIKAFLEKRKPRWN 224          
BLAST of Telomere repeat binding factor 2-1 vs. TrEMBL
Match: A0A183QED6 (Uncharacterized protein OS=Schistosoma rodhaini OX=6188 PE=3 SV=1)

HSP 1 Score: 345.51 bits (885), Expect = 4.401e-113
Identity = 174/266 (65.41%), Postives = 205/266 (77.07%), Query Frame = -3
Query:  736 NSLYHQNSIGSLASVFNAIQTPNSHSIKKDNNEAP---LNLISHSNNLCNETAGQISIGSIVGRTPVTPHTPSTPMIDKEIVMPTPQLQNIVCTVNLGCKLDLKSIALHARNAEYNPKRFAAVIMRIRTPRTTALIFSSGKMVCTGAKSEDEAKLAARKFARIIQKLDFDAKFMNFKIQNMVGSCDVKFPIRLEGICLSHTQFATYEPELFPGLIYRMGKPKIVLLIFVSGKIVLTGAKVREEIYEAFKNIYPILKTFMNTSQTPK 1524
            N L  Q+S+ S+ S+   +      S+++     P   +NL  H+++         +  SI GRTP TP T STP+ D++  +P PQLQNIVCTV LGCKL+LK+IAL ARNAEYNPKRFAAVIMRIR PRTTALIFSSGKMVCTGAKSE++A+LAARK+ARIIQ+L F+A F  FKIQNMVGSCDV+F IRLEG+ LS  QFATYEPELFPGLIYRM KPKIVLL+FVSGKIVLTGAKVREEIYEAF NIYPILK F  + + P+
Sbjct:    2 NPLSQQHSVASIGSLLGNLPLQGDSSLQQKTPLIPGGSVNLNLHASD---------NAASIPGRTPCTPLTLSTPLQDRDGAIPVPQLQNIVCTVYLGCKLNLKNIALSARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQARLAARKYARIIQRLGFEAHFKEFKIQNMVGSCDVRFHIRLEGLVLSQGQFATYEPELFPGLIYRMTKPKIVLLVFVSGKIVLTGAKVREEIYEAFNNIYPILKNFKKSDKDPR 258          
BLAST of Telomere repeat binding factor 2-1 vs. TrEMBL
Match: A0A095BZ37 (TATA-box-binding protein OS=Schistosoma haematobium OX=6185 GN=MS3_02661 PE=3 SV=1)

HSP 1 Score: 345.125 bits (884), Expect = 6.228e-113
Identity = 173/266 (65.04%), Postives = 205/266 (77.07%), Query Frame = -3
Query:  736 NSLYHQNSIGSLASVFNAIQTPNSHSIKKDN---NEAPLNLISHSNNLCNETAGQISIGSIVGRTPVTPHTPSTPMIDKEIVMPTPQLQNIVCTVNLGCKLDLKSIALHARNAEYNPKRFAAVIMRIRTPRTTALIFSSGKMVCTGAKSEDEAKLAARKFARIIQKLDFDAKFMNFKIQNMVGSCDVKFPIRLEGICLSHTQFATYEPELFPGLIYRMGKPKIVLLIFVSGKIVLTGAKVREEIYEAFKNIYPILKTFMNTSQTPK 1524
            N L  Q+S+ S+ S+   +      S+++     +   +NL  H+++         +  SI GRTP TP T STP+ D++  +P PQLQNIVCTV LGCKL+LK+IAL ARNAEYNPKRFAAVIMRIR PRTTALIFSSGKMVCTGAKSE++A+LAARK+ARIIQ+L F+A F  FKIQNMVGSCDV+F IRLEG+ LS  QFATYEPELFPGLIYRM KPKIVLL+FVSGKIVLTGAKVREEIYEAF NIYPILK F  + + P+
Sbjct:    2 NPLSQQHSVASIGSLLGNLPLQGDSSLQQKTPLISGGSVNLNLHASD---------NAASIPGRTPCTPLTLSTPLQDRDGAIPVPQLQNIVCTVYLGCKLNLKNIALSARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQARLAARKYARIIQRLGFEAHFKEFKIQNMVGSCDVRFHIRLEGLVLSQGQFATYEPELFPGLIYRMTKPKIVLLVFVSGKIVLTGAKVREEIYEAFNNIYPILKNFKKSDKDPR 258          
BLAST of Telomere repeat binding factor 2-1 vs. TrEMBL
Match: A0A183K0M5 (Uncharacterized protein OS=Schistosoma curassoni OX=6186 GN=SCUD_LOCUS8536 PE=3 SV=1)

HSP 1 Score: 345.125 bits (884), Expect = 6.228e-113
Identity = 173/266 (65.04%), Postives = 205/266 (77.07%), Query Frame = -3
Query:  736 NSLYHQNSIGSLASVFNAIQTPNSHSIKKDN---NEAPLNLISHSNNLCNETAGQISIGSIVGRTPVTPHTPSTPMIDKEIVMPTPQLQNIVCTVNLGCKLDLKSIALHARNAEYNPKRFAAVIMRIRTPRTTALIFSSGKMVCTGAKSEDEAKLAARKFARIIQKLDFDAKFMNFKIQNMVGSCDVKFPIRLEGICLSHTQFATYEPELFPGLIYRMGKPKIVLLIFVSGKIVLTGAKVREEIYEAFKNIYPILKTFMNTSQTPK 1524
            N L  Q+S+ S+ S+   +      S+++     +   +NL  H+++         +  SI GRTP TP T STP+ D++  +P PQLQNIVCTV LGCKL+LK+IAL ARNAEYNPKRFAAVIMRIR PRTTALIFSSGKMVCTGAKSE++A+LAARK+ARIIQ+L F+A F  FKIQNMVGSCDV+F IRLEG+ LS  QFATYEPELFPGLIYRM KPKIVLL+FVSGKIVLTGAKVREEIYEAF NIYPILK F  + + P+
Sbjct:    2 NPLSQQHSVASIGSLLGNLPLQGDSSLQQKTPLISGGSVNLNLHASD---------NAASIPGRTPCTPLTLSTPLQDRDGAIPVPQLQNIVCTVYLGCKLNLKNIALSARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQARLAARKYARIIQRLGFEAHFKEFKIQNMVGSCDVRFHIRLEGLVLSQGQFATYEPELFPGLIYRMTKPKIVLLVFVSGKIVLTGAKVREEIYEAFNNIYPILKNFKKSDKDPR 258          
BLAST of Telomere repeat binding factor 2-1 vs. Ensembl Cavefish
Match: tbpl2 (TATA box binding protein like 2 [Source:NCBI gene;Acc:407713])

HSP 1 Score: 306.22 bits (783), Expect = 1.594e-100
Identity = 143/173 (82.66%), Postives = 159/173 (91.91%), Query Frame = -3
Query:  760 PQLQNIVCTVNLGCKLDLKSIALHARNAEYNPKRFAAVIMRIRTPRTTALIFSSGKMVCTGAKSEDEAKLAARKFARIIQKLDFDAKFMNFKIQNMVGSCDVKFPIRLEGICLSHTQFATYEPELFPGLIYRMGKPKIVLLIFVSGKIVLTGAKVREEIYEAFKNIYPILKTF 1278
            PQLQNIV TVNL C LDLKSIAL ARNAEYNPKRFAAVIMRIR PRTTALIFSSGKMVCTGAKSE++++LAARK+AR++QKL F AKF++FKIQNMVGSCDV FPIRLEG+ L+H QF++YEPELFPGLIYRM KP+IVLLIFVSGK+VLTGAK R EIYEAF+NIYPILK F
Sbjct:  138 PQLQNIVSTVNLACPLDLKSIALQARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVCFPIRLEGLVLTHQQFSSYEPELFPGLIYRMVKPRIVLLIFVSGKVVLTGAKDRSEIYEAFENIYPILKGF 310          
BLAST of Telomere repeat binding factor 2-1 vs. Ensembl Cavefish
Match: tbp (TATA box binding protein [Source:NCBI gene;Acc:368882])

HSP 1 Score: 160.229 bits (404), Expect = 2.491e-45
Identity = 105/221 (47.51%), Postives = 121/221 (54.75%), Query Frame = -3
Query:  748 HSNNLCNETA--GQISIGSIVGRTPVTPHTPSTPMIDKEIVMPTPQLQNIVCTVNLGCKLDLKSIALHARNAEYNPKRFAAVIMRIRTPRTTALIFSSGKMVCTGAKSEDEAKLAARKFARIIQKLDFDAKFMNFKIQNMVGSCDVKFPIRLEGICLSHTQFATYEPELFPGLIYRMGKPKIVLLIFVSGKIVLTGAKVREEIYEAFKNIYPILKTFMNTS 1404
            HS  +   T   G   + +    TP+TP TP+TP  +   ++P  QLQNIV TVNLGCKLDLK+IAL ARNAEYNPKRFAAVIMRIR PRTTALIFSSGKMVCTGAKS  E +L      R+I+                              I L               LI+  GK            +VLTGAKVR EIYEAF+NIYPILK F  T+
Sbjct:   86 HSQAVSTTTVLPGNTPLYTTAPLTPMTPITPATPASESSGIVP--QLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSY-EPELFPGLIYRMIKPR----------------------------IVL---------------LIFVSGK------------VVLTGAKVRGEIYEAFENIYPILKGFRKTT 248          
BLAST of Telomere repeat binding factor 2-1 vs. Ensembl Cavefish
Match: echs1 (enoyl-CoA hydratase, short chain 1 [Source:NCBI gene;Acc:103039905])

HSP 1 Score: 78.1814 bits (191), Expect = 9.071e-16
Identity = 51/156 (32.69%), Postives = 76/156 (48.72%), Query Frame = 1
Query:   94 PVIVSIQGTAAAAGCQLVASCDIAICGQSSLFSTPGILAGLFCSTPGVA-VGRVLPRKIALEMLYTGEPISAETALKYGLVNHVVEDSKIDETSEKIANKIASLSSSTMKLGKKCFIEQMKLEKEKAYELASNVMVENLQFTDCKEGIKAFLEKRK 558
            PVI ++ G A   GC+L   CDI   G+ + F  P IL G      G   + R + + +A+EM+ TG+ ISA+ A + GLV+ V    ++   + K   KIAS S     + K+      +L   +   L   +        D KEG+ AF+EKRK
Sbjct:  109 PVIAAVNGFALGGGCELAMMCDIIYAGEKAQFGQPEILLGTIPGAGGTQRLTRAVGKSLAMEMVLTGDRISAQEAKQSGLVSKVFPVDQLVSEAIKCGEKIASNSKLVAAMAKEAVNAAFELTLAEGNRLEKRLFHSTFATEDRKEGMTAFVEKRK 264          
BLAST of Telomere repeat binding factor 2-1 vs. Ensembl Cavefish
Match: echs1 (enoyl-CoA hydratase, short chain 1 [Source:NCBI gene;Acc:103039905])

HSP 1 Score: 78.1814 bits (191), Expect = 1.323e-15
Identity = 51/156 (32.69%), Postives = 76/156 (48.72%), Query Frame = 1
Query:   94 PVIVSIQGTAAAAGCQLVASCDIAICGQSSLFSTPGILAGLFCSTPGVA-VGRVLPRKIALEMLYTGEPISAETALKYGLVNHVVEDSKIDETSEKIANKIASLSSSTMKLGKKCFIEQMKLEKEKAYELASNVMVENLQFTDCKEGIKAFLEKRK 558
            PVI ++ G A   GC+L   CDI   G+ + F  P IL G      G   + R + + +A+EM+ TG+ ISA+ A + GLV+ V    ++   + K   KIAS S     + K+      +L   +   L   +        D KEG+ AF+EKRK
Sbjct:  130 PVIAAVNGFALGGGCELAMMCDIIYAGEKAQFGQPEILLGTIPGAGGTQRLTRAVGKSLAMEMVLTGDRISAQEAKQSGLVSKVFPVDQLVSEAIKCGEKIASNSKLVAAMAKEAVNAAFELTLAEGNRLEKRLFHSTFATEDRKEGMTAFVEKRK 285          
BLAST of Telomere repeat binding factor 2-1 vs. Ensembl Cavefish
Match: echdc2 (enoyl-CoA hydratase domain containing 2 [Source:NCBI gene;Acc:103031035])

HSP 1 Score: 65.4698 bits (158), Expect = 2.756e-11
Identity = 49/187 (26.20%), Postives = 88/187 (47.06%), Query Frame = 1
Query:   64 LMKIIENYFIPVIVSIQGTAAAAGCQLVASCDI---AICGQSSLF-STPGILAGLFCSTPGVAVGRVLPRKIAL----EMLYTGEPISAETALKYGLVNHVVEDSKIDETSEK----IANKIASLSSSTMKLGKKCFIEQMKLEKEKAYELASNVMVENLQFT------DCKEGIKAFLEKRKPRWN 570
            LM  I    +P I ++ G A   G +L  +CD+   A   Q  L  +T G+L       PG    + LPR +      E+++TG  +  + AL+ GLVN  V  ++  + + K    +A +I       +++ K+     +++      ++AS + +E + +       D +EG+ AF+EKR PR+ 
Sbjct:  143 LMNEIAALPMPTIAAVDGFALGGGLELALACDLRTAAFSAQMGLIETTRGLL-------PGAGGSQRLPRAVGFAVAKELIFTGRRVGGQQALELGLVNRAVPQNESGDAAHKEALNLAREIIPQGPIAVRMAKEAMNRGIEV------DIASGMAIEGMCYARVIPTRDRQEGMAAFIEKRTPRYT 316          
BLAST of Telomere repeat binding factor 2-1 vs. Ensembl Sea Lamprey
Match: tbp (TATA box binding protein [Source:NCBI gene;Acc:368882])

HSP 1 Score: 318.931 bits (816), Expect = 2.315e-106
Identity = 148/177 (83.62%), Postives = 164/177 (92.66%), Query Frame = -3
Query:  748 PQLQNIVCTVNLGCKLDLKSIALHARNAEYNPKRFAAVIMRIRTPRTTALIFSSGKMVCTGAKSEDEAKLAARKFARIIQKLDFDAKFMNFKIQNMVGSCDVKFPIRLEGICLSHTQFATYEPELFPGLIYRMGKPKIVLLIFVSGKIVLTGAKVREEIYEAFKNIYPILKTFMNTS 1278
            PQLQNIV TVNL CKLDLK IALHARNAEYNPKRFAAVIMRIR PRTTALIFSSGKMVCTGAKSED+++LAARK+AR++QKL F AKF++FKIQNMVGSCDVKFPIRLEG+ L+H QF++YEPELFPGLIYRM KP+IVLLIFVSGK+VLTGAKVR EIYEAF+NIYPILK F  T+
Sbjct:  116 PQLQNIVSTVNLCCKLDLKKIALHARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEDQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMVKPRIVLLIFVSGKVVLTGAKVRGEIYEAFENIYPILKGFRKTT 292          
BLAST of Telomere repeat binding factor 2-1 vs. Ensembl Sea Lamprey
Match: ECHDC3 (enoyl-CoA hydratase domain containing 3 [Source:HGNC Symbol;Acc:HGNC:23489])

HSP 1 Score: 183.341 bits (464), Expect = 1.207e-54
Identity = 86/174 (49.43%), Postives = 123/174 (70.69%), Query Frame = 1
Query:   46 FKY*FQLMKIIENYFIPVIVSIQGTAAAAGCQLVASCDIAICGQSSLFSTPGILAGLFCSTPGVAVGRVLPRKIALEMLYTGEPISAETALKYGLVNHVVEDSKIDETSEKIANKIASLSSSTMKLGKKCFIEQMKLEKEKAYELASNVMVENLQFTDCKEGIKAFLEKRKPRW 567
            F+   ++M+ I+   +PV+  + G A AAGCQLVASCD+A+  + S F+TPG+  GLFCSTPGVA+GR +P+K+A+EML TGEPISA  AL +GL++ VV   ++D   E++A  +  LS S + LGK+ F+ QM  + + AY LA   M++NLQ  D +EGI+AF+EKR P+W
Sbjct:   69 FETCTEVMRTIQRLPVPVMAKVDGLATAAGCQLVASCDLALASERSRFATPGVHVGLFCSTPGVALGRSVPKKVAMEMLLTGEPISASEALAHGLLSRVVPVERLDGEVERVARSVCRLSRSVLALGKRAFLGQMSRDWDAAYALAQAAMLDNLQLPDGQEGIRAFVEKRTPQW 242          
BLAST of Telomere repeat binding factor 2-1 vs. Ensembl Sea Lamprey
Match: tbpl1 (TBP-like 1 [Source:NCBI gene;Acc:403035])

HSP 1 Score: 132.109 bits (331), Expect = 2.935e-36
Identity = 70/170 (41.18%), Postives = 100/170 (58.82%), Query Frame = -3
Query:  769 LQNIVCTVNLGCKLDLKSIALHARNAEYNPKRFAAVIMRIRTPRTTALIFSSGKMVCTGAKSEDEAKLAARKFARIIQKLDFDA--KFMNFKIQNMVGSCDVKFPIRLEGICLSHTQFATYEPELFPGLIYRMGKPKIVLLIFVSGKIVLTGAKVREEIYEAFKNIYPIL 1272
            + N+VC     C LDL+ IAL   N  Y  +    V+M++R PR T+ I+SSGK++CTGA SE++AK+ AR+ AR +QKL F    +F  FK+ N++  C + F IRL     +H   A+YEPEL P   Y++      L IF +G I LT   V   I +A + IYP++
Sbjct:   15 ITNVVCVFRTRCHLDLRHIALEGANVMYK-RDEGKVLMKLRRPRITSTIWSSGKVICTGATSEEDAKIGARRCARCLQKLGFKTQIRFCAFKVVNVLAVCSMPFEIRLVDFTKTHRPIASYEPELHPAATYKIKSLSATLQIFSTGSITLTAPNV-SLIAQAIEQIYPLV 182          
BLAST of Telomere repeat binding factor 2-1 vs. Ensembl Sea Lamprey
Match: echs1 (enoyl CoA hydratase, short chain, 1, mitochondrial [Source:ZFIN;Acc:ZDB-GENE-030616-617])

HSP 1 Score: 75.485 bits (184), Expect = 2.487e-15
Identity = 48/159 (30.19%), Postives = 76/159 (47.80%), Query Frame = 1
Query:   94 PVIVSIQGTAAAAGCQLVASCDIAICGQSSLFSTPGILAGLFCSTPGVA-VGRVLPRKIALEMLYTGEPISAETALKYGLVNHVVEDSKIDETSEKIANKIASLSSSTMKLGKKCFIEQMKLEKEKAYELASNVMVENLQFTDCKEGIKAFLEKRKPRW 567
            PVI ++ G A   GC+L   CDI   G+ + F  P I  G      G   + R + + +A+EM+ TG+ ISA+ A + GLV+ V    ++   + K+  KI+  S   + + K+      +L   +   L            D KEG+ AF+EKRK  +
Sbjct:  131 PVIAAVNGFALGGGCELAMMCDIIYAGEKAQFGQPEIALGTIPGAGGTQRLTRAVGKSLAMEMVLTGDRISAQQAKEAGLVSKVCPPDQLLGEAVKLGEKISRHSKLVISMAKEAVNAAFELSLAEGNRLEKRFFHATFATDDRKEGMSAFVEKRKATF 289          
BLAST of Telomere repeat binding factor 2-1 vs. Ensembl Sea Lamprey
Match: ech1 (enoyl CoA hydratase 1, peroxisomal [Source:ZFIN;Acc:ZDB-GENE-041010-170])

HSP 1 Score: 61.2326 bits (147), Expect = 1.022e-10
Identity = 46/170 (27.06%), Postives = 77/170 (45.29%), Query Frame = 1
Query:   73 IIENYFIPVIVSIQGTAAAAGCQLVASCDIAICGQSSLFSTPGILAGLFCSTPGVAVGRVLP-----RKIALEMLYTGEPISAETALKYGLVNHVVED-SKIDETSEKIANKIASLSSSTMKLGKKCFIEQMKLEKEKAYELASNVMVENLQFTDCKEGIKAFLEKRKPR 564
            +IE    PVI +IQG     G  +V +CDI  C Q + F    +  GL      V   + LP     R +  +++YTG  + ++ A   GLV+ V  D + + E + +IA  IA+ S   ++  K   +        ++ E  +   +  LQ  D  +   A L+K+ P+
Sbjct:  112 VIEKCTKPVIAAIQGACVGGGVDMVTACDIRFCTQDAWFQVKEVDIGL---AADVGTLQRLPKVIGSRSLVCDLVYTGRKMMSDEAKSSGLVSRVFPDKASLMEAALQIAEDIANKSPVAVQGSKVNLVYSRDHSVRESLEYMATWNMAMLQTDDIMKSATAVLQKKNPK 278          
BLAST of Telomere repeat binding factor 2-1 vs. Ensembl Yeast
Match: SPT15 (TATA-binding protein (TBP); general transcription factor that interacts with other factors to form the preinitiation complex at promoters; essential for viability, highly conserved; yeast gene can complement mutations in human homolog TBP [Source:SGD;Acc:S000000950])

HSP 1 Score: 297.36 bits (760), Expect = 5.578e-99
Identity = 138/173 (79.77%), Postives = 156/173 (90.17%), Query Frame = -3
Query:  760 PQLQNIVCTVNLGCKLDLKSIALHARNAEYNPKRFAAVIMRIRTPRTTALIFSSGKMVCTGAKSEDEAKLAARKFARIIQKLDFDAKFMNFKIQNMVGSCDVKFPIRLEGICLSHTQFATYEPELFPGLIYRMGKPKIVLLIFVSGKIVLTGAKVREEIYEAFKNIYPILKTF 1278
            P LQNIV TV LGC+LDLK++ALHARNAEYNPKRFAAVIMRIR P+TTALIF+SGKMV TGAKSED++KLA+RK+ARIIQK+ F AKF +FKIQN+VGSCDVKFPIRLEG+  SH  F++YEPELFPGLIYRM KPKIVLLIFVSGKIVLTGAK REEIY+AF+ IYP+L  F
Sbjct:   65 PTLQNIVATVTLGCRLDLKTVALHARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVVTGAKSEDDSKLASRKYARIIQKIGFAAKFTDFKIQNIVGSCDVKFPIRLEGLAFSHGTFSSYEPELFPGLIYRMVKPKIVLLIFVSGKIVLTGAKQREEIYQAFEAIYPVLSEF 237          
BLAST of Telomere repeat binding factor 2-1 vs. Ensembl Yeast
Match: YER147C-A_mRNA (Dubious open reading frame; unlikely to encode a functional protein, based on available experimental and comparative sequence data; overlaps ORF SPT15/YER148W [Source:SGD;Acc:S000028759])

HSP 1 Score: 52.373 bits (124), Expect = 8.329e-9
Identity = 25/40 (62.50%), Postives = 30/40 (75.00%), Query Frame = 2
Query: 1160 IITAAKRFGLYSAFLA*RAIDFKSNLHPKFTVQTIFCN*G 1279
            ++TAAKR GLYSA  A  A  F+SNLHPK TV T+FC+ G
Sbjct:    1 MMTAAKRLGLYSALRACSATVFRSNLHPKVTVATMFCSVG 40          
BLAST of Telomere repeat binding factor 2-1 vs. Ensembl Nematostella
Match: EDO44103 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RWY1])

HSP 1 Score: 320.857 bits (821), Expect = 2.547e-108
Identity = 155/193 (80.31%), Postives = 170/193 (88.08%), Query Frame = -3
Query:  751 PHTPSTPMIDKEIVMPTPQLQNIVCTVNLGCKLDLKSIALHARNAEYNPKRFAAVIMRIRTPRTTALIFSSGKMVCTGAKSEDEAKLAARKFARIIQKLDFDAKFMNFKIQNMVGSCDVKFPIRLEGICLSHTQFATYEPELFPGLIYRMGKPKIVLLIFVSGKIVLTGAKVREEIYEAFKNIYPILKTFMNT 1329
            P TP TPM  +   +  PQLQNIV TVNLGCKLDLK IAL ARNAEYNPKRFAAVIMRIR PRTTALIFSSGKMVCTGAKSE+++KLAARK+AR++QKL F AKF  FKIQNMVGSCDVKFPIRLEG+ L+H QF++YEPELFPGLIYRM KP+IVLLIFVSGK+VLTGAKVR+EIYEAF NIYPILKTF  T
Sbjct:    3 PLTPMTPMTGEPSGI-LPQLQNIVSTVNLGCKLDLKKIALQARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSKLAARKYARVVQKLGFPAKFTEFKIQNMVGSCDVKFPIRLEGLVLAHGQFSSYEPELFPGLIYRMVKPRIVLLIFVSGKVVLTGAKVRQEIYEAFDNIYPILKTFRKT 194          
BLAST of Telomere repeat binding factor 2-1 vs. Ensembl Nematostella
Match: EDO32277 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SVJ4])

HSP 1 Score: 197.208 bits (500), Expect = 3.704e-59
Identity = 88/169 (52.07%), Postives = 124/169 (73.37%), Query Frame = 1
Query:   61 QLMKIIENYFIPVIVSIQGTAAAAGCQLVASCDIAICGQSSLFSTPGILAGLFCSTPGVAVGRVLPRKIALEMLYTGEPISAETALKYGLVNHVVEDSKIDETSEKIANKIASLSSSTMKLGKKCFIEQMKLEKEKAYELASNVMVENLQFTDCKEGIKAFLEKRKPRW 567
            Q+M +I++  IPV+  + G A AAGCQLVASCD+A+    S F+TPG+  GLFCSTPGVA+ R +PRK+A+EML TG PI+A  AL++GLV+ VV + +++    +I++KIA +S   + +GK CF  Q+   +++AY+ A NVM+ENL+  D KEGIKAF+EKRKP W
Sbjct:  118 QVMSLIQDLPIPVVAQVNGLATAAGCQLVASCDVAVASDKSQFATPGVNIGLFCSTPGVALARAVPRKVAMEMLLTGRPITAGEALRHGLVSRVVPEDQLENEVNRISSKIAEVSRPVVAMGKACFYSQVAQTRDQAYKYAENVMIENLKMEDGKEGIKAFVEKRKPVW 286          
BLAST of Telomere repeat binding factor 2-1 vs. Ensembl Nematostella
Match: EDO40020 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S886])

HSP 1 Score: 95.5153 bits (236), Expect = 3.073e-22
Identity = 54/159 (33.96%), Postives = 83/159 (52.20%), Query Frame = 1
Query:   94 PVIVSIQGTAAAAGCQLVASCDIAICGQSSLFSTPGILAGLFCSTPGVA-VGRVLPRKIALEMLYTGEPISAETALKYGLVNHVVEDSKIDETSEKIANKIASLSSSTMKLGKKCFIEQMKLEKEKAYELASNVMVENLQFTDCKEGIKAFLEKRKPRW 567
            PVI ++ G A   GC+L   CDI      + F  P IL G      G   + R + + +A+EM+ TG+PI+A+ ALK GLV+ V     +   + K A KIA LS  ++ + K+C     ++  E+  ++   +        D KEG+ AF+EKRKP +
Sbjct:   97 PVIAAVNGFALGGGCELAMMCDIIYASDKAKFGQPEILIGTIPGAGGTQRLTRAVGKSLAMEMVLTGDPINADHALKAGLVSKVFPADDLVPNAIKTAEKIAGLSKLSVGIAKECLNYAYEMTLEEGLKVEKRMFHTTFALDDRKEGMTAFIEKRKPEF 255          
BLAST of Telomere repeat binding factor 2-1 vs. Ensembl Nematostella
Match: EDO31779 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWZ6])

HSP 1 Score: 62.7734 bits (151), Expect = 6.714e-11
Identity = 44/121 (36.36%), Postives = 63/121 (52.07%), Query Frame = 1
Query:   94 PVIVSIQGTAAAAGCQLVASCDIAICGQSSLFSTPGILAGLFCSTPGVAV---GRV-LPRKI----ALEMLYTGEPISAETALKYGLVNHVVEDSKIDETSEKIANKIASLSSSTMKLGKK 432
            PVI +IQG A   G +L   CD+ +C + S+F       G F    GV +   G V LP  I    AL+++ TG  + A+ A++ GLVN VV   K  E + KIA KI+     ++K  +K
Sbjct:  126 PVIGAIQGYAVGGGLELALLCDLRVCEEDSVF-------GFFNRRFGVPLVDGGAVRLPYLIGLSRALDLIMTGRAVKAQEAIEIGLVNRVVPKGKAIEEAIKIAEKISRFPQESLKADRK 239          
BLAST of Telomere repeat binding factor 2-1 vs. Ensembl Nematostella
Match: EDO37709 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SF39])

HSP 1 Score: 53.9138 bits (128), Expect = 8.754e-8
Identity = 34/102 (33.33%), Postives = 56/102 (54.90%), Query Frame = 1
Query:   61 QLMKIIENYFIPVIVSIQGTAAAAGCQLVASCD--IAICGQSSLFSTPGILAGLFCSTPGVAVGRVLPRKI----ALEMLYTGEPISAETALKYGLVNHVVE 348
            Q+ + +E+   PV+ +I GT    G +L  SC   IA+    ++ S P ++ GL    PG    + LPR +    +L+M+ TG+ I A+ A K GLV+ +V+
Sbjct:  133 QVYQFLEDSPKPVVAAIMGTCMGGGLELALSCHYRIAVNDGKTVLSAPEVMLGLL---PGAGGTQRLPRLVGLPDSLDMMLTGKNIRAQKAKKMGLVDMLVQ 231          
BLAST of Telomere repeat binding factor 2-1 vs. Ensembl Medaka
Match: tbp (TATA-box binding protein [Source:NCBI gene;Acc:100049222])

HSP 1 Score: 325.865 bits (834), Expect = 8.882e-107
Identity = 154/198 (77.78%), Postives = 177/198 (89.39%), Query Frame = -3
Query:  748 TPVTPHTPSTPMIDKEIVMPTPQLQNIVCTVNLGCKLDLKSIALHARNAEYNPKRFAAVIMRIRTPRTTALIFSSGKMVCTGAKSEDEAKLAARKFARIIQKLDFDAKFMNFKIQNMVGSCDVKFPIRLEGICLSHTQFATYEPELFPGLIYRMGKPKIVLLIFVSGKIVLTGAKVREEIYEAFKNIYPILKTFMNTS 1341
            TP+TP  P+TP  +   ++P  QLQNIV TVNLGCKLDLK+IAL ARNAEYNPKRFAAVIMRIR PRTTALIFSSGKMVCTGAKSE++++LAARK+AR++QKL F AKF++FKIQNMVGSCDVKFPIRLEG+ L+H QF++YEPELFPGLIYRM KP+IVLLIFVSGK+VLTGAKVR EIYEAF+NIYPILK F  T+
Sbjct:  212 TPMTPIAPATPASESSGIVP--QLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVRAEIYEAFENIYPILKGFRKTT 407          
BLAST of Telomere repeat binding factor 2-1 vs. Ensembl Medaka
Match: tbpl2 (TATA-box binding protein like 2 [Source:NCBI gene;Acc:101165520])

HSP 1 Score: 299.286 bits (765), Expect = 5.162e-97
Identity = 140/173 (80.92%), Postives = 155/173 (89.60%), Query Frame = -3
Query:  760 PQLQNIVCTVNLGCKLDLKSIALHARNAEYNPKRFAAVIMRIRTPRTTALIFSSGKMVCTGAKSEDEAKLAARKFARIIQKLDFDAKFMNFKIQNMVGSCDVKFPIRLEGICLSHTQFATYEPELFPGLIYRMGKPKIVLLIFVSGKIVLTGAKVREEIYEAFKNIYPILKTF 1278
            PQLQNIV TV LGC LDLK IA  ARNAEYNPKRFAAVIMRIR PRTTALIFSSGKMVCTGAKSE+E++LAARK+AR++QKL F A+F+ FKIQNMV SCDV FPIRLEG+ L+H QF++YEPELFPGLIYRM KP+IVLLIFVSGK+VLTGAK R EIYEAF+NIYPILK F
Sbjct:  192 PQLQNIVSTVTLGCPLDLKFIARQARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEESRLAARKYARVVQKLGFSARFLEFKIQNMVASCDVCFPIRLEGLVLTHQQFSSYEPELFPGLIYRMVKPRIVLLIFVSGKVVLTGAKERAEIYEAFENIYPILKGF 364          
BLAST of Telomere repeat binding factor 2-1 vs. Ensembl Medaka
Match: tbpl2 (TATA-box binding protein like 2 [Source:NCBI gene;Acc:101165520])

HSP 1 Score: 298.516 bits (763), Expect = 2.925e-95
Identity = 140/173 (80.92%), Postives = 155/173 (89.60%), Query Frame = -3
Query:  760 PQLQNIVCTVNLGCKLDLKSIALHARNAEYNPKRFAAVIMRIRTPRTTALIFSSGKMVCTGAKSEDEAKLAARKFARIIQKLDFDAKFMNFKIQNMVGSCDVKFPIRLEGICLSHTQFATYEPELFPGLIYRMGKPKIVLLIFVSGKIVLTGAKVREEIYEAFKNIYPILKTF 1278
            PQLQNIV TV LGC LDLK IA  ARNAEYNPKRFAAVIMRIR PRTTALIFSSGKMVCTGAKSE+E++LAARK+AR++QKL F A+F+ FKIQNMV SCDV FPIRLEG+ L+H QF++YEPELFPGLIYRM KP+IVLLIFVSGK+VLTGAK R EIYEAF+NIYPILK F
Sbjct:  177 PQLQNIVSTVTLGCPLDLKFIARQARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEESRLAARKYARVVQKLGFSARFLEFKIQNMVASCDVCFPIRLEGLVLTHQQFSSYEPELFPGLIYRMVKPRIVLLIFVSGKVVLTGAKERAEIYEAFENIYPILKGF 349          
BLAST of Telomere repeat binding factor 2-1 vs. Ensembl Medaka
Match: ECHDC3 (enoyl-CoA hydratase domain containing 3 [Source:NCBI gene;Acc:101173425])

HSP 1 Score: 189.119 bits (479), Expect = 4.540e-56
Identity = 87/175 (49.71%), Postives = 121/175 (69.14%), Query Frame = 1
Query:   46 FKY*FQLMKIIENYFIPVIVSIQGTAAAAGCQLVASCDIAICGQSSLFSTPGILAGLFCSTPGVAVGRVLPRKIALEMLYTGEPISAETALKYGLVNHVVEDSKIDETSEKIANKIASLSSSTMKLGKKCFIEQMKLEKEKAYELASNVMVENLQFTDCKEGIKAFLEKRKPRWN 570
            F    ++M +I++  +PVI  + G A AAGCQLVASCDIA+    S F+TPG+  GLFCSTP VA+GR +PRK+A+EML+TG PISA+ AL +GL++ VV + +++E +  IA ++   S   + LGK  F  QM   ++ AY  AS VMV+NL   D +EGI+AFLEKR+P W+
Sbjct:   73 FHTCSEVMTLIQDVPVPVIAMVNGVATAAGCQLVASCDIAVATDKSSFATPGVNVGLFCSTPAVAIGRAVPRKVAMEMLFTGSPISAQEALLHGLISKVVPEERLEEETLAIAQRVCRASRPVVALGKATFQRQMAQGRDAAYATASKVMVDNLALRDGQEGIRAFLEKRQPVWS 247          
BLAST of Telomere repeat binding factor 2-1 vs. Ensembl Medaka
Match: ECHDC3 (enoyl-CoA hydratase domain containing 3 [Source:NCBI gene;Acc:101173425])

HSP 1 Score: 188.734 bits (478), Expect = 2.036e-55
Identity = 86/170 (50.59%), Postives = 120/170 (70.59%), Query Frame = 1
Query:   61 QLMKIIENYFIPVIVSIQGTAAAAGCQLVASCDIAICGQSSLFSTPGILAGLFCSTPGVAVGRVLPRKIALEMLYTGEPISAETALKYGLVNHVVEDSKIDETSEKIANKIASLSSSTMKLGKKCFIEQMKLEKEKAYELASNVMVENLQFTDCKEGIKAFLEKRKPRWN 570
            ++M +I++  +PVI  + G A AAGCQLVASCDIA+    S F+TPG+  GLFCSTP VA+GR +PRK+A+EML+TG PISA+ AL +GL++ VV + +++E +  IA ++   S   + LGK  F  QM   ++ AY  AS VMV+NL   D +EGI+AFLEKR+P W+
Sbjct:  115 EVMTLIQDVPVPVIAMVNGVATAAGCQLVASCDIAVATDKSSFATPGVNVGLFCSTPAVAIGRAVPRKVAMEMLFTGSPISAQEALLHGLISKVVPEERLEEETLAIAQRVCRASRPVVALGKATFQRQMAQGRDAAYATASKVMVDNLALRDGQEGIRAFLEKRQPVWS 284          
BLAST of Telomere repeat binding factor 2-1 vs. Planmine SMEST
Match: SMESG000064519.1 (SMESG000064519.1)

HSP 1 Score: 564.688 bits (1454), Expect = 0.000e+0
Identity = 273/273 (100.00%), Postives = 273/273 (100.00%), Query Frame = -3
Query:  736 MQNNISSVATNSLYHQNSIGSLASVFNAIQTPNSHSIKKDNNEAPLNLISHSNNLCNETAGQISIGSIVGRTPVTPHTPSTPMIDKEIVMPTPQLQNIVCTVNLGCKLDLKSIALHARNAEYNPKRFAAVIMRIRTPRTTALIFSSGKMVCTGAKSEDEAKLAARKFARIIQKLDFDAKFMNFKIQNMVGSCDVKFPIRLEGICLSHTQFATYEPELFPGLIYRMGKPKIVLLIFVSGKIVLTGAKVREEIYEAFKNIYPILKTFMNTSQTPK 1554
            MQNNISSVATNSLYHQNSIGSLASVFNAIQTPNSHSIKKDNNEAPLNLISHSNNLCNETAGQISIGSIVGRTPVTPHTPSTPMIDKEIVMPTPQLQNIVCTVNLGCKLDLKSIALHARNAEYNPKRFAAVIMRIRTPRTTALIFSSGKMVCTGAKSEDEAKLAARKFARIIQKLDFDAKFMNFKIQNMVGSCDVKFPIRLEGICLSHTQFATYEPELFPGLIYRMGKPKIVLLIFVSGKIVLTGAKVREEIYEAFKNIYPILKTFMNTSQTPK
Sbjct:    1 MQNNISSVATNSLYHQNSIGSLASVFNAIQTPNSHSIKKDNNEAPLNLISHSNNLCNETAGQISIGSIVGRTPVTPHTPSTPMIDKEIVMPTPQLQNIVCTVNLGCKLDLKSIALHARNAEYNPKRFAAVIMRIRTPRTTALIFSSGKMVCTGAKSEDEAKLAARKFARIIQKLDFDAKFMNFKIQNMVGSCDVKFPIRLEGICLSHTQFATYEPELFPGLIYRMGKPKIVLLIFVSGKIVLTGAKVREEIYEAFKNIYPILKTFMNTSQTPK 273          
BLAST of Telomere repeat binding factor 2-1 vs. Planmine SMEST
Match: SMESG000064518.1 (SMESG000064518.1)

HSP 1 Score: 349.747 bits (896), Expect = 3.540e-118
Identity = 169/170 (99.41%), Postives = 169/170 (99.41%), Query Frame = 1
Query:   61 QLMKIIENYFIPVIVSIQGTAAAAGCQLVASCDIAICGQSSLFSTPGILAGLFCSTPGVAVGRVLPRKIALEMLYTGEPISAETALKYGLVNHVVEDSKIDETSEKIANKIASLSSSTMKLGKKCFIEQMKLEKEKAYELASNVMVENLQFTDCKEGIKAFLEKRKPRWN 570
             LMKIIENYFIPVIVSIQGTAAAAGCQLVASCDIAICGQSSLFSTPGILAGLFCSTPGVAVGRVLPRKIALEMLYTGEPISAETALKYGLVNHVVEDSKIDETSEKIANKIASLSSSTMKLGKKCFIEQMKLEKEKAYELASNVMVENLQFTDCKEGIKAFLEKRKPRWN
Sbjct:  110 NLMKIIENYFIPVIVSIQGTAAAAGCQLVASCDIAICGQSSLFSTPGILAGLFCSTPGVAVGRVLPRKIALEMLYTGEPISAETALKYGLVNHVVEDSKIDETSEKIANKIASLSSSTMKLGKKCFIEQMKLEKEKAYELASNVMVENLQFTDCKEGIKAFLEKRKPRWN 279          
BLAST of Telomere repeat binding factor 2-1 vs. Planmine SMEST
Match: SMESG000068211.1 (SMESG000068211.1)

HSP 1 Score: 201.06 bits (510), Expect = 5.499e-61
Identity = 97/185 (52.43%), Postives = 128/185 (69.19%), Query Frame = -3
Query:  760 TPMIDKEIVMPTPQLQNIVCTVNLGCKLDLKSIALHARNAEYNPKRFAAVIMRIRTPRTTALIFSSGKMVCTGAKSEDEAKLAARKFARIIQKLDFDAKFMNFKIQNMVGSCDVKFPIRLEGICLSHTQFATYEPELFPGLIYRMGKPKIVLLIFVSGKIVLTGAKVREEIYEAFKNIYPILKTF 1314
            +P + +++    P +QNI C  +L C LDL  IA  A N +Y+ K F AVIMRIR P+TTA IF +GK++C GAK+E++AK A RK +RIIQKL +  ++ NFKI NMV SCDV+F I L+ + L H+ F TY+PE FPGL Y+M  P I +LIF SGKI+LTG K +  I EA+  I P+LK F
Sbjct:   42 SPELSQDVGSSHPVIQNIACFFDLNCGLDLSHIAKSALNTKYDAKCFPAVIMRIRKPKTTANIFKNGKIICAGAKTEEDAKKATRKISRIIQKLGYKIRYNNFKILNMVASCDVRFQIGLDPLNLLHSSFTTYDPEQFPGLFYKMADPLITILIFKSGKIILTGGKDKSNIDEAYNKILPVLKMF 226          
BLAST of Telomere repeat binding factor 2-1 vs. Planmine SMEST
Match: SMESG000068211.1 (SMESG000068211.1)

HSP 1 Score: 201.83 bits (512), Expect = 6.204e-61
Identity = 97/185 (52.43%), Postives = 128/185 (69.19%), Query Frame = -3
Query:  760 TPMIDKEIVMPTPQLQNIVCTVNLGCKLDLKSIALHARNAEYNPKRFAAVIMRIRTPRTTALIFSSGKMVCTGAKSEDEAKLAARKFARIIQKLDFDAKFMNFKIQNMVGSCDVKFPIRLEGICLSHTQFATYEPELFPGLIYRMGKPKIVLLIFVSGKIVLTGAKVREEIYEAFKNIYPILKTF 1314
            +P + +++    P +QNI C  +L C LDL  IA  A N +Y+ K F AVIMRIR P+TTA IF +GK++C GAK+E++AK A RK +RIIQKL +  ++ NFKI NMV SCDV+F I L+ + L H+ F TY+PE FPGL Y+M  P I +LIF SGKI+LTG K +  I EA+  I P+LK F
Sbjct:   67 SPELSQDVGSSHPVIQNIACFFDLNCGLDLSHIAKSALNTKYDAKCFPAVIMRIRKPKTTANIFKNGKIICAGAKTEEDAKKATRKISRIIQKLGYKIRYNNFKILNMVASCDVRFQIGLDPLNLLHSSFTTYDPEQFPGLFYKMADPLITILIFKSGKIILTGGKDKSNIDEAYNKILPVLKMF 251          
BLAST of Telomere repeat binding factor 2-1 vs. Planmine SMEST
Match: SMESG000017008.1 (SMESG000017008.1)

HSP 1 Score: 174.096 bits (440), Expect = 3.176e-51
Identity = 78/188 (41.49%), Postives = 124/188 (65.96%), Query Frame = -3
Query:  760 TPSTPMIDKEIVMPTPQLQNIVCTVNLGCKLDLKSIALHARNAEYNPKRFAAVIMRIRTPRTTALIFSSGKMVCTGAKSEDEAKLAARKFARIIQKLDFDAKFMNFKIQNMVGSCDVKFPIRLEGICLSHTQFATYEPELFPGLIYRMGKPKIVLLIFVSGKIVLTGAKVREEIYEAFKNIYPILKTF 1323
            T + P++D     P P++ N+V   + G +L L  I      AEYNP RF+  I+++ +P+ T++IF++G ++ TGA+SE+   L AR+  R++  ++   K +NFK  N+V   ++KFPIRLEGI  S+ Q   YEPELFP + YR+  PK+  LIFV+G+I++TGAK + ++ +AF N+YP+L+ F
Sbjct:   15 TITRPIVDNHFQTPIPKITNVVAKFSTGIELKLDYIIAKVNGAEYNPARFSGCILKLVSPKITSMIFNTGIILITGARSEESCYLGARRLIRMLTLINLPVKLVNFKYINIVAQVNLKFPIRLEGIVDSNAQRINYEPELFPAVFYRIFSPKMTFLIFVNGQIIITGAKSKSQLIKAFNNVYPVLRQF 202          
The following BLAST results are available for this feature:
BLAST of Telomere repeat binding factor 2-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TBP1.119e-10978.28TATA-box binding protein [Source:HGNC Symbol;Acc:H... [more]
TBP9.628e-10978.28TATA-box binding protein [Source:HGNC Symbol;Acc:H... [more]
TBP9.690e-10978.28TATA-box binding protein [Source:HGNC Symbol;Acc:H... [more]
TBP9.690e-10978.28TATA-box binding protein [Source:HGNC Symbol;Acc:H... [more]
TBPL21.595e-10377.60TATA-box binding protein like 2 [Source:HGNC Symbo... [more]
back to top
BLAST of Telomere repeat binding factor 2-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tbp-11.875e-9874.33TATA-box-binding protein [Source:UniProtKB/Swiss-... [more]
ech-28.169e-4949.70Enoyl-CoA Hydratase [Source:UniProtKB/TrEMBL;Acc:... [more]
ech-28.169e-4949.70Enoyl-CoA Hydratase [Source:UniProtKB/TrEMBL;Acc:... [more]
ech-21.299e-4849.70Enoyl-CoA Hydratase [Source:UniProtKB/TrEMBL;Acc:... [more]
tlf-13.712e-2733.90TBP-like factor [Source:UniProtKB/TrEMBL;Acc:G5EC... [more]
back to top
BLAST of Telomere repeat binding factor 2-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tbp8.832e-10578.28gene:FBgn0003687 transcript:FBtr0071679[more]
Trf1.248e-7054.55gene:FBgn0010287 transcript:FBtr0079542[more]
CG69843.381e-4143.90gene:FBgn0034191 transcript:FBtr0086979[more]
Trf21.868e-3942.20gene:FBgn0261793 transcript:FBtr0333811[more]
Trf21.868e-3942.20gene:FBgn0261793 transcript:FBtr0330106[more]
back to top
BLAST of Telomere repeat binding factor 2-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tbp6.593e-11078.79TATA box binding protein [Source:NCBI gene;Acc:368... [more]
tbp6.593e-11078.79TATA box binding protein [Source:NCBI gene;Acc:368... [more]
tbpl21.690e-10182.66TATA box binding protein like 2 [Source:NCBI gene;... [more]
tbpl13.636e-3740.48TBP-like 1 [Source:NCBI gene;Acc:403035][more]
tbpl13.636e-3740.48TBP-like 1 [Source:NCBI gene;Acc:403035][more]
back to top
BLAST of Telomere repeat binding factor 2-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tbp3.692e-10978.28TATA-box binding protein [Source:NCBI gene;Acc:549... [more]
tbp6.853e-10978.28TATA-box binding protein [Source:NCBI gene;Acc:549... [more]
pa2g43.254e-10381.92proliferation-associated 2G4 [Source:Xenbase;Acc:X... [more]
tbp5.108e-9577.27TATA-box binding protein [Source:NCBI gene;Acc:549... [more]
pa2g48.632e-6879.84proliferation-associated 2G4 [Source:Xenbase;Acc:X... [more]
back to top
BLAST of Telomere repeat binding factor 2-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tbp1.545e-10978.28TATA box binding protein [Source:MGI Symbol;Acc:MG... [more]
Tbp1.545e-10978.28TATA box binding protein [Source:MGI Symbol;Acc:MG... [more]
Tbp1.545e-10978.28TATA box binding protein [Source:MGI Symbol;Acc:MG... [more]
Tbpl23.638e-9467.65TATA box binding protein like 2 [Source:MGI Symbol... [more]
Tbpl21.807e-9267.32TATA box binding protein like 2 [Source:MGI Symbol... [more]
back to top
BLAST of Telomere repeat binding factor 2-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q7SXL3|TBP_DANRE4.977e-10978.79TATA-box-binding protein OS=Danio rerio OX=7955 GN... [more]
sp|Q92117|TBP_PROFL6.437e-10978.28TATA-box-binding protein OS=Protobothrops flavovir... [more]
sp|Q92146|TBP_TRIGA6.888e-10978.28TATA-box-binding protein OS=Trimeresurus gramineus... [more]
sp|P53360|TBP_MESAU1.015e-10878.28TATA-box-binding protein OS=Mesocricetus auratus O... [more]
sp|O13270|TBP_CHICK1.028e-10878.28TATA-box-binding protein OS=Gallus gallus OX=9031 ... [more]
back to top
BLAST of Telomere repeat binding factor 2-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A172RW061.032e-134100.00Telomere repeat binding factor 2-2 (Fragment) OS=S... [more]
A0A172RVR76.577e-11599.41Telomere repeat binding factor 2-1 (Fragment) OS=S... [more]
A0A183QED64.401e-11365.41Uncharacterized protein OS=Schistosoma rodhaini OX... [more]
A0A095BZ376.228e-11365.04TATA-box-binding protein OS=Schistosoma haematobiu... [more]
A0A183K0M56.228e-11365.04Uncharacterized protein OS=Schistosoma curassoni O... [more]
back to top
BLAST of Telomere repeat binding factor 2-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tbpl21.594e-10082.66TATA box binding protein like 2 [Source:NCBI gene;... [more]
tbp2.491e-4547.51TATA box binding protein [Source:NCBI gene;Acc:368... [more]
echs19.071e-1632.69enoyl-CoA hydratase, short chain 1 [Source:NCBI ge... [more]
echs11.323e-1532.69enoyl-CoA hydratase, short chain 1 [Source:NCBI ge... [more]
echdc22.756e-1126.20enoyl-CoA hydratase domain containing 2 [Source:NC... [more]
back to top
BLAST of Telomere repeat binding factor 2-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tbp2.315e-10683.62TATA box binding protein [Source:NCBI gene;Acc:368... [more]
ECHDC31.207e-5449.43enoyl-CoA hydratase domain containing 3 [Source:HG... [more]
tbpl12.935e-3641.18TBP-like 1 [Source:NCBI gene;Acc:403035][more]
echs12.487e-1530.19enoyl CoA hydratase, short chain, 1, mitochondrial... [more]
ech11.022e-1027.06enoyl CoA hydratase 1, peroxisomal [Source:ZFIN;Ac... [more]
back to top
BLAST of Telomere repeat binding factor 2-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
SPT155.578e-9979.77TATA-binding protein (TBP); general transcription ... [more]
YER147C-A_mRNA8.329e-962.50Dubious open reading frame; unlikely to encode a f... [more]
back to top
BLAST of Telomere repeat binding factor 2-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO441032.547e-10880.31Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO322773.704e-5952.07Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO400203.073e-2233.96Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO317796.714e-1136.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO377098.754e-833.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Telomere repeat binding factor 2-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tbp8.882e-10777.78TATA-box binding protein [Source:NCBI gene;Acc:100... [more]
tbpl25.162e-9780.92TATA-box binding protein like 2 [Source:NCBI gene;... [more]
tbpl22.925e-9580.92TATA-box binding protein like 2 [Source:NCBI gene;... [more]
ECHDC34.540e-5649.71enoyl-CoA hydratase domain containing 3 [Source:NC... [more]
ECHDC32.036e-5550.59enoyl-CoA hydratase domain containing 3 [Source:NC... [more]
back to top
BLAST of Telomere repeat binding factor 2-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000064519.10.000e+0100.00SMESG000064519.1[more]
SMESG000064518.13.540e-11899.41SMESG000064518.1[more]
SMESG000068211.15.499e-6152.43SMESG000068211.1[more]
SMESG000068211.16.204e-6152.43SMESG000068211.1[more]
SMESG000017008.13.176e-5141.49SMESG000017008.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028055 ID=SMED30028055|Name=Telomere repeat binding factor 2-1|organism=Schmidtea mediterranea sexual|type=transcript|length=1583bp
TTTTGATAAAGCATCTAATGTTAGATTTTGAAAATTTCTTCAATTTTCAA
ATATTGATTTCAGCTAATGAAAATAATAGAAAATTACTTTATACCTGTAA
TTGTATCAATTCAAGGCACTGCTGCAGCAGCAGGTTGCCAATTGGTGGCT
TCCTGTGACATAGCAATATGTGGACAATCTTCTTTATTTTCAACACCAGG
AATATTAGCAGGTCTATTTTGTTCTACTCCTGGTGTTGCTGTCGGCCGTG
TTTTACCAAGAAAAATTGCTTTAGAAATGCTGTATACTGGCGAACCTATT
TCGGCCGAAACTGCACTGAAATATGGATTGGTTAATCATGTAGTCGAAGA
TTCAAAAATTGATGAAACTTCAGAGAAAATCGCAAATAAAATTGCATCAT
TAAGCAGTTCGACTATGAAATTAGGTAAAAAGTGCTTTATTGAACAAATG
AAGCTAGAAAAAGAAAAGGCTTATGAACTCGCGTCCAATGTAATGGTAGA
AAATTTACAGTTTACAGATTGCAAAGAAGGTATCAAAGCATTTTTAGAAA
AAAGAAAGCCAAGATGGAATTAGTGATTATTTTTCGATTTCAATAAAAAG
TTGTCTTTACACATTATATTCAGCATTGAGAAAATATAAATCATTTCAAA
ATATCACAATTAGTTCAAATATAATACAAGTTTCGGTCGCATTTCCAAAT
TAACACCGTAACACAAGTAGCAACCGAACAATTTATTTTGGAGTTTGAGA
TGTATTCATAAAGGTCTTTAAAATAGGATAAATATTTTTGAATGCTTCAT
AAATCTCTTCTCTAACTTTTGCTCCTGTTAAGACTATTTTTCCCGAAACG
AAAATCAAAAGAACAATTTTTGGTTTACCCATTCGATAAATTAATCCAGG
AAACAATTCTGGTTCATATGTAGCAAACTGGGTGTGTGAAAGACAAATAC
CTTCCAAACGAATTGGAAATTTGACGTCACAAGAACCAACCATGTTTTGA
ATTTTAAAATTCATAAATTTTGCATCAAAATCTAATTTTTGAATAATTCT
GGCAAACTTTCTCGCTGCTAATTTAGCTTCATCTTCACTTTTTGCGCCAG
TACAAACCATTTTACCCGATGAAAATATAAGAGCGGTAGTTCGAGGTGTT
CTTATTCTCATAATAACGGCTGCAAAACGCTTTGGATTGTATTCAGCGTT
TCTGGCATGAAGAGCAATTGATTTCAAATCTAATTTACATCCCAAATTTA
CAGTGCAAACAATATTTTGTAACTGAGGTGTAGGCATCACAATTTCTTTA
TCAATCATAGGGGTAGAGGGTGTATGAGGAGTAACAGGAGTACGACCAAC
TATGCTCCCGATACTAATTTGACCAGCTGTTTCATTACATAAATTGTTTG
AATGAGAAATTAAATTCAACGGAGCTTCATTATTATCCTTTTTTATAGAA
TGGGAATTTGGAGTTTGTATTGCATTAAAAACACTGGCTAAACTTCCTAT
GCTGTTTTGATGGTATAGGCTATTAGTAGCAACTGATGAAATATTGTTCT
GCATGTAATTATTTGTCATATAAGATTTATATA
back to top

protein sequence of SMED30028055-orf-1

>SMED30028055-orf-1 ID=SMED30028055-orf-1|Name=SMED30028055-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=169bp
MKIIENYFIPVIVSIQGTAAAAGCQLVASCDIAICGQSSLFSTPGILAGL
FCSTPGVAVGRVLPRKIALEMLYTGEPISAETALKYGLVNHVVEDSKIDE
TSEKIANKIASLSSSTMKLGKKCFIEQMKLEKEKAYELASNVMVENLQFT
DCKEGIKAFLEKRKPRWN*
back to top

protein sequence of SMED30028055-orf-2

>SMED30028055-orf-2 ID=SMED30028055-orf-2|Name=SMED30028055-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=283bp
YKSYMTNNYMQNNISSVATNSLYHQNSIGSLASVFNAIQTPNSHSIKKDN
NEAPLNLISHSNNLCNETAGQISIGSIVGRTPVTPHTPSTPMIDKEIVMP
TPQLQNIVCTVNLGCKLDLKSIALHARNAEYNPKRFAAVIMRIRTPRTTA
LIFSSGKMVCTGAKSEDEAKLAARKFARIIQKLDFDAKFMNFKIQNMVGS
CDVKFPIRLEGICLSHTQFATYEPELFPGLIYRMGKPKIVLLIFVSGKIV
LTGAKVREEIYEAFKNIYPILKTFMNTSQTPK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
PLANA:0000208testis
PLANA:0000228male germ cell
Vocabulary: INTERPRO
TermDefinition
IPR014748Enoyl-CoA_hydra_C
IPR006588Peptide_N_glycanase_PAW_dom
IPR029045ClpP/crotonase-like_dom_sf
IPR001753Enoyl-CoA_hydra/iso
IPR000814TBP
IPR012295TBP_dom_sf
IPR030491TBP_CS
Vocabulary: biological process
TermDefinition
GO:0006516glycoprotein catabolic process
GO:0008152metabolic process
GO:0006352DNA-templated transcription, initiation
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
Vocabulary: molecular function
TermDefinition
GO:0003824catalytic activity
GO:0003677DNA binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001753Enoyl-CoA hydratase/isomerasePFAMPF00378ECH_1coord: 5..168
e-value: 5.9E-32
score: 110.9
IPR014748Enoyl-CoA hydratase, C-terminalGENE3DG3DSA:1.10.12.10coord: 113..168
e-value: 5.3E-24
score: 85.8
NoneNo IPR availableGENE3DG3DSA:3.90.226.10coord: 1..112
e-value: 1.2E-31
score: 111.7
NoneNo IPR availablePANTHERPTHR43602FAMILY NOT NAMEDcoord: 1..168
NoneNo IPR availablePROSITEPS51257PROKAR_LIPOPROTEINcoord: 1..24
score: 5.0
NoneNo IPR availableCDDcd06558crotonase-likecoord: 4..109
e-value: 2.51059E-31
score: 109.572
NoneNo IPR availableTMHMMTMhelixcoord: 44..63
NoneNo IPR availableTMHMMTMhelixcoord: 7..29
IPR029045ClpP/crotonase-like domain superfamilySUPERFAMILYSSF52096ClpP/crotonasecoord: 3..168