Regulatory-associated protein of mTOR

Overview
NameRegulatory-associated protein of mTOR
Smed IDSMED30028047
Length (bp)4947
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Regulatory-associated protein of mTOR (SMED30028047) t-SNE clustered cells

Violin plots show distribution of expression levels for Regulatory-associated protein of mTOR (SMED30028047) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Regulatory-associated protein of mTOR (SMED30028047) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Regulatory-associated protein of mTOR (SMED30028047) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028047

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30028047h1SMcG0018069 JF894290.2smed_ncbi_20240424PMID:22451003
González-Sastre et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30028047h1SMcG0018069 JF894290.2smed_ncbi_20240424PMID:22451003
González-Sastre et al., 2012
whole organism asexual adult fluorescence in situ hybridization evidence
whole organismSMED30028047h1SMcG0018069 JF894290.2smed_ncbi_20240424PMID:22451003
González-Sastre et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30028047h1SMcG0018069 dd_Smed_v4_4759_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30028047h1SMcG0018069 dd_Smed_v4_4759_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
whole organismSMED30028047h1SMcG0018069 JF894290smed_ncbi_20240424PMID:22479207
González-Estévez et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30028047h1SMcG0018069 JF894290smed_ncbi_20240424PMID:22479207
González-Estévez et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Regulatory-associated protein of mTOR vs. Ensembl Human
Match: RPTOR (regulatory associated protein of MTOR complex 1 [Source:HGNC Symbol;Acc:HGNC:30287])

HSP 1 Score: 405.986 bits (1042), Expect = 6.001e-128
Identity = 197/371 (53.10%), Postives = 258/371 (69.54%), Query Frame = 2
Query:   89 LIDIVEEDKS------YPFVAFKARHLNXXXXXXXXXXXXXXKDKVRTLHVVLVLCLNLAVDPPDTLVKVSPCSKMEAWFDPKEKNLNRALEMIGKNLQIQYERWQPKARYRQSLDPTIEEIHRLCQSLRRSAREDRVLFHYNGHGVPRPTENGEIWVFNKAYTKYIPLSLYDLHSWMGGPTVYVFDCNNAGRIIRMMEQFSMKRFENNGTANSS------------SMDNIIILASCQENEDIPQNPEVPADLFTSCLTTPIKIALHWYLLRNQEIFPNYLNETMLELIGGSPSNRVSMFGEINWVFTAVTDTIAWSCLPPPLFQKLFRQDLLVASLFRNFLLAERIMHYYGLRPVSYPPLPKTYEHPMW 1147
            L+ + EED++       P    K RH  +      L +    KD+++T+ V LVLCLN+ VDPPD +VK +PC+++E W DP      +ALE IG NLQ QYE WQP+ARY+QSLDPT++E+ +LC SLRR+A+E+RVLFHYNGHGVPRPT NGE+WVFNK YT+YIPLS+YDL +WMG P+++V+DC+NAG I++  +QF+++R +    A  +            SM N I LA+C+  E +P  P++PADLFTSCLTTPIKIAL W+ ++        +   ++E I G  ++R +  GE+NW+FTA+TDTIAW+ LP  LFQKLFRQDLLVASLFRNFLLAERIM  Y   PVS P LP TY H MW
Sbjct:   10 LLGLGEEDEADLTDWNLPLAFMKKRHCEKIEGSKSLAQSWRMKDRMKTVSVALVLCLNVGVDPPD-VVKTTPCARLECWIDPLSMGPQKALETIGANLQKQYENWQPRARYKQSLDPTVDEVKKLCTSLRRNAKEERVLFHYNGHGVPRPTVNGEVWVFNKNYTQYIPLSIYDLQTWMGSPSIFVYDCSNAGLIVKSFKQFALQREQELEVAAINPNHPLAQMPLPPSMKNCIQLAACEATELLPMIPDLPADLFTSCLTTPIKIALRWFCMQKCVSLVPGVTLDLIEKIPGRLNDRRTPLGELNWIFTAITDTIAWNVLPRDLFQKLFRQDLLVASLFRNFLLAERIMRSYNCTPVSSPRLPPTYMHAMW 379          
BLAST of Regulatory-associated protein of mTOR vs. Ensembl Human
Match: RPTOR (regulatory associated protein of MTOR complex 1 [Source:HGNC Symbol;Acc:HGNC:30287])

HSP 1 Score: 429.869 bits (1104), Expect = 3.088e-127
Identity = 208/398 (52.26%), Postives = 272/398 (68.34%), Query Frame = 2
Query:   89 LIDIVEEDKS------YPFVAFKARHLNXXXXXXXXXXXXXXKDKVRTLHVVLVLCLNLAVDPPDTLVKVSPCSKMEAWFDPKEKNLNRALEMIGKNLQIQYERWQPKARYRQSLDPTIEEIHRLCQSLRRSAREDRVLFHYNGHGVPRPTENGEIWVFNKAYTKYIPLSLYDLHSWMGGPTVYVFDCNNAGRIIRMMEQFSMKRFENNGTAN------------SSSMDNIIILASCQENEDIPQNPEVPADLFTSCLTTPIKIALHWYLLRNQEIFPNYLNETMLELIGGSPSNRVSMFGEINWVFTAVTDTIAWSCLPPPLFQKLFRQDLLVASLFRNFLLAERIMHYYGLRPVSYPPLPKTYEHPMWDAWDHALDCYTSQLPEIYHKKQSMNNS 1228
            L+ + EED++       P    K RH  +      L +    KD+++T+ V LVLCLN+ VDPPD +VK +PC+++E W DP      +ALE IG NLQ QYE WQP+ARY+QSLDPT++E+ +LC SLRR+A+E+RVLFHYNGHGVPRPT NGE+WVFNK YT+YIPLS+YDL +WMG P+++V+DC+NAG I++  +QF+++R +    A               SM N I LA+C+  E +P  P++PADLFTSCLTTPIKIAL W+ ++        +   ++E I G  ++R +  GE+NW+FTA+TDTIAW+ LP  LFQKLFRQDLLVASLFRNFLLAERIM  Y   PVS P LP TY H MW AWD A+D   SQLP I  +  +  +S
Sbjct:   10 LLGLGEEDEADLTDWNLPLAFMKKRHCEKIEGSKSLAQSWRMKDRMKTVSVALVLCLNVGVDPPD-VVKTTPCARLECWIDPLSMGPQKALETIGANLQKQYENWQPRARYKQSLDPTVDEVKKLCTSLRRNAKEERVLFHYNGHGVPRPTVNGEVWVFNKNYTQYIPLSIYDLQTWMGSPSIFVYDCSNAGLIVKSFKQFALQREQELEVAAINPNHPLAQMPLPPSMKNCIQLAACEATELLPMIPDLPADLFTSCLTTPIKIALRWFCMQKCVSLVPGVTLDLIEKIPGRLNDRRTPLGELNWIFTAITDTIAWNVLPRDLFQKLFRQDLLVASLFRNFLLAERIMRSYNCTPVSSPRLPPTYMHAMWQAWDLAVDICLSQLPTIIEEGTAFRHS 406          

HSP 2 Score: 153.68 bits (387), Expect = 1.136e-36
Identity = 81/280 (28.93%), Postives = 151/280 (53.93%), Query Frame = 2
Query: 3602 HVIDSAKYEDRNERLKKQKNIKLEGAQNWKASLNSSGTQLS-QIFLQKIDSKPELLKFHPYLNYLAVVDRSGVSLWNWESGQRAQYMLSQSVSCKXXXXXXXXXXXXXXXXXXLEFINAEEDRGGLILVGTMDGRIKIWRNYLRDMGQDPDIVTAWIALPDQICSNRPSGLITHWSQSLGQLTISGDVKYIRLWDSLQECKISDMNTNSESCVSSIDRSQDGRLIVAGFGDGHIKMFDIRAPVNECVINAGVGDMGWIHKVAYSDSTN-QVYSIGIYGEL 4435
            H ++S   ++R  R  +   ++ +  Q  +  +    T+L  QIFL +    P ++KFHP+   +AV D+  +  W+WE G++  Y  + +                   +T++E++N ++    L+L  T DG I++W+N+  D+ ++P++VTAW  L D + + R +G++  W Q  G L  SGDV+ +R+WD+ +E K+ D+ T ++SCV+S+       LIVAG GDG I+++D R  ++EC +        W+ K +     +  + S+ + G++
Sbjct:  820 HDLESQIRKEREWRFLRNSRVRRQAQQVIQKGI----TRLDDQIFLNRNPGVPSVVKFHPFTPCIAVADKDSICFWDWEKGEKLDYFHNGN--------------PRYTRVTAMEYLNGQD--CSLLLTATDDGAIRVWKNFA-DLEKNPEMVTAWQGLSDMLPTTRGAGMVVDWEQETGLLMSSGDVRIVRIWDTDREMKVQDIPTGADSCVTSLSCDSHRSLIVAGLGDGSIRVYDRRMALSECRVMTYREHTAWVVKASLQKRPDGHIVSVSVNGDV 1078          

HSP 3 Score: 98.5969 bits (244), Expect = 8.536e-20
Identity = 57/98 (58.16%), Postives = 75/98 (76.53%), Query Frame = 2
Query: 1709 FKHTDFFNDHMTAFELWLKTADEKKXXXXXXXXXXXXXXXXXHRYRALRLLSEYMDLGPWAVIQCLTVGIFPYVVRLLQSPVYDVKPYLVFIWGKIIS 2002
            F+H+ FF + +TAF++WL    E +  P QLPI+LQVLLSQVHR RAL LL  ++DLGPWAV   L+VGIFPYV++LLQS   +++P LVFIW KI++
Sbjct:  403 FRHSPFFAEQLTAFQVWLTMGVENRNPPEQLPIVLQVLLSQVHRLRALDLLGRFLDLGPWAVSLALSVGIFPYVLKLLQSSARELRPLLVFIWAKILA 500          
BLAST of Regulatory-associated protein of mTOR vs. Ensembl Human
Match: RPTOR (regulatory associated protein of MTOR complex 1 [Source:HGNC Symbol;Acc:HGNC:30287])

HSP 1 Score: 431.795 bits (1109), Expect = 1.192e-126
Identity = 208/398 (52.26%), Postives = 272/398 (68.34%), Query Frame = 2
Query:   89 LIDIVEEDKS------YPFVAFKARHLNXXXXXXXXXXXXXXKDKVRTLHVVLVLCLNLAVDPPDTLVKVSPCSKMEAWFDPKEKNLNRALEMIGKNLQIQYERWQPKARYRQSLDPTIEEIHRLCQSLRRSAREDRVLFHYNGHGVPRPTENGEIWVFNKAYTKYIPLSLYDLHSWMGGPTVYVFDCNNAGRIIRMMEQFSMKRFENNGTAN------------SSSMDNIIILASCQENEDIPQNPEVPADLFTSCLTTPIKIALHWYLLRNQEIFPNYLNETMLELIGGSPSNRVSMFGEINWVFTAVTDTIAWSCLPPPLFQKLFRQDLLVASLFRNFLLAERIMHYYGLRPVSYPPLPKTYEHPMWDAWDHALDCYTSQLPEIYHKKQSMNNS 1228
            L+ + EED++       P    K RH  +      L +    KD+++T+ V LVLCLN+ VDPPD +VK +PC+++E W DP      +ALE IG NLQ QYE WQP+ARY+QSLDPT++E+ +LC SLRR+A+E+RVLFHYNGHGVPRPT NGE+WVFNK YT+YIPLS+YDL +WMG P+++V+DC+NAG I++  +QF+++R +    A               SM N I LA+C+  E +P  P++PADLFTSCLTTPIKIAL W+ ++        +   ++E I G  ++R +  GE+NW+FTA+TDTIAW+ LP  LFQKLFRQDLLVASLFRNFLLAERIM  Y   PVS P LP TY H MW AWD A+D   SQLP I  +  +  +S
Sbjct:   10 LLGLGEEDEADLTDWNLPLAFMKKRHCEKIEGSKSLAQSWRMKDRMKTVSVALVLCLNVGVDPPD-VVKTTPCARLECWIDPLSMGPQKALETIGANLQKQYENWQPRARYKQSLDPTVDEVKKLCTSLRRNAKEERVLFHYNGHGVPRPTVNGEVWVFNKNYTQYIPLSIYDLQTWMGSPSIFVYDCSNAGLIVKSFKQFALQREQELEVAAINPNHPLAQMPLPPSMKNCIQLAACEATELLPMIPDLPADLFTSCLTTPIKIALRWFCMQKCVSLVPGVTLDLIEKIPGRLNDRRTPLGELNWIFTAITDTIAWNVLPRDLFQKLFRQDLLVASLFRNFLLAERIMRSYNCTPVSSPRLPPTYMHAMWQAWDLAVDICLSQLPTIIEEGTAFRHS 406          

HSP 2 Score: 232.646 bits (592), Expect = 5.565e-61
Identity = 167/474 (35.23%), Postives = 262/474 (55.27%), Query Frame = 2
Query: 1709 FKHTDFFNDHMTAFELWLKTADEKKXXXXXXXXXXXXXXXXXHRYRALRLLSEYMDLGPWAVIQCLTVGIFPYVVRLLQSPVYDVKPYLVFIWGKIISSAQTDFAKNDVVKDAGYKYFVSCLTENEPY-EIIIKTISAFALAKMLNNNPVGQKLYIKQNFMTVLIEELENNPSDLANDNYIRLRIWFILSFAKLWSDNDDAKWYGVRQQIHEKLLLYLKDISPEVRAATVYALGTFLNNKASDGIRSKHAVQVEQNICQHLLNHSVNDSSPLVRAELVVAMKYMVNLFSNQVMSMAIYYDVWLSQNNHGSINDVNNGKFMGPPSPLANRNVMPSRGSIEKISKRLFVHSPPALTDKISVRQKAVSSGDLTNFDENNNTFWLFKDSHIPFILPDMYLYGNINSTRGNLKNLGAELSFRPTFIKKVPAVSNFTTYNS--GFPIINIYAQMWFSLILLSKDPYPKVSILASKIVEAI 3121
            F+H+ FF + +TAF++WL    E +  P QLPI+LQVLLSQVHR RAL LL  ++DLGPWAV   L+VGIFPYV++LLQS   +++P LVFIW KI++   +   + D+VKD G+KYF+S L   +PY     +T++AF LA ++N+   GQ+  ++ N + + +E+L        ND +  LR W  +   ++W + D A+W GVR   HEKL   L D  PEVR A V+ALGTF+ N A    R+ H+  ++ N+   +L   V+D SP+VR ELVVA+ ++V  + +   ++A+ +              +   K    PSP          GS+  +          +++   ++R  AV++    N    N +        + F   ++    + +ST G+ +N    LSF    I K+   S++++ NS  G    ++Y Q+W  L+ L+ DPYP+VS +A K++ +I
Sbjct:  403 FRHSPFFAEQLTAFQVWLTMGVENRNPPEQLPIVLQVLLSQVHRLRALDLLGRFLDLGPWAVSLALSVGIFPYVLKLLQSSARELRPLLVFIWAKILAVDSS--CQADLVKDNGHKYFLSVLA--DPYMPAEHRTMTAFILAVIVNSYHTGQEACLQGNLIAICLEQL--------NDPHPLLRQWVAICLGRIWQNFDSARWCGVRDSAHEKLYSLLSDPIPEVRCAAVFALGTFVGNSAE---RTDHSTTIDHNVAM-MLAQLVSDGSPMVRKELVVALSHLVVQYESNFCTVALQF--------------IEEEKNYALPSPATTEG-----GSLTPVRDSPCTPRLRSVSSYGNIR--AVATARSLNKSLQNLSLTEESGGAVAFSPGNLSTSSSASSTLGSPENEEHILSFET--IDKMRRASSYSSLNSLIGVSFNSVYTQIWRVLLHLAADPYPEVSDVAMKVLNSI 837          

HSP 3 Score: 153.295 bits (386), Expect = 1.420e-36
Identity = 81/280 (28.93%), Postives = 151/280 (53.93%), Query Frame = 2
Query: 3602 HVIDSAKYEDRNERLKKQKNIKLEGAQNWKASLNSSGTQLS-QIFLQKIDSKPELLKFHPYLNYLAVVDRSGVSLWNWESGQRAQYMLSQSVSCKXXXXXXXXXXXXXXXXXXLEFINAEEDRGGLILVGTMDGRIKIWRNYLRDMGQDPDIVTAWIALPDQICSNRPSGLITHWSQSLGQLTISGDVKYIRLWDSLQECKISDMNTNSESCVSSIDRSQDGRLIVAGFGDGHIKMFDIRAPVNECVINAGVGDMGWIHKVAYSDSTN-QVYSIGIYGEL 4435
            H ++S   ++R  R  +   ++ +  Q  +  +    T+L  QIFL +    P ++KFHP+   +AV D+  +  W+WE G++  Y  + +                   +T++E++N ++    L+L  T DG I++W+N+  D+ ++P++VTAW  L D + + R +G++  W Q  G L  SGDV+ +R+WD+ +E K+ D+ T ++SCV+S+       LIVAG GDG I+++D R  ++EC +        W+ K +     +  + S+ + G++
Sbjct:  978 HDLESQIRKEREWRFLRNSRVRRQAQQVIQKGI----TRLDDQIFLNRNPGVPSVVKFHPFTPCIAVADKDSICFWDWEKGEKLDYFHNGN--------------PRYTRVTAMEYLNGQD--CSLLLTATDDGAIRVWKNFA-DLEKNPEMVTAWQGLSDMLPTTRGAGMVVDWEQETGLLMSSGDVRIVRIWDTDREMKVQDIPTGADSCVTSLSCDSHRSLIVAGLGDGSIRVYDRRMALSECRVMTYREHTAWVVKASLQKRPDGHIVSVSVNGDV 1236          
BLAST of Regulatory-associated protein of mTOR vs. Ensembl Human
Match: RPTOR (regulatory associated protein of MTOR complex 1 [Source:HGNC Symbol;Acc:HGNC:30287])

HSP 1 Score: 58.9214 bits (141), Expect = 7.359e-10
Identity = 31/82 (37.80%), Postives = 47/82 (57.32%), Query Frame = 2
Query:   89 LIDIVEEDKS------YPFVAFKARHLNXXXXXXXXXXXXXXKDKVRTLHVVLVLCLNLAVDPPDTLVKVSPCSKMEAWFDP 316
            L+ + EED++       P    K RH  +      L +    KD+++T+ V LVLCLN+ VDPPD +VK +PC+++E W  P
Sbjct:   10 LLGLGEEDEADLTDWNLPLAFMKKRHCEKIEGSKSLAQSWRMKDRMKTVSVALVLCLNVGVDPPD-VVKTTPCARLECWIGP 90          
BLAST of Regulatory-associated protein of mTOR vs. Ensembl Celegans
Match: daf-15 (DAF-15 [Source:UniProtKB/TrEMBL;Acc:Q68TI8])

HSP 1 Score: 296.975 bits (759), Expect = 4.641e-81
Identity = 152/374 (40.64%), Postives = 233/374 (62.30%), Query Frame = 2
Query:  200 DKVRTLHVVLVLCLNLAVDPPDTLVKVSPCSKMEAWFDPKEKNLNRALEMIGKNLQIQYERWQPKA--RYRQSLDPTIEEIHRLCQSLRRSAREDRVLFHYNGHGVPRPTENGEIWVFNKAYTKYIPLSLYDLHSWMGGPTVYVFDCNNAGRIIRMMEQFS-------MKRF------ENNGTANSSSM------------------DNIIILASCQENEDIP-QNPEVPADLFTSCLTTPIKIALHWYLLRNQ--EIFPNYLNETMLELIGGSPSNRVSMFGEINWVFTAVTDTIAWSCLPPPLFQKLFRQDLLVASLFRNFLLAERIMHYYGLRPVSYPPLPKTYEHPMWDAWDHALDCYTSQLPEIYHKKQ 1213
            D++RT  V +++CL+L VDPP+   +    S++ +W DP +   ++A   IG + Q  YE+WQPK+  RY+   DP I+++ ++  +LRR +  DRVLFHYNGHGVP+PT+NGEIWVFNK++T+YIPLS++DL  W+  PT+Y+++ ++A  I+    +F          RF      + N    SS M                  ++ I LA+C   + +P  NP +PADLFTSCLTTPI+ +L ++L  ++  + +P    E +L++I G+ + R ++ GE+NW+FTA+TDTIA++ +    FQKLFRQDLL+A+LFR+FLLA+R+M  + + PVS PPL  T  H +W  WD  +D       E+ + K+
Sbjct:   90 DRLRTASVAIIMCLHLGVDPPEAPSRKDAPSRLLSWVDPYKCGAHKAAIEIGLSTQRAYEKWQPKSKTRYKICTDPPIDDVRKVATNLRRISGNDRVLFHYNGHGVPKPTDNGEIWVFNKSFTQYIPLSIFDLQGWLDYPTIYIWETHSAETILHNYRRFGEDQKISWQSRFDRWQEEQRNLPPISSKMTDADQAEALGFPEKYPRYNDCIHLAACSAGQWLPMSNPHLPADLFTSCLTTPIRTSLAFHLSHSEHRDEYP----ENILDMIPGNLAERRTVLGELNWIFTAITDTIAFTSIDRDSFQKLFRQDLLLATLFRSFLLAQRVMSKFNVLPVSQPPLKDTSMHDLWRCWDQTMDMVLDYCRELIYVKE 459          

HSP 2 Score: 115.546 bits (288), Expect = 2.606e-25
Identity = 99/367 (26.98%), Postives = 174/367 (47.41%), Query Frame = 2
Query: 2051 YKYFVSCLTENE--PYEIIIKTISAFALAKMLNNN-PVGQKLYIKQNFMTVLIEELENNPSDLANDNYIRLRIWFILSFAKLWSDNDDAKWYGVRQQIHEKLLLYLKDISPEVRAATVYALGTFLNNKASDGIRSKHAVQVEQNICQHLLNHSVNDSSPLVRAELVVAMKYMVNLFSNQ----VMSMAIYYDVWLSQNNHGSINDVNNGKFMGPPSPLANRNVMPSRGSIEKISKRLFVHSPPALTDKISVRQKAVSSGDLTNFDENNNTFWLFKDSHIPFILPDMYLYGNINSTRGNLKNLGAELSFRPTF---IKKVPAVSNFTTYNSGFPIINIYAQMWFSLILLSKDPYPKVSILASKIVEAI 3121
            ++YF+  L + E  P +   KT++AF LA++ +NN  + QK    + +M +  E + +   D A    + L++W ++   +LWSD D A+W G+R   H+K++L L D S EVRAA V+ALG+ L N +     ++HA  VE+N+   L +  V DSS LVR EL+VA+++ V  F  +    ++ ++      L +  + S N    G  +    P  +R   P    + +  +      P  +  K+S    + +  +  + D   N + +  ++            GN       ++    ++ +R      IK + A     T+N         A+ W SL++LS DP  +V+ +A KIV  +
Sbjct:  741 FQYFLQLLGDPEIKPKQ---KTVAAFVLAQLTSNNFKLAQKELTNKGYMGICTELMVD---DTARSVKL-LKLWILIGLGRLWSDYDVARWQGIRLMAHDKMILELSDESAEVRAAAVFALGSLLRNSSRS---NEHASAVEENLAGELCSQCVFDSSVLVREELIVALQWFVFDFEKRFVKFLLELSNQIKFKLPRKRNSSENLSEQGLDIAAEMPSNHRR--PRAPPVNEFMQ------PSVIRKKMSTSVFSTAVEETVHEDGIGNVYHIAHEA------------GN------RVEQESEDIEYRERAKVQIKHLEA----KTFNEAV------AKTWLSLLILSLDPIERVARMAQKIVHRV 1061          

HSP 3 Score: 85.8853 bits (211), Expect = 2.682e-16
Identity = 51/97 (52.58%), Postives = 70/97 (72.16%), Query Frame = 2
Query: 1712 KHTDFFNDHMTAFELWLKTADEKKXXXXXXXXXXXXXXXXXHRYRALRLLSEYMDLGPWAVIQCLTVGIFPYVVRLLQSPVYDVKPYLVFIWGKIIS 2002
            ++  FF + + AFELWL    ++   P+QLP++LQVLLSQ HR RALRLL+ ++D G WA+   L VGIFPYV++LLQS + D+K  L FIW KI++
Sbjct:  496 QYNTFFTEQLQAFELWLDYGVDEGTPPLQLPMVLQVLLSQAHRVRALRLLARFLDFGRWAIGYSLAVGIFPYVLKLLQSNISDLKISLAFIWAKILA 592          

HSP 4 Score: 51.2174 bits (121), Expect = 9.510e-6
Identity = 32/136 (23.53%), Postives = 64/136 (47.06%), Query Frame = 2
Query: 3974 LILVGTMDGRIKIWRNYL----RDMGQDPDIVTAWIALPDQI-CSNRPSGLITHWSQSLGQLTISGDVKYIRLWDSLQECKISD----------------MNTNSESCVSSIDRSQDGRLIVAGFGDGHIKMFDIR 4318
            +++  + +G ++IW  Y      D  + P++V+A   L  Q+  S+  +  +  W+Q  G+L  +G  + +R+WD+  E    D                +NTN+     S +  ++G ++  G+ DG +  FD+R
Sbjct: 1457 MVIACSTNGVVRIWDPYFLGWCDDYEKPPELVSASFPLESQMKISDETNRCLFDWNQQNGKLLCTG-TRSVRIWDAHCEKVCHDVMYSPGSKQQTGPGAKLNTNTLPTAMSGNLDEEGNMVAVGYADGRVDYFDMR 1591          
BLAST of Regulatory-associated protein of mTOR vs. Ensembl Celegans
Match: daf-15 (DAF-15 [Source:UniProtKB/TrEMBL;Acc:Q68TI8])

HSP 1 Score: 296.975 bits (759), Expect = 4.884e-81
Identity = 152/374 (40.64%), Postives = 233/374 (62.30%), Query Frame = 2
Query:  200 DKVRTLHVVLVLCLNLAVDPPDTLVKVSPCSKMEAWFDPKEKNLNRALEMIGKNLQIQYERWQPKA--RYRQSLDPTIEEIHRLCQSLRRSAREDRVLFHYNGHGVPRPTENGEIWVFNKAYTKYIPLSLYDLHSWMGGPTVYVFDCNNAGRIIRMMEQFS-------MKRF------ENNGTANSSSM------------------DNIIILASCQENEDIP-QNPEVPADLFTSCLTTPIKIALHWYLLRNQ--EIFPNYLNETMLELIGGSPSNRVSMFGEINWVFTAVTDTIAWSCLPPPLFQKLFRQDLLVASLFRNFLLAERIMHYYGLRPVSYPPLPKTYEHPMWDAWDHALDCYTSQLPEIYHKKQ 1213
            D++RT  V +++CL+L VDPP+   +    S++ +W DP +   ++A   IG + Q  YE+WQPK+  RY+   DP I+++ ++  +LRR +  DRVLFHYNGHGVP+PT+NGEIWVFNK++T+YIPLS++DL  W+  PT+Y+++ ++A  I+    +F          RF      + N    SS M                  ++ I LA+C   + +P  NP +PADLFTSCLTTPI+ +L ++L  ++  + +P    E +L++I G+ + R ++ GE+NW+FTA+TDTIA++ +    FQKLFRQDLL+A+LFR+FLLA+R+M  + + PVS PPL  T  H +W  WD  +D       E+ + K+
Sbjct:   66 DRLRTASVAIIMCLHLGVDPPEAPSRKDAPSRLLSWVDPYKCGAHKAAIEIGLSTQRAYEKWQPKSKTRYKICTDPPIDDVRKVATNLRRISGNDRVLFHYNGHGVPKPTDNGEIWVFNKSFTQYIPLSIFDLQGWLDYPTIYIWETHSAETILHNYRRFGEDQKISWQSRFDRWQEEQRNLPPISSKMTDADQAEALGFPEKYPRYNDCIHLAACSAGQWLPMSNPHLPADLFTSCLTTPIRTSLAFHLSHSEHRDEYP----ENILDMIPGNLAERRTVLGELNWIFTAITDTIAFTSIDRDSFQKLFRQDLLLATLFRSFLLAQRVMSKFNVLPVSQPPLKDTSMHDLWRCWDQTMDMVLDYCRELIYVKE 435          

HSP 2 Score: 115.546 bits (288), Expect = 2.405e-25
Identity = 99/367 (26.98%), Postives = 174/367 (47.41%), Query Frame = 2
Query: 2051 YKYFVSCLTENE--PYEIIIKTISAFALAKMLNNN-PVGQKLYIKQNFMTVLIEELENNPSDLANDNYIRLRIWFILSFAKLWSDNDDAKWYGVRQQIHEKLLLYLKDISPEVRAATVYALGTFLNNKASDGIRSKHAVQVEQNICQHLLNHSVNDSSPLVRAELVVAMKYMVNLFSNQ----VMSMAIYYDVWLSQNNHGSINDVNNGKFMGPPSPLANRNVMPSRGSIEKISKRLFVHSPPALTDKISVRQKAVSSGDLTNFDENNNTFWLFKDSHIPFILPDMYLYGNINSTRGNLKNLGAELSFRPTF---IKKVPAVSNFTTYNSGFPIINIYAQMWFSLILLSKDPYPKVSILASKIVEAI 3121
            ++YF+  L + E  P +   KT++AF LA++ +NN  + QK    + +M +  E + +   D A    + L++W ++   +LWSD D A+W G+R   H+K++L L D S EVRAA V+ALG+ L N +     ++HA  VE+N+   L +  V DSS LVR EL+VA+++ V  F  +    ++ ++      L +  + S N    G  +    P  +R   P    + +  +      P  +  K+S    + +  +  + D   N + +  ++            GN       ++    ++ +R      IK + A     T+N         A+ W SL++LS DP  +V+ +A KIV  +
Sbjct:  717 FQYFLQLLGDPEIKPKQ---KTVAAFVLAQLTSNNFKLAQKELTNKGYMGICTELMVD---DTARSVKL-LKLWILIGLGRLWSDYDVARWQGIRLMAHDKMILELSDESAEVRAAAVFALGSLLRNSSRS---NEHASAVEENLAGELCSQCVFDSSVLVREELIVALQWFVFDFEKRFVKFLLELSNQIKFKLPRKRNSSENLSEQGLDIAAEMPSNHRR--PRAPPVNEFMQ------PSVIRKKMSTSVFSTAVEETVHEDGIGNVYHIAHEA------------GN------RVEQESEDIEYRERAKVQIKHLEA----KTFNEAV------AKTWLSLLILSLDPIERVARMAQKIVHRV 1037          

HSP 3 Score: 85.5001 bits (210), Expect = 2.984e-16
Identity = 51/97 (52.58%), Postives = 70/97 (72.16%), Query Frame = 2
Query: 1712 KHTDFFNDHMTAFELWLKTADEKKXXXXXXXXXXXXXXXXXHRYRALRLLSEYMDLGPWAVIQCLTVGIFPYVVRLLQSPVYDVKPYLVFIWGKIIS 2002
            ++  FF + + AFELWL    ++   P+QLP++LQVLLSQ HR RALRLL+ ++D G WA+   L VGIFPYV++LLQS + D+K  L FIW KI++
Sbjct:  472 QYNTFFTEQLQAFELWLDYGVDEGTPPLQLPMVLQVLLSQAHRVRALRLLARFLDFGRWAIGYSLAVGIFPYVLKLLQSNISDLKISLAFIWAKILA 568          

HSP 4 Score: 51.2174 bits (121), Expect = 9.339e-6
Identity = 32/136 (23.53%), Postives = 64/136 (47.06%), Query Frame = 2
Query: 3974 LILVGTMDGRIKIWRNYL----RDMGQDPDIVTAWIALPDQI-CSNRPSGLITHWSQSLGQLTISGDVKYIRLWDSLQECKISD----------------MNTNSESCVSSIDRSQDGRLIVAGFGDGHIKMFDIR 4318
            +++  + +G ++IW  Y      D  + P++V+A   L  Q+  S+  +  +  W+Q  G+L  +G  + +R+WD+  E    D                +NTN+     S +  ++G ++  G+ DG +  FD+R
Sbjct: 1439 MVIACSTNGVVRIWDPYFLGWCDDYEKPPELVSASFPLESQMKISDETNRCLFDWNQQNGKLLCTG-TRSVRIWDAHCEKVCHDVMYSPGSKQQTGPGAKLNTNTLPTAMSGNLDEEGNMVAVGYADGRVDYFDMR 1573          
BLAST of Regulatory-associated protein of mTOR vs. Ensembl Celegans
Match: daf-15 (DAF-15 [Source:UniProtKB/TrEMBL;Acc:Q68TI8])

HSP 1 Score: 296.59 bits (758), Expect = 5.368e-81
Identity = 152/374 (40.64%), Postives = 233/374 (62.30%), Query Frame = 2
Query:  200 DKVRTLHVVLVLCLNLAVDPPDTLVKVSPCSKMEAWFDPKEKNLNRALEMIGKNLQIQYERWQPKA--RYRQSLDPTIEEIHRLCQSLRRSAREDRVLFHYNGHGVPRPTENGEIWVFNKAYTKYIPLSLYDLHSWMGGPTVYVFDCNNAGRIIRMMEQFS-------MKRF------ENNGTANSSSM------------------DNIIILASCQENEDIP-QNPEVPADLFTSCLTTPIKIALHWYLLRNQ--EIFPNYLNETMLELIGGSPSNRVSMFGEINWVFTAVTDTIAWSCLPPPLFQKLFRQDLLVASLFRNFLLAERIMHYYGLRPVSYPPLPKTYEHPMWDAWDHALDCYTSQLPEIYHKKQ 1213
            D++RT  V +++CL+L VDPP+   +    S++ +W DP +   ++A   IG + Q  YE+WQPK+  RY+   DP I+++ ++  +LRR +  DRVLFHYNGHGVP+PT+NGEIWVFNK++T+YIPLS++DL  W+  PT+Y+++ ++A  I+    +F          RF      + N    SS M                  ++ I LA+C   + +P  NP +PADLFTSCLTTPI+ +L ++L  ++  + +P    E +L++I G+ + R ++ GE+NW+FTA+TDTIA++ +    FQKLFRQDLL+A+LFR+FLLA+R+M  + + PVS PPL  T  H +W  WD  +D       E+ + K+
Sbjct:   66 DRLRTASVAIIMCLHLGVDPPEAPSRKDAPSRLLSWVDPYKCGAHKAAIEIGLSTQRAYEKWQPKSKTRYKICTDPPIDDVRKVATNLRRISGNDRVLFHYNGHGVPKPTDNGEIWVFNKSFTQYIPLSIFDLQGWLDYPTIYIWETHSAETILHNYRRFGEDQKISWQSRFDRWQEEQRNLPPISSKMTDADQAEALGFPEKYPRYNDCIHLAACSAGQWLPMSNPHLPADLFTSCLTTPIRTSLAFHLSHSEHRDEYP----ENILDMIPGNLAERRTVLGELNWIFTAITDTIAFTSIDRDSFQKLFRQDLLLATLFRSFLLAQRVMSKFNVLPVSQPPLKDTSMHDLWRCWDQTMDMVLDYCRELIYVKE 435          

HSP 2 Score: 115.161 bits (287), Expect = 3.043e-25
Identity = 99/367 (26.98%), Postives = 174/367 (47.41%), Query Frame = 2
Query: 2051 YKYFVSCLTENE--PYEIIIKTISAFALAKMLNNN-PVGQKLYIKQNFMTVLIEELENNPSDLANDNYIRLRIWFILSFAKLWSDNDDAKWYGVRQQIHEKLLLYLKDISPEVRAATVYALGTFLNNKASDGIRSKHAVQVEQNICQHLLNHSVNDSSPLVRAELVVAMKYMVNLFSNQ----VMSMAIYYDVWLSQNNHGSINDVNNGKFMGPPSPLANRNVMPSRGSIEKISKRLFVHSPPALTDKISVRQKAVSSGDLTNFDENNNTFWLFKDSHIPFILPDMYLYGNINSTRGNLKNLGAELSFRPTF---IKKVPAVSNFTTYNSGFPIINIYAQMWFSLILLSKDPYPKVSILASKIVEAI 3121
            ++YF+  L + E  P +   KT++AF LA++ +NN  + QK    + +M +  E + +   D A    + L++W ++   +LWSD D A+W G+R   H+K++L L D S EVRAA V+ALG+ L N +     ++HA  VE+N+   L +  V DSS LVR EL+VA+++ V  F  +    ++ ++      L +  + S N    G  +    P  +R   P    + +  +      P  +  K+S    + +  +  + D   N + +  ++            GN       ++    ++ +R      IK + A     T+N         A+ W SL++LS DP  +V+ +A KIV  +
Sbjct:  717 FQYFLQLLGDPEIKPKQ---KTVAAFVLAQLTSNNFKLAQKELTNKGYMGICTELMVD---DTARSVKL-LKLWILIGLGRLWSDYDVARWQGIRLMAHDKMILELSDESAEVRAAAVFALGSLLRNSSRS---NEHASAVEENLAGELCSQCVFDSSVLVREELIVALQWFVFDFEKRFVKFLLELSNQIKFKLPRKRNSSENLSEQGLDIAAEMPSNHRR--PRAPPVNEFMQ------PSVIRKKMSTSVFSTAVEETVHEDGIGNVYHIAHEA------------GN------RVEQESEDIEYRERAKVQIKHLEA----KTFNEAV------AKTWLSLLILSLDPIERVARMAQKIVHRV 1037          

HSP 3 Score: 85.5001 bits (210), Expect = 3.033e-16
Identity = 51/97 (52.58%), Postives = 70/97 (72.16%), Query Frame = 2
Query: 1712 KHTDFFNDHMTAFELWLKTADEKKXXXXXXXXXXXXXXXXXHRYRALRLLSEYMDLGPWAVIQCLTVGIFPYVVRLLQSPVYDVKPYLVFIWGKIIS 2002
            ++  FF + + AFELWL    ++   P+QLP++LQVLLSQ HR RALRLL+ ++D G WA+   L VGIFPYV++LLQS + D+K  L FIW KI++
Sbjct:  472 QYNTFFTEQLQAFELWLDYGVDEGTPPLQLPMVLQVLLSQAHRVRALRLLARFLDFGRWAIGYSLAVGIFPYVLKLLQSNISDLKISLAFIWAKILA 568          

HSP 4 Score: 51.2174 bits (121), Expect = 9.257e-6
Identity = 32/136 (23.53%), Postives = 64/136 (47.06%), Query Frame = 2
Query: 3974 LILVGTMDGRIKIWRNYL----RDMGQDPDIVTAWIALPDQI-CSNRPSGLITHWSQSLGQLTISGDVKYIRLWDSLQECKISD----------------MNTNSESCVSSIDRSQDGRLIVAGFGDGHIKMFDIR 4318
            +++  + +G ++IW  Y      D  + P++V+A   L  Q+  S+  +  +  W+Q  G+L  +G  + +R+WD+  E    D                +NTN+     S +  ++G ++  G+ DG +  FD+R
Sbjct: 1433 MVIACSTNGVVRIWDPYFLGWCDDYEKPPELVSASFPLESQMKISDETNRCLFDWNQQNGKLLCTG-TRSVRIWDAHCEKVCHDVMYSPGSKQQTGPGAKLNTNTLPTAMSGNLDEEGNMVAVGYADGRVDYFDMR 1567          
BLAST of Regulatory-associated protein of mTOR vs. Ensembl Celegans
Match: daf-15 (DAF-15 [Source:UniProtKB/TrEMBL;Acc:Q68TI8])

HSP 1 Score: 295.819 bits (756), Expect = 1.022e-80
Identity = 152/377 (40.32%), Postives = 233/377 (61.80%), Query Frame = 2
Query:  200 DKVRTLHVVLVLCLNLAVDPPDTLVKVSPCSKMEAWFDPKEKNLNRALEMIGKNLQIQYERWQPKA-----RYRQSLDPTIEEIHRLCQSLRRSAREDRVLFHYNGHGVPRPTENGEIWVFNKAYTKYIPLSLYDLHSWMGGPTVYVFDCNNAGRIIRMMEQFS-------MKRF------ENNGTANSSSM------------------DNIIILASCQENEDIP-QNPEVPADLFTSCLTTPIKIALHWYLLRNQ--EIFPNYLNETMLELIGGSPSNRVSMFGEINWVFTAVTDTIAWSCLPPPLFQKLFRQDLLVASLFRNFLLAERIMHYYGLRPVSYPPLPKTYEHPMWDAWDHALDCYTSQLPEIYHKKQ 1213
            D++RT  V +++CL+L VDPP+   +    S++ +W DP +   ++A   IG + Q  YE+WQPK+     RY+   DP I+++ ++  +LRR +  DRVLFHYNGHGVP+PT+NGEIWVFNK++T+YIPLS++DL  W+  PT+Y+++ ++A  I+    +F          RF      + N    SS M                  ++ I LA+C   + +P  NP +PADLFTSCLTTPI+ +L ++L  ++  + +P    E +L++I G+ + R ++ GE+NW+FTA+TDTIA++ +    FQKLFRQDLL+A+LFR+FLLA+R+M  + + PVS PPL  T  H +W  WD  +D       E+ + K+
Sbjct:   66 DRLRTASVAIIMCLHLGVDPPEAPSRKDAPSRLLSWVDPYKCGAHKAAIEIGLSTQRAYEKWQPKSKSYRTRYKICTDPPIDDVRKVATNLRRISGNDRVLFHYNGHGVPKPTDNGEIWVFNKSFTQYIPLSIFDLQGWLDYPTIYIWETHSAETILHNYRRFGEDQKISWQSRFDRWQEEQRNLPPISSKMTDADQAEALGFPEKYPRYNDCIHLAACSAGQWLPMSNPHLPADLFTSCLTTPIRTSLAFHLSHSEHRDEYP----ENILDMIPGNLAERRTVLGELNWIFTAITDTIAFTSIDRDSFQKLFRQDLLLATLFRSFLLAQRVMSKFNVLPVSQPPLKDTSMHDLWRCWDQTMDMVLDYCRELIYVKE 438          

HSP 2 Score: 115.546 bits (288), Expect = 2.347e-25
Identity = 99/367 (26.98%), Postives = 174/367 (47.41%), Query Frame = 2
Query: 2051 YKYFVSCLTENE--PYEIIIKTISAFALAKMLNNN-PVGQKLYIKQNFMTVLIEELENNPSDLANDNYIRLRIWFILSFAKLWSDNDDAKWYGVRQQIHEKLLLYLKDISPEVRAATVYALGTFLNNKASDGIRSKHAVQVEQNICQHLLNHSVNDSSPLVRAELVVAMKYMVNLFSNQ----VMSMAIYYDVWLSQNNHGSINDVNNGKFMGPPSPLANRNVMPSRGSIEKISKRLFVHSPPALTDKISVRQKAVSSGDLTNFDENNNTFWLFKDSHIPFILPDMYLYGNINSTRGNLKNLGAELSFRPTF---IKKVPAVSNFTTYNSGFPIINIYAQMWFSLILLSKDPYPKVSILASKIVEAI 3121
            ++YF+  L + E  P +   KT++AF LA++ +NN  + QK    + +M +  E + +   D A    + L++W ++   +LWSD D A+W G+R   H+K++L L D S EVRAA V+ALG+ L N +     ++HA  VE+N+   L +  V DSS LVR EL+VA+++ V  F  +    ++ ++      L +  + S N    G  +    P  +R   P    + +  +      P  +  K+S    + +  +  + D   N + +  ++            GN       ++    ++ +R      IK + A     T+N         A+ W SL++LS DP  +V+ +A KIV  +
Sbjct:  720 FQYFLQLLGDPEIKPKQ---KTVAAFVLAQLTSNNFKLAQKELTNKGYMGICTELMVD---DTARSVKL-LKLWILIGLGRLWSDYDVARWQGIRLMAHDKMILELSDESAEVRAAAVFALGSLLRNSSRS---NEHASAVEENLAGELCSQCVFDSSVLVREELIVALQWFVFDFEKRFVKFLLELSNQIKFKLPRKRNSSENLSEQGLDIAAEMPSNHRR--PRAPPVNEFMQ------PSVIRKKMSTSVFSTAVEETVHEDGIGNVYHIAHEA------------GN------RVEQESEDIEYRERAKVQIKHLEA----KTFNEAV------AKTWLSLLILSLDPIERVARMAQKIVHRV 1040          

HSP 3 Score: 85.5001 bits (210), Expect = 2.887e-16
Identity = 51/97 (52.58%), Postives = 70/97 (72.16%), Query Frame = 2
Query: 1712 KHTDFFNDHMTAFELWLKTADEKKXXXXXXXXXXXXXXXXXHRYRALRLLSEYMDLGPWAVIQCLTVGIFPYVVRLLQSPVYDVKPYLVFIWGKIIS 2002
            ++  FF + + AFELWL    ++   P+QLP++LQVLLSQ HR RALRLL+ ++D G WA+   L VGIFPYV++LLQS + D+K  L FIW KI++
Sbjct:  475 QYNTFFTEQLQAFELWLDYGVDEGTPPLQLPMVLQVLLSQAHRVRALRLLARFLDFGRWAIGYSLAVGIFPYVLKLLQSNISDLKISLAFIWAKILA 571          

HSP 4 Score: 51.2174 bits (121), Expect = 9.108e-6
Identity = 32/136 (23.53%), Postives = 64/136 (47.06%), Query Frame = 2
Query: 3974 LILVGTMDGRIKIWRNYL----RDMGQDPDIVTAWIALPDQI-CSNRPSGLITHWSQSLGQLTISGDVKYIRLWDSLQECKISD----------------MNTNSESCVSSIDRSQDGRLIVAGFGDGHIKMFDIR 4318
            +++  + +G ++IW  Y      D  + P++V+A   L  Q+  S+  +  +  W+Q  G+L  +G  + +R+WD+  E    D                +NTN+     S +  ++G ++  G+ DG +  FD+R
Sbjct: 1442 MVIACSTNGVVRIWDPYFLGWCDDYEKPPELVSASFPLESQMKISDETNRCLFDWNQQNGKLLCTG-TRSVRIWDAHCEKVCHDVMYSPGSKQQTGPGAKLNTNTLPTAMSGNLDEEGNMVAVGYADGRVDYFDMR 1576          
BLAST of Regulatory-associated protein of mTOR vs. Ensembl Celegans
Match: daf-15 (DAF-15 [Source:UniProtKB/TrEMBL;Acc:Q68TI8])

HSP 1 Score: 295.434 bits (755), Expect = 1.225e-80
Identity = 152/377 (40.32%), Postives = 233/377 (61.80%), Query Frame = 2
Query:  200 DKVRTLHVVLVLCLNLAVDPPDTLVKVSPCSKMEAWFDPKEKNLNRALEMIGKNLQIQYERWQPKA-----RYRQSLDPTIEEIHRLCQSLRRSAREDRVLFHYNGHGVPRPTENGEIWVFNKAYTKYIPLSLYDLHSWMGGPTVYVFDCNNAGRIIRMMEQFS-------MKRF------ENNGTANSSSM------------------DNIIILASCQENEDIP-QNPEVPADLFTSCLTTPIKIALHWYLLRNQ--EIFPNYLNETMLELIGGSPSNRVSMFGEINWVFTAVTDTIAWSCLPPPLFQKLFRQDLLVASLFRNFLLAERIMHYYGLRPVSYPPLPKTYEHPMWDAWDHALDCYTSQLPEIYHKKQ 1213
            D++RT  V +++CL+L VDPP+   +    S++ +W DP +   ++A   IG + Q  YE+WQPK+     RY+   DP I+++ ++  +LRR +  DRVLFHYNGHGVP+PT+NGEIWVFNK++T+YIPLS++DL  W+  PT+Y+++ ++A  I+    +F          RF      + N    SS M                  ++ I LA+C   + +P  NP +PADLFTSCLTTPI+ +L ++L  ++  + +P    E +L++I G+ + R ++ GE+NW+FTA+TDTIA++ +    FQKLFRQDLL+A+LFR+FLLA+R+M  + + PVS PPL  T  H +W  WD  +D       E+ + K+
Sbjct:   66 DRLRTASVAIIMCLHLGVDPPEAPSRKDAPSRLLSWVDPYKCGAHKAAIEIGLSTQRAYEKWQPKSKSYRTRYKICTDPPIDDVRKVATNLRRISGNDRVLFHYNGHGVPKPTDNGEIWVFNKSFTQYIPLSIFDLQGWLDYPTIYIWETHSAETILHNYRRFGEDQKISWQSRFDRWQEEQRNLPPISSKMTDADQAEALGFPEKYPRYNDCIHLAACSAGQWLPMSNPHLPADLFTSCLTTPIRTSLAFHLSHSEHRDEYP----ENILDMIPGNLAERRTVLGELNWIFTAITDTIAFTSIDRDSFQKLFRQDLLLATLFRSFLLAQRVMSKFNVLPVSQPPLKDTSMHDLWRCWDQTMDMVLDYCRELIYVKE 438          

HSP 2 Score: 115.161 bits (287), Expect = 2.969e-25
Identity = 99/367 (26.98%), Postives = 174/367 (47.41%), Query Frame = 2
Query: 2051 YKYFVSCLTENE--PYEIIIKTISAFALAKMLNNN-PVGQKLYIKQNFMTVLIEELENNPSDLANDNYIRLRIWFILSFAKLWSDNDDAKWYGVRQQIHEKLLLYLKDISPEVRAATVYALGTFLNNKASDGIRSKHAVQVEQNICQHLLNHSVNDSSPLVRAELVVAMKYMVNLFSNQ----VMSMAIYYDVWLSQNNHGSINDVNNGKFMGPPSPLANRNVMPSRGSIEKISKRLFVHSPPALTDKISVRQKAVSSGDLTNFDENNNTFWLFKDSHIPFILPDMYLYGNINSTRGNLKNLGAELSFRPTF---IKKVPAVSNFTTYNSGFPIINIYAQMWFSLILLSKDPYPKVSILASKIVEAI 3121
            ++YF+  L + E  P +   KT++AF LA++ +NN  + QK    + +M +  E + +   D A    + L++W ++   +LWSD D A+W G+R   H+K++L L D S EVRAA V+ALG+ L N +     ++HA  VE+N+   L +  V DSS LVR EL+VA+++ V  F  +    ++ ++      L +  + S N    G  +    P  +R   P    + +  +      P  +  K+S    + +  +  + D   N + +  ++            GN       ++    ++ +R      IK + A     T+N         A+ W SL++LS DP  +V+ +A KIV  +
Sbjct:  720 FQYFLQLLGDPEIKPKQ---KTVAAFVLAQLTSNNFKLAQKELTNKGYMGICTELMVD---DTARSVKL-LKLWILIGLGRLWSDYDVARWQGIRLMAHDKMILELSDESAEVRAAAVFALGSLLRNSSRS---NEHASAVEENLAGELCSQCVFDSSVLVREELIVALQWFVFDFEKRFVKFLLELSNQIKFKLPRKRNSSENLSEQGLDIAAEMPSNHRR--PRAPPVNEFMQ------PSVIRKKMSTSVFSTAVEETVHEDGIGNVYHIAHEA------------GN------RVEQESEDIEYRERAKVQIKHLEA----KTFNEAV------AKTWLSLLILSLDPIERVARMAQKIVHRV 1040          

HSP 3 Score: 85.5001 bits (210), Expect = 2.958e-16
Identity = 51/97 (52.58%), Postives = 70/97 (72.16%), Query Frame = 2
Query: 1712 KHTDFFNDHMTAFELWLKTADEKKXXXXXXXXXXXXXXXXXHRYRALRLLSEYMDLGPWAVIQCLTVGIFPYVVRLLQSPVYDVKPYLVFIWGKIIS 2002
            ++  FF + + AFELWL    ++   P+QLP++LQVLLSQ HR RALRLL+ ++D G WA+   L VGIFPYV++LLQS + D+K  L FIW KI++
Sbjct:  475 QYNTFFTEQLQAFELWLDYGVDEGTPPLQLPMVLQVLLSQAHRVRALRLLARFLDFGRWAIGYSLAVGIFPYVLKLLQSNISDLKISLAFIWAKILA 571          

HSP 4 Score: 51.2174 bits (121), Expect = 8.583e-6
Identity = 32/136 (23.53%), Postives = 64/136 (47.06%), Query Frame = 2
Query: 3974 LILVGTMDGRIKIWRNYL----RDMGQDPDIVTAWIALPDQI-CSNRPSGLITHWSQSLGQLTISGDVKYIRLWDSLQECKISD----------------MNTNSESCVSSIDRSQDGRLIVAGFGDGHIKMFDIR 4318
            +++  + +G ++IW  Y      D  + P++V+A   L  Q+  S+  +  +  W+Q  G+L  +G  + +R+WD+  E    D                +NTN+     S +  ++G ++  G+ DG +  FD+R
Sbjct: 1436 MVIACSTNGVVRIWDPYFLGWCDDYEKPPELVSASFPLESQMKISDETNRCLFDWNQQNGKLLCTG-TRSVRIWDAHCEKVCHDVMYSPGSKQQTGPGAKLNTNTLPTAMSGNLDEEGNMVAVGYADGRVDYFDMR 1570          
BLAST of Regulatory-associated protein of mTOR vs. Ensembl Fly
Match: raptor (gene:FBgn0029840 transcript:FBtr0345895)

HSP 1 Score: 400.208 bits (1027), Expect = 1.384e-114
Identity = 185/366 (50.55%), Postives = 251/366 (68.58%), Query Frame = 2
Query:  197 KDKVRTLHVVLVLCLNLAVDPPDTLVKVSPCSKMEAWFDPKEKNLNRALEMIGKNLQIQYERWQPKARYRQSLDPTIEEIHRLCQSLRRSAREDRVLFHYNGHGVPRPTENGEIWVFNKAYTKYIPLSLYDLHSWMGGPTVYVFDCNNAGRIIRMMEQFSMKRFE---------------------NNGTANSS-----------SMDNIIILASCQENEDIPQNPEVPADLFTSCLTTPIKIALHWYLLRNQEIFPNYLNETMLELIGGSPSNRVSMFGEINWVFTAVTDTIAWSCLPPPLFQKLFRQDLLVASLFRNFLLAERIMHYYGLRPVSYPPLPKTYEHPMWDAWDHALDCYTSQLPEI 1198
            +++++T  V LVLCLN+ VDPPD +VK+ PCS++E W DP   +  +A+E+IG NLQ+QYERWQP+ARY++  DPT++++ +LC SLRR+A+ +R+LFHYNGHGVP+PT NGEIWVFNK +T+YIPLS+++L +WM  P++YV+DC+NAG II   + ++ +  E                     + G AN +           S  N I LA+C  NE +P N ++PADLFTSCLTTPI IAL WY ++ +      +   +++ I G  ++R +M GE+NW+FTA+TDTIAW+ LP  LFQ+LFRQDLLVASLFRNFLLAERI+  +   PVS P LP  Y HPMW AWD  +D    QLPEI
Sbjct:  211 RERMKTASVALVLCLNIGVDPPD-VVKIQPCSRLECWIDPSSVSPPKAMELIGSNLQMQYERWQPRARYKKCNDPTVDDVKKLCTSLRRNAKGERILFHYNGHGVPKPTANGEIWVFNKTFTQYIPLSIFELITWMSAPSIYVYDCSNAGIIINSFQPYAKQHEEELGKALAAAQQRGGVQQLVGGSGGAANVAANQVQLTNQMVSYKNCIHLAACAANEILPMNAQLPADLFTSCLTTPINIALKWYAMQEKLGMVPRIQSELIDKIPGKVNDRRTMMGELNWIFTAITDTIAWNTLPRELFQRLFRQDLLVASLFRNFLLAERILRSHDCTPVSLPALPPCYRHPMWKAWDLVVDLALQQLPEI 575          

HSP 2 Score: 200.29 bits (508), Expect = 3.383e-51
Identity = 133/343 (38.78%), Postives = 198/343 (57.73%), Query Frame = 2
Query: 1706 PFKHTDFFNDHMTAFELWLKTADEKKXXXXXXXXXXXXXXXXXHRYRALRLLSEYMDLGPWAVIQCLTVGIFPYVVRLLQSPVYDVKPYLVFIWGKIIS---SAQTDFAKNDVVKDAGYKYFVSCLTENEPYEIIIKTISAFALAKMLNNNPVGQKLYIKQNFMTVLIEELENNPSDLANDNYIRLRIWFILSFAKLWSDNDDAKWYGVRQQIHEKLLLYLKDISPEVRAATVYALGTFLNNKASDGIRSKHAVQVEQNICQHLLNHSVNDSSPLVRAELVVAMKYMVNLFSNQVMSMAIYYDVWLSQNNHGSINDVNNGKFMGPPSPLANRNVMPSRGSIEK 2725
            P++   FF   +TAF++WL +  E +  P QLPI+LQVLLSQVHR RAL LL+ ++DLGPWAV   L VGIFPYV++LLQS   +++P LVFIW KI++   S Q D  K        YKYF+S L ++       +T+SAF L+ +++N  +GQ   ++   +++ +E+L        ND    LR W  +    LW + + A+W G R   HEKL + L+D  PEVRAA V+ALGTF+++        + A  +++ I   +L     D SPLVR EL  A+++MV LF +Q      +  V+L+++  G    V+   F+  P P   R++  S  S+E+
Sbjct:  581 PYRQLPFFEHQLTAFQVWLDSESESRTPPEQLPIVLQVLLSQVHRLRALELLARFLDLGPWAVNLALGVGIFPYVLKLLQSSTRELRPVLVFIWAKILAVDPSCQVDLVKE-------YKYFLSVL-QDTSVSKEHRTLSAFVLSSIVHNFLLGQTSALQGPLLSICLEQL--------NDGSWLLRQWLAICLGMLWQNFEKARWSGARDLAHEKLYVLLRDSIPEVRAAAVFALGTFISSVTDRS--EEQANNIDRIIAITMLETVGEDMSPLVRMELAAALQWMVVLFESQ------FVAVYLTEHMRG---HVSAASFVMCPDP---RDLTSSTHSLER 893          
BLAST of Regulatory-associated protein of mTOR vs. Ensembl Fly
Match: raptor (gene:FBgn0029840 transcript:FBtr0332964)

HSP 1 Score: 400.208 bits (1027), Expect = 1.384e-114
Identity = 185/366 (50.55%), Postives = 251/366 (68.58%), Query Frame = 2
Query:  197 KDKVRTLHVVLVLCLNLAVDPPDTLVKVSPCSKMEAWFDPKEKNLNRALEMIGKNLQIQYERWQPKARYRQSLDPTIEEIHRLCQSLRRSAREDRVLFHYNGHGVPRPTENGEIWVFNKAYTKYIPLSLYDLHSWMGGPTVYVFDCNNAGRIIRMMEQFSMKRFE---------------------NNGTANSS-----------SMDNIIILASCQENEDIPQNPEVPADLFTSCLTTPIKIALHWYLLRNQEIFPNYLNETMLELIGGSPSNRVSMFGEINWVFTAVTDTIAWSCLPPPLFQKLFRQDLLVASLFRNFLLAERIMHYYGLRPVSYPPLPKTYEHPMWDAWDHALDCYTSQLPEI 1198
            +++++T  V LVLCLN+ VDPPD +VK+ PCS++E W DP   +  +A+E+IG NLQ+QYERWQP+ARY++  DPT++++ +LC SLRR+A+ +R+LFHYNGHGVP+PT NGEIWVFNK +T+YIPLS+++L +WM  P++YV+DC+NAG II   + ++ +  E                     + G AN +           S  N I LA+C  NE +P N ++PADLFTSCLTTPI IAL WY ++ +      +   +++ I G  ++R +M GE+NW+FTA+TDTIAW+ LP  LFQ+LFRQDLLVASLFRNFLLAERI+  +   PVS P LP  Y HPMW AWD  +D    QLPEI
Sbjct:  211 RERMKTASVALVLCLNIGVDPPD-VVKIQPCSRLECWIDPSSVSPPKAMELIGSNLQMQYERWQPRARYKKCNDPTVDDVKKLCTSLRRNAKGERILFHYNGHGVPKPTANGEIWVFNKTFTQYIPLSIFELITWMSAPSIYVYDCSNAGIIINSFQPYAKQHEEELGKALAAAQQRGGVQQLVGGSGGAANVAANQVQLTNQMVSYKNCIHLAACAANEILPMNAQLPADLFTSCLTTPINIALKWYAMQEKLGMVPRIQSELIDKIPGKVNDRRTMMGELNWIFTAITDTIAWNTLPRELFQRLFRQDLLVASLFRNFLLAERILRSHDCTPVSLPALPPCYRHPMWKAWDLVVDLALQQLPEI 575          

HSP 2 Score: 200.29 bits (508), Expect = 3.383e-51
Identity = 133/343 (38.78%), Postives = 198/343 (57.73%), Query Frame = 2
Query: 1706 PFKHTDFFNDHMTAFELWLKTADEKKXXXXXXXXXXXXXXXXXHRYRALRLLSEYMDLGPWAVIQCLTVGIFPYVVRLLQSPVYDVKPYLVFIWGKIIS---SAQTDFAKNDVVKDAGYKYFVSCLTENEPYEIIIKTISAFALAKMLNNNPVGQKLYIKQNFMTVLIEELENNPSDLANDNYIRLRIWFILSFAKLWSDNDDAKWYGVRQQIHEKLLLYLKDISPEVRAATVYALGTFLNNKASDGIRSKHAVQVEQNICQHLLNHSVNDSSPLVRAELVVAMKYMVNLFSNQVMSMAIYYDVWLSQNNHGSINDVNNGKFMGPPSPLANRNVMPSRGSIEK 2725
            P++   FF   +TAF++WL +  E +  P QLPI+LQVLLSQVHR RAL LL+ ++DLGPWAV   L VGIFPYV++LLQS   +++P LVFIW KI++   S Q D  K        YKYF+S L ++       +T+SAF L+ +++N  +GQ   ++   +++ +E+L        ND    LR W  +    LW + + A+W G R   HEKL + L+D  PEVRAA V+ALGTF+++        + A  +++ I   +L     D SPLVR EL  A+++MV LF +Q      +  V+L+++  G    V+   F+  P P   R++  S  S+E+
Sbjct:  581 PYRQLPFFEHQLTAFQVWLDSESESRTPPEQLPIVLQVLLSQVHRLRALELLARFLDLGPWAVNLALGVGIFPYVLKLLQSSTRELRPVLVFIWAKILAVDPSCQVDLVKE-------YKYFLSVL-QDTSVSKEHRTLSAFVLSSIVHNFLLGQTSALQGPLLSICLEQL--------NDGSWLLRQWLAICLGMLWQNFEKARWSGARDLAHEKLYVLLRDSIPEVRAAAVFALGTFISSVTDRS--EEQANNIDRIIAITMLETVGEDMSPLVRMELAAALQWMVVLFESQ------FVAVYLTEHMRG---HVSAASFVMCPDP---RDLTSSTHSLER 893          
BLAST of Regulatory-associated protein of mTOR vs. Ensembl Zebrafish
Match: rptor (regulatory associated protein of MTOR, complex 1 [Source:ZFIN;Acc:ZDB-GENE-130530-685])

HSP 1 Score: 434.491 bits (1116), Expect = 1.250e-127
Identity = 208/385 (54.03%), Postives = 268/385 (69.61%), Query Frame = 2
Query:  110 DKSYPFVAFKARHLNXXXXXXXXXXXXXXKDKVRTLHVVLVLCLNLAVDPPDTLVKVSPCSKMEAWFDPKEKNLNRALEMIGKNLQIQYERWQPKARYRQSLDPTIEEIHRLCQSLRRSAREDRVLFHYNGHGVPRPTENGEIWVFNKAYTKYIPLSLYDLHSWMGGPTVYVFDCNNAGRIIRMMEQFSMKRFENNGTAN------------SSSMDNIIILASCQENEDIPQNPEVPADLFTSCLTTPIKIALHWYLLRNQEIFPNYLNETMLELIGGSPSNRVSMFGEINWVFTAVTDTIAWSCLPPPLFQKLFRQDLLVASLFRNFLLAERIMHYYGLRPVSYPPLPKTYEHPMWDAWDHALDCYTSQLPEIYHKKQSMNNS 1228
            D + P    K RH  +      L +    KD+++T+ V LVLCLN+ VDPPD +VK SPC+++E W DP   +  +ALE IG NLQ QYE WQP+ARY+QSLDPT++E+ +LC SLRR+A+E+RVLFHYNGHGVPRPT NGEIWVFNK YT+YIPLS+YDL +WMG P+++V+DC+NAG I++  +QF+++R +    A               SM N I LA+C  +E +P NP++PADLFTSCLTTPIKIAL W+ ++        +   ++E I G  ++R +  GE+NW+FTA+TDTIAW+ LP  LFQKLFRQDLLVASLFRNFLLAERIM  Y   PVS P LP TY H MW AWD A+D   SQLP I  +  +  +S
Sbjct:   25 DWNLPLAFMKKRHTEKIEGYKALAQSWRMKDRMKTVSVALVLCLNVGVDPPD-VVKTSPCARLECWIDPLSMSPQKALETIGANLQKQYENWQPRARYKQSLDPTVDEVKKLCTSLRRNAKEERVLFHYNGHGVPRPTVNGEIWVFNKNYTQYIPLSVYDLQTWMGSPSIFVYDCSNAGIIVKSFKQFALQREQELEVAAINPNHPLAQMPLPPSMKNCIQLAACDASELLPMNPDLPADLFTSCLTTPIKIALRWFCMQKSAKLVPGVTLDLIEKIPGRLNDRRTPLGELNWIFTAITDTIAWNVLPRDLFQKLFRQDLLVASLFRNFLLAERIMRSYNCTPVSSPRLPPTYMHAMWQAWDLAVDICLSQLPTIIEEGTAFRHS 408          

HSP 2 Score: 237.654 bits (605), Expect = 8.856e-63
Identity = 182/522 (34.87%), Postives = 277/522 (53.07%), Query Frame = 2
Query: 1709 FKHTDFFNDHMTAFELWLKTADEKKXXXXXXXXXXXXXXXXXHRYRALRLLSEYMDLGPWAVIQCLTVGIFPYVVRLLQSPVYDVKPYLVFIWGKIISSAQTDFAKNDVVKDAGYKYFVSCLTEN-EPYEIIIKTISAFALAKMLNNNPVGQKLYIKQNFMTVLIEELENNPSDLANDNYIRLRIWFILSFAKLWSDNDDAKWYGVRQQIHEKLLLYLKDISPEVRAATVYALGTFLNNKASDGIRSKHAVQVEQNICQHLLNHSVNDSSPLVRAELVVAMKYMVNLFSNQVMSMAIYYDVWLSQNNHGSINDVNNGKFMGPPSPLANRNVMPSRGSIEKISKRLFVHSPPALTDKISVRQKAVSSGDLTNFDENNNTFWLFKDSHIPFILPDMYLYGNINSTRGNLKNLGAE------LSFRPTFIKKVPAVSNFTTYNS--GFPIINIYAQMWFSLILLSKDPYPKVSILASKIVEAINLYKKITQKSESNELNQQNTDFQISPKLNCSPAQFIQPIHSA 3247
            F+H+ FF + +TAF++WL    E +  P QLPI+LQVLLSQVHR RAL LL  ++DLGPWAV   L+VGIFPYV++LLQS   +++P LVFIW KI++   +   + D+VKD G+KYF+S L +   P E   +T++ F LA ++NN   GQ+  ++ N + + +E+L        ND +  LR W  +   ++W + D A+W GVR   HEKL   L D  PEVR A V+ALGTF+ N A    R+ H+  ++ N+   +L   +ND SP+VR ELVVA+ ++V  + +   ++A+ +           + +  N     P +     N+ PSR S   I +   V+S   L    + R    S  +L N +E                 P  +  GN++++      LG+       LSF    I K+  VS++++ NS  G    ++Y Q+W  L+ L+ DP+P VS LA K++ +I    K T  + +  +    +  Q +P    SP      IH A
Sbjct:  405 FRHSPFFAEQLTAFQVWLSMGVENRNPPEQLPIVLQVLLSQVHRLRALDLLGRFLDLGPWAVSLALSVGIFPYVLKLLQSSARELRPLLVFIWAKILAVDSS--CQADLVKDNGHKYFLSVLADPFMPAE--HRTMAVFILAVIVNNYNTGQEACLQGNLIAICLEQL--------NDPHPLLRQWVAICLGRIWQNYDSARWCGVRDSAHEKLYSLLSDSIPEVRCAAVFALGTFVGNSAE---RTDHSTTIDHNVAM-MLAQLINDGSPIVRKELVVALSHLVVQYESNFCTVALQF-----------MEEEKNYAVPSPANSTETGNITPSRDS-PAIPRLRSVNSYTNLRAATTARTLNKSLQNL-NLNEEGG--------------PAAFSPGNLSTSSSASSTLGSPDNDEYLLSFET--IDKMRRVSSYSSLNSLIGVSFNSVYTQIWRVLLHLAADPFPDVSDLAMKVLNSIAY--KATMNARTQRILDSGSLTQSAP---ASPTSKGTLIHQA 876          

HSP 3 Score: 136.732 bits (343), Expect = 1.181e-31
Identity = 107/429 (24.94%), Postives = 180/429 (41.96%), Query Frame = 2
Query: 3632 RNERLKKQ-KNIKLEGAQNWKASLNSSGTQLS-QIFLQKIDSKPELLKFHPYLNYLAVVDRSGVSLWNWESGQRAQYMLSQSVSCKXXXXXXXXXXXXXXXXXXLEFINAEEDRGGLILVGTMDGRIKIWRNYLRDMGQDPDIVTAWIALPDQICSNRP----------------SGLITHWSQSLGQLTISGDVKYIRLWDSLQECKISDMNTNSESCVSSIDRSQDGRLIVAGFGDGHIKMFDIRAPVNECVINAGVGDMGWIHKVAYS-DSTNQVYSIGIYGELTTWCVRQRNLPKPYITPSRRPNPLRNTQNVDIDPKATSREGLLKDPFTSDSKLTLAKSINHSLKLQPVHCADLRVSSESDKEHLAVIGYGKESRGILTAIAPTGSINSNFKYFEGFSRANIEAPTSVCVHPYQTLVGAGLED 4861
            RN R++KQ + I   G            T+L  QIF+ +    P ++KFHP+   +AV D+  +  W+WE G+R  Y  + +                   IT++E++N  +    L+L  T DG ++IW+N+     ++P++VTAW  L D + + R                 +G++  W Q  G L  SGDV+ IR+WD+ +E K+ D+ T ++SCV+S+       L+ AG GDG ++++D R   NEC +        W+ K     +    + S+ + G++             +  P R P  +   Q V         +GL        + L    S+N  +    VH ++                               G + SN KY++GF    I A + +  HP+   +  G  D
Sbjct: 1007 RNARVRKQSQRITQRGV-----------TRLDDQIFINRNPGVPSVVKFHPFNPCIAVADKDSICFWDWEKGERLDYFYNGN--------------PRYTRITAMEYLNGHD--CSLLLTATDDGALRIWKNFADQ--RNPEMVTAWQGLSDMLPTTRGLARRVSIYLDRSKQGGAGMVVDWEQETGLLMTSGDVRVIRIWDTEREIKVQDIPTGADSCVTSLSCDPQRSLVAAGLGDGSVRVYDRRMGPNECRVMTYREHGAWVVKAHLQKEPEGHIISVSVNGDVR------------FFDP-RMPESVNTLQTV---------KGLTALDIHPQANLFACGSMNQFIA---VHNSN-------------------------------GDVISNIKYYDGFMGQRIGAISCLAFHPFWPHLAVGSND 1350          
BLAST of Regulatory-associated protein of mTOR vs. Ensembl Zebrafish
Match: rptor (regulatory associated protein of MTOR, complex 1 [Source:ZFIN;Acc:ZDB-GENE-130530-685])

HSP 1 Score: 434.491 bits (1116), Expect = 1.250e-127
Identity = 208/385 (54.03%), Postives = 268/385 (69.61%), Query Frame = 2
Query:  110 DKSYPFVAFKARHLNXXXXXXXXXXXXXXKDKVRTLHVVLVLCLNLAVDPPDTLVKVSPCSKMEAWFDPKEKNLNRALEMIGKNLQIQYERWQPKARYRQSLDPTIEEIHRLCQSLRRSAREDRVLFHYNGHGVPRPTENGEIWVFNKAYTKYIPLSLYDLHSWMGGPTVYVFDCNNAGRIIRMMEQFSMKRFENNGTAN------------SSSMDNIIILASCQENEDIPQNPEVPADLFTSCLTTPIKIALHWYLLRNQEIFPNYLNETMLELIGGSPSNRVSMFGEINWVFTAVTDTIAWSCLPPPLFQKLFRQDLLVASLFRNFLLAERIMHYYGLRPVSYPPLPKTYEHPMWDAWDHALDCYTSQLPEIYHKKQSMNNS 1228
            D + P    K RH  +      L +    KD+++T+ V LVLCLN+ VDPPD +VK SPC+++E W DP   +  +ALE IG NLQ QYE WQP+ARY+QSLDPT++E+ +LC SLRR+A+E+RVLFHYNGHGVPRPT NGEIWVFNK YT+YIPLS+YDL +WMG P+++V+DC+NAG I++  +QF+++R +    A               SM N I LA+C  +E +P NP++PADLFTSCLTTPIKIAL W+ ++        +   ++E I G  ++R +  GE+NW+FTA+TDTIAW+ LP  LFQKLFRQDLLVASLFRNFLLAERIM  Y   PVS P LP TY H MW AWD A+D   SQLP I  +  +  +S
Sbjct:   25 DWNLPLAFMKKRHTEKIEGYKALAQSWRMKDRMKTVSVALVLCLNVGVDPPD-VVKTSPCARLECWIDPLSMSPQKALETIGANLQKQYENWQPRARYKQSLDPTVDEVKKLCTSLRRNAKEERVLFHYNGHGVPRPTVNGEIWVFNKNYTQYIPLSVYDLQTWMGSPSIFVYDCSNAGIIVKSFKQFALQREQELEVAAINPNHPLAQMPLPPSMKNCIQLAACDASELLPMNPDLPADLFTSCLTTPIKIALRWFCMQKSAKLVPGVTLDLIEKIPGRLNDRRTPLGELNWIFTAITDTIAWNVLPRDLFQKLFRQDLLVASLFRNFLLAERIMRSYNCTPVSSPRLPPTYMHAMWQAWDLAVDICLSQLPTIIEEGTAFRHS 408          

HSP 2 Score: 237.654 bits (605), Expect = 8.856e-63
Identity = 182/522 (34.87%), Postives = 277/522 (53.07%), Query Frame = 2
Query: 1709 FKHTDFFNDHMTAFELWLKTADEKKXXXXXXXXXXXXXXXXXHRYRALRLLSEYMDLGPWAVIQCLTVGIFPYVVRLLQSPVYDVKPYLVFIWGKIISSAQTDFAKNDVVKDAGYKYFVSCLTEN-EPYEIIIKTISAFALAKMLNNNPVGQKLYIKQNFMTVLIEELENNPSDLANDNYIRLRIWFILSFAKLWSDNDDAKWYGVRQQIHEKLLLYLKDISPEVRAATVYALGTFLNNKASDGIRSKHAVQVEQNICQHLLNHSVNDSSPLVRAELVVAMKYMVNLFSNQVMSMAIYYDVWLSQNNHGSINDVNNGKFMGPPSPLANRNVMPSRGSIEKISKRLFVHSPPALTDKISVRQKAVSSGDLTNFDENNNTFWLFKDSHIPFILPDMYLYGNINSTRGNLKNLGAE------LSFRPTFIKKVPAVSNFTTYNS--GFPIINIYAQMWFSLILLSKDPYPKVSILASKIVEAINLYKKITQKSESNELNQQNTDFQISPKLNCSPAQFIQPIHSA 3247
            F+H+ FF + +TAF++WL    E +  P QLPI+LQVLLSQVHR RAL LL  ++DLGPWAV   L+VGIFPYV++LLQS   +++P LVFIW KI++   +   + D+VKD G+KYF+S L +   P E   +T++ F LA ++NN   GQ+  ++ N + + +E+L        ND +  LR W  +   ++W + D A+W GVR   HEKL   L D  PEVR A V+ALGTF+ N A    R+ H+  ++ N+   +L   +ND SP+VR ELVVA+ ++V  + +   ++A+ +           + +  N     P +     N+ PSR S   I +   V+S   L    + R    S  +L N +E                 P  +  GN++++      LG+       LSF    I K+  VS++++ NS  G    ++Y Q+W  L+ L+ DP+P VS LA K++ +I    K T  + +  +    +  Q +P    SP      IH A
Sbjct:  405 FRHSPFFAEQLTAFQVWLSMGVENRNPPEQLPIVLQVLLSQVHRLRALDLLGRFLDLGPWAVSLALSVGIFPYVLKLLQSSARELRPLLVFIWAKILAVDSS--CQADLVKDNGHKYFLSVLADPFMPAE--HRTMAVFILAVIVNNYNTGQEACLQGNLIAICLEQL--------NDPHPLLRQWVAICLGRIWQNYDSARWCGVRDSAHEKLYSLLSDSIPEVRCAAVFALGTFVGNSAE---RTDHSTTIDHNVAM-MLAQLINDGSPIVRKELVVALSHLVVQYESNFCTVALQF-----------MEEEKNYAVPSPANSTETGNITPSRDS-PAIPRLRSVNSYTNLRAATTARTLNKSLQNL-NLNEEGG--------------PAAFSPGNLSTSSSASSTLGSPDNDEYLLSFET--IDKMRRVSSYSSLNSLIGVSFNSVYTQIWRVLLHLAADPFPDVSDLAMKVLNSIAY--KATMNARTQRILDSGSLTQSAP---ASPTSKGTLIHQA 876          

HSP 3 Score: 136.732 bits (343), Expect = 1.181e-31
Identity = 107/429 (24.94%), Postives = 180/429 (41.96%), Query Frame = 2
Query: 3632 RNERLKKQ-KNIKLEGAQNWKASLNSSGTQLS-QIFLQKIDSKPELLKFHPYLNYLAVVDRSGVSLWNWESGQRAQYMLSQSVSCKXXXXXXXXXXXXXXXXXXLEFINAEEDRGGLILVGTMDGRIKIWRNYLRDMGQDPDIVTAWIALPDQICSNRP----------------SGLITHWSQSLGQLTISGDVKYIRLWDSLQECKISDMNTNSESCVSSIDRSQDGRLIVAGFGDGHIKMFDIRAPVNECVINAGVGDMGWIHKVAYS-DSTNQVYSIGIYGELTTWCVRQRNLPKPYITPSRRPNPLRNTQNVDIDPKATSREGLLKDPFTSDSKLTLAKSINHSLKLQPVHCADLRVSSESDKEHLAVIGYGKESRGILTAIAPTGSINSNFKYFEGFSRANIEAPTSVCVHPYQTLVGAGLED 4861
            RN R++KQ + I   G            T+L  QIF+ +    P ++KFHP+   +AV D+  +  W+WE G+R  Y  + +                   IT++E++N  +    L+L  T DG ++IW+N+     ++P++VTAW  L D + + R                 +G++  W Q  G L  SGDV+ IR+WD+ +E K+ D+ T ++SCV+S+       L+ AG GDG ++++D R   NEC +        W+ K     +    + S+ + G++             +  P R P  +   Q V         +GL        + L    S+N  +    VH ++                               G + SN KY++GF    I A + +  HP+   +  G  D
Sbjct: 1007 RNARVRKQSQRITQRGV-----------TRLDDQIFINRNPGVPSVVKFHPFNPCIAVADKDSICFWDWEKGERLDYFYNGN--------------PRYTRITAMEYLNGHD--CSLLLTATDDGALRIWKNFADQ--RNPEMVTAWQGLSDMLPTTRGLARRVSIYLDRSKQGGAGMVVDWEQETGLLMTSGDVRVIRIWDTEREIKVQDIPTGADSCVTSLSCDPQRSLVAAGLGDGSVRVYDRRMGPNECRVMTYREHGAWVVKAHLQKEPEGHIISVSVNGDVR------------FFDP-RMPESVNTLQTV---------KGLTALDIHPQANLFACGSMNQFIA---VHNSN-------------------------------GDVISNIKYYDGFMGQRIGAISCLAFHPFWPHLAVGSND 1350          
BLAST of Regulatory-associated protein of mTOR vs. Ensembl Zebrafish
Match: rptor (regulatory associated protein of MTOR, complex 1 [Source:ZFIN;Acc:ZDB-GENE-130530-685])

HSP 1 Score: 434.106 bits (1115), Expect = 1.252e-127
Identity = 208/385 (54.03%), Postives = 268/385 (69.61%), Query Frame = 2
Query:  110 DKSYPFVAFKARHLNXXXXXXXXXXXXXXKDKVRTLHVVLVLCLNLAVDPPDTLVKVSPCSKMEAWFDPKEKNLNRALEMIGKNLQIQYERWQPKARYRQSLDPTIEEIHRLCQSLRRSAREDRVLFHYNGHGVPRPTENGEIWVFNKAYTKYIPLSLYDLHSWMGGPTVYVFDCNNAGRIIRMMEQFSMKRFENNGTAN------------SSSMDNIIILASCQENEDIPQNPEVPADLFTSCLTTPIKIALHWYLLRNQEIFPNYLNETMLELIGGSPSNRVSMFGEINWVFTAVTDTIAWSCLPPPLFQKLFRQDLLVASLFRNFLLAERIMHYYGLRPVSYPPLPKTYEHPMWDAWDHALDCYTSQLPEIYHKKQSMNNS 1228
            D + P    K RH  +      L +    KD+++T+ V LVLCLN+ VDPPD +VK SPC+++E W DP   +  +ALE IG NLQ QYE WQP+ARY+QSLDPT++E+ +LC SLRR+A+E+RVLFHYNGHGVPRPT NGEIWVFNK YT+YIPLS+YDL +WMG P+++V+DC+NAG I++  +QF+++R +    A               SM N I LA+C  +E +P NP++PADLFTSCLTTPIKIAL W+ ++        +   ++E I G  ++R +  GE+NW+FTA+TDTIAW+ LP  LFQKLFRQDLLVASLFRNFLLAERIM  Y   PVS P LP TY H MW AWD A+D   SQLP I  +  +  +S
Sbjct:   25 DWNLPLAFMKKRHTEKIEGYKALAQSWRMKDRMKTVSVALVLCLNVGVDPPD-VVKTSPCARLECWIDPLSMSPQKALETIGANLQKQYENWQPRARYKQSLDPTVDEVKKLCTSLRRNAKEERVLFHYNGHGVPRPTVNGEIWVFNKNYTQYIPLSVYDLQTWMGSPSIFVYDCSNAGIIVKSFKQFALQREQELEVAAINPNHPLAQMPLPPSMKNCIQLAACDASELLPMNPDLPADLFTSCLTTPIKIALRWFCMQKSAKLVPGVTLDLIEKIPGRLNDRRTPLGELNWIFTAITDTIAWNVLPRDLFQKLFRQDLLVASLFRNFLLAERIMRSYNCTPVSSPRLPPTYMHAMWQAWDLAVDICLSQLPTIIEEGTAFRHS 408          

HSP 2 Score: 237.654 bits (605), Expect = 9.737e-63
Identity = 182/522 (34.87%), Postives = 277/522 (53.07%), Query Frame = 2
Query: 1709 FKHTDFFNDHMTAFELWLKTADEKKXXXXXXXXXXXXXXXXXHRYRALRLLSEYMDLGPWAVIQCLTVGIFPYVVRLLQSPVYDVKPYLVFIWGKIISSAQTDFAKNDVVKDAGYKYFVSCLTEN-EPYEIIIKTISAFALAKMLNNNPVGQKLYIKQNFMTVLIEELENNPSDLANDNYIRLRIWFILSFAKLWSDNDDAKWYGVRQQIHEKLLLYLKDISPEVRAATVYALGTFLNNKASDGIRSKHAVQVEQNICQHLLNHSVNDSSPLVRAELVVAMKYMVNLFSNQVMSMAIYYDVWLSQNNHGSINDVNNGKFMGPPSPLANRNVMPSRGSIEKISKRLFVHSPPALTDKISVRQKAVSSGDLTNFDENNNTFWLFKDSHIPFILPDMYLYGNINSTRGNLKNLGAE------LSFRPTFIKKVPAVSNFTTYNS--GFPIINIYAQMWFSLILLSKDPYPKVSILASKIVEAINLYKKITQKSESNELNQQNTDFQISPKLNCSPAQFIQPIHSA 3247
            F+H+ FF + +TAF++WL    E +  P QLPI+LQVLLSQVHR RAL LL  ++DLGPWAV   L+VGIFPYV++LLQS   +++P LVFIW KI++   +   + D+VKD G+KYF+S L +   P E   +T++ F LA ++NN   GQ+  ++ N + + +E+L        ND +  LR W  +   ++W + D A+W GVR   HEKL   L D  PEVR A V+ALGTF+ N A    R+ H+  ++ N+   +L   +ND SP+VR ELVVA+ ++V  + +   ++A+ +           + +  N     P +     N+ PSR S   I +   V+S   L    + R    S  +L N +E                 P  +  GN++++      LG+       LSF    I K+  VS++++ NS  G    ++Y Q+W  L+ L+ DP+P VS LA K++ +I    K T  + +  +    +  Q +P    SP      IH A
Sbjct:  405 FRHSPFFAEQLTAFQVWLSMGVENRNPPEQLPIVLQVLLSQVHRLRALDLLGRFLDLGPWAVSLALSVGIFPYVLKLLQSSARELRPLLVFIWAKILAVDSS--CQADLVKDNGHKYFLSVLADPFMPAE--HRTMAVFILAVIVNNYNTGQEACLQGNLIAICLEQL--------NDPHPLLRQWVAICLGRIWQNYDSARWCGVRDSAHEKLYSLLSDSIPEVRCAAVFALGTFVGNSAE---RTDHSTTIDHNVAM-MLAQLINDGSPIVRKELVVALSHLVVQYESNFCTVALQF-----------MEEEKNYAVPSPANSTETGNITPSRDS-PAIPRLRSVNSYTNLRAATTARTLNKSLQNL-NLNEEGG--------------PAAFSPGNLSTSSSASSTLGSPDNDEYLLSFET--IDKMRRVSSYSSLNSLIGVSFNSVYTQIWRVLLHLAADPFPDVSDLAMKVLNSIAY--KATMNARTQRILDSGSLTQSAP---ASPTSKGTLIHQA 876          

HSP 3 Score: 147.132 bits (370), Expect = 7.868e-35
Identity = 107/413 (25.91%), Postives = 180/413 (43.58%), Query Frame = 2
Query: 3632 RNERLKKQ-KNIKLEGAQNWKASLNSSGTQLS-QIFLQKIDSKPELLKFHPYLNYLAVVDRSGVSLWNWESGQRAQYMLSQSVSCKXXXXXXXXXXXXXXXXXXLEFINAEEDRGGLILVGTMDGRIKIWRNYLRDMGQDPDIVTAWIALPDQICSNRPSGLITHWSQSLGQLTISGDVKYIRLWDSLQECKISDMNTNSESCVSSIDRSQDGRLIVAGFGDGHIKMFDIRAPVNECVINAGVGDMGWIHKVAYS-DSTNQVYSIGIYGELTTWCVRQRNLPKPYITPSRRPNPLRNTQNVDIDPKATSREGLLKDPFTSDSKLTLAKSINHSLKLQPVHCADLRVSSESDKEHLAVIGYGKESRGILTAIAPTGSINSNFKYFEGFSRANIEAPTSVCVHPYQTLVGAGLED 4861
            RN R++KQ + I   G            T+L  QIF+ +    P ++KFHP+   +AV D+  +  W+WE G+R  Y  + +                   IT++E++N  +    L+L  T DG ++IW+N+     ++P++VTAW  L D + + R +G++  W Q  G L  SGDV+ IR+WD+ +E K+ D+ T ++SCV+S+       L+ AG GDG ++++D R   NEC +        W+ K     +    + S+ + G++             +  P R P  +   Q V         +GL        + L    S+N  +    VH ++                               G + SN KY++GF    I A + +  HP+   +  G  D
Sbjct: 1007 RNARVRKQSQRITQRGV-----------TRLDDQIFINRNPGVPSVVKFHPFNPCIAVADKDSICFWDWEKGERLDYFYNGN--------------PRYTRITAMEYLNGHD--CSLLLTATDDGALRIWKNFADQ--RNPEMVTAWQGLSDMLPTTRGAGMVVDWEQETGLLMTSGDVRVIRIWDTEREIKVQDIPTGADSCVTSLSCDPQRSLVAAGLGDGSVRVYDRRMGPNECRVMTYREHGAWVVKAHLQKEPEGHIISVSVNGDVR------------FFDP-RMPESVNTLQTV---------KGLTALDIHPQANLFACGSMNQFIA---VHNSN-------------------------------GDVISNIKYYDGFMGQRIGAISCLAFHPFWPHLAVGSND 1334          
BLAST of Regulatory-associated protein of mTOR vs. Ensembl Zebrafish
Match: rptor (regulatory associated protein of MTOR, complex 1 [Source:ZFIN;Acc:ZDB-GENE-130530-685])

HSP 1 Score: 361.303 bits (926), Expect = 9.398e-103
Identity = 187/375 (49.87%), Postives = 233/375 (62.13%), Query Frame = 2
Query:  110 DKSYPFVAFKARHLNXXXXXXXXXXXXXXKDKVRTLHVVLVLCLNLAVDPPDTLVKVSPCSKMEAWFDPKEKNLNRALEMIGKNLQIQYERWQPKARYRQSLDPTIEEIHRLCQSLRRSAREDRVLFHYNGHGVPRPTENGEIWVFNK--AYTKYIPLSLYDLHSWMGGPTVYVFDCNNAGRIIRMMEQFSMKRFENNGTANSSSMDNIIILASCQENEDIPQNPEVPADLFTSCLTTPIKIALHWYLLRNQEIFPNYLNETMLELIGGSPSNRVSMFGEINWVFTAVTDTIAWSCLPPPLFQKLFRQDLLVASLFRNFLLAERIMHYYGLRPVSYPPLPKTYEHPMWDAWDHALDCYTSQLPEIYHKKQSMNNS 1228
            D + P    K RH  +      L +    KD+++T+ V LVLCLN+ VDPPD +VK SPC+++E W DP   +  +ALE IG NLQ QYE WQP+ARY+QSLDPT++E+ +LC SLRR+A+E+RVLFHYNGHGVPRPT NGEIWVFNK  A     PL+   L                                         SM N I LA+C  +E +P NP++PADLFTSCLTTPIKIAL W+ ++        +   ++E I G  ++R +  GE+NW+FTA+TDTIAW+ LP  LFQKLFRQDLLVASLFRNFLLAERIM  Y   PVS P LP TY H MW AWD A+D   SQLP I  +  +  +S
Sbjct:   25 DWNLPLAFMKKRHTEKIEGYKALAQSWRMKDRMKTVSVALVLCLNVGVDPPD-VVKTSPCARLECWIDPLSMSPQKALETIGANLQKQYENWQPRARYKQSLDPTVDEVKKLCTSLRRNAKEERVLFHYNGHGVPRPTVNGEIWVFNKVAAINPNHPLAQMPL---------------------------------------PPSMKNCIQLAACDASELLPMNPDLPADLFTSCLTTPIKIALRWFCMQKSAKLVPGVTLDLIEKIPGRLNDRRTPLGELNWIFTAITDTIAWNVLPRDLFQKLFRQDLLVASLFRNFLLAERIMRSYNCTPVSSPRLPPTYMHAMWQAWDLAVDICLSQLPTIIEEGTAFRHS 359          

HSP 2 Score: 238.424 bits (607), Expect = 5.120e-63
Identity = 182/522 (34.87%), Postives = 277/522 (53.07%), Query Frame = 2
Query: 1709 FKHTDFFNDHMTAFELWLKTADEKKXXXXXXXXXXXXXXXXXHRYRALRLLSEYMDLGPWAVIQCLTVGIFPYVVRLLQSPVYDVKPYLVFIWGKIISSAQTDFAKNDVVKDAGYKYFVSCLTEN-EPYEIIIKTISAFALAKMLNNNPVGQKLYIKQNFMTVLIEELENNPSDLANDNYIRLRIWFILSFAKLWSDNDDAKWYGVRQQIHEKLLLYLKDISPEVRAATVYALGTFLNNKASDGIRSKHAVQVEQNICQHLLNHSVNDSSPLVRAELVVAMKYMVNLFSNQVMSMAIYYDVWLSQNNHGSINDVNNGKFMGPPSPLANRNVMPSRGSIEKISKRLFVHSPPALTDKISVRQKAVSSGDLTNFDENNNTFWLFKDSHIPFILPDMYLYGNINSTRGNLKNLGAE------LSFRPTFIKKVPAVSNFTTYNS--GFPIINIYAQMWFSLILLSKDPYPKVSILASKIVEAINLYKKITQKSESNELNQQNTDFQISPKLNCSPAQFIQPIHSA 3247
            F+H+ FF + +TAF++WL    E +  P QLPI+LQVLLSQVHR RAL LL  ++DLGPWAV   L+VGIFPYV++LLQS   +++P LVFIW KI++   +   + D+VKD G+KYF+S L +   P E   +T++ F LA ++NN   GQ+  ++ N + + +E+L        ND +  LR W  +   ++W + D A+W GVR   HEKL   L D  PEVR A V+ALGTF+ N A    R+ H+  ++ N+   +L   +ND SP+VR ELVVA+ ++V  + +   ++A+ +           + +  N     P +     N+ PSR S   I +   V+S   L    + R    S  +L N +E                 P  +  GN++++      LG+       LSF    I K+  VS++++ NS  G    ++Y Q+W  L+ L+ DP+P VS LA K++ +I    K T  + +  +    +  Q +P    SP      IH A
Sbjct:  356 FRHSPFFAEQLTAFQVWLSMGVENRNPPEQLPIVLQVLLSQVHRLRALDLLGRFLDLGPWAVSLALSVGIFPYVLKLLQSSARELRPLLVFIWAKILAVDSS--CQADLVKDNGHKYFLSVLADPFMPAE--HRTMAVFILAVIVNNYNTGQEACLQGNLIAICLEQL--------NDPHPLLRQWVAICLGRIWQNYDSARWCGVRDSAHEKLYSLLSDSIPEVRCAAVFALGTFVGNSAE---RTDHSTTIDHNVAM-MLAQLINDGSPIVRKELVVALSHLVVQYESNFCTVALQF-----------MEEEKNYAVPSPANSTETGNITPSRDS-PAIPRLRSVNSYTNLRAATTARTLNKSLQNL-NLNEEGG--------------PAAFSPGNLSTSSSASSTLGSPDNDEYLLSFE--TIDKMRRVSSYSSLNSLIGVSFNSVYTQIWRVLLHLAADPFPDVSDLAMKVLNSIAY--KATMNARTQRILDSGSLTQSAP---ASPTSKGTLIHQA 827          

HSP 3 Score: 137.117 bits (344), Expect = 9.585e-32
Identity = 107/429 (24.94%), Postives = 180/429 (41.96%), Query Frame = 2
Query: 3632 RNERLKKQ-KNIKLEGAQNWKASLNSSGTQLS-QIFLQKIDSKPELLKFHPYLNYLAVVDRSGVSLWNWESGQRAQYMLSQSVSCKXXXXXXXXXXXXXXXXXXLEFINAEEDRGGLILVGTMDGRIKIWRNYLRDMGQDPDIVTAWIALPDQICSNRP----------------SGLITHWSQSLGQLTISGDVKYIRLWDSLQECKISDMNTNSESCVSSIDRSQDGRLIVAGFGDGHIKMFDIRAPVNECVINAGVGDMGWIHKVAYS-DSTNQVYSIGIYGELTTWCVRQRNLPKPYITPSRRPNPLRNTQNVDIDPKATSREGLLKDPFTSDSKLTLAKSINHSLKLQPVHCADLRVSSESDKEHLAVIGYGKESRGILTAIAPTGSINSNFKYFEGFSRANIEAPTSVCVHPYQTLVGAGLED 4861
            RN R++KQ + I   G            T+L  QIF+ +    P ++KFHP+   +AV D+  +  W+WE G+R  Y  + +                   IT++E++N  +    L+L  T DG ++IW+N+     ++P++VTAW  L D + + R                 +G++  W Q  G L  SGDV+ IR+WD+ +E K+ D+ T ++SCV+S+       L+ AG GDG ++++D R   NEC +        W+ K     +    + S+ + G++             +  P R P  +   Q V         +GL        + L    S+N  +    VH ++                               G + SN KY++GF    I A + +  HP+   +  G  D
Sbjct:  958 RNARVRKQSQRITQRGV-----------TRLDDQIFINRNPGVPSVVKFHPFNPCIAVADKDSICFWDWEKGERLDYFYNGN--------------PRYTRITAMEYLNGHD--CSLLLTATDDGALRIWKNFADQ--RNPEMVTAWQGLSDMLPTTRGLARRVSIYLDRSKQGGAGMVVDWEQETGLLMTSGDVRVIRIWDTEREIKVQDIPTGADSCVTSLSCDPQRSLVAAGLGDGSVRVYDRRMGPNECRVMTYREHGAWVVKAHLQKEPEGHIISVSVNGDVR------------FFDP-RMPESVNTLQTV---------KGLTALDIHPQANLFACGSMNQFIA---VHNSN-------------------------------GDVISNIKYYDGFMGQRIGAISCLAFHPFWPHLAVGSND 1301          
BLAST of Regulatory-associated protein of mTOR vs. Ensembl Zebrafish
Match: rptor (regulatory associated protein of MTOR, complex 1 [Source:ZFIN;Acc:ZDB-GENE-130530-685])

HSP 1 Score: 124.405 bits (311), Expect = 4.855e-28
Identity = 76/233 (32.62%), Postives = 122/233 (52.36%), Query Frame = 2
Query: 2021 AKNDVVKDAGYKYFVSCLTEN-EPYEIIIKTISAFALAKMLNNNPVGQKLYIKQNFMTVLIEELENNPSDLANDNYIRLRIWFILSFAKLWSDNDDAKWYGVRQQIHEKLLLYLKDISPEVRAATVYALGTFLNNKASDGIRSKHAVQVEQNICQHLLNHSVNDSSPLVRAELVVAMKYMVNLFSNQVMSMAIYYDVWLSQNNHGSINDVNNGKFMGPPSPLANRNVMPSRGS 2716
             + D+VKD G+KYF+S L +   P E   +T++ F LA ++NN   GQ+  ++ N + + +E+L        ND +  LR W  +   ++W + D A+W GVR   HEKL   L D  PEVR A V+ALGTF+ N A    R+ H+  ++ N+   +L   +ND SP+   ELVVA+ ++V  + +   ++A+ +           + +  N     P +     N+ PSR S
Sbjct:  103 CQADLVKDNGHKYFLSVLADPFMPAEH--RTMAVFILAVIVNNYNTGQEACLQGNLIAICLEQL--------NDPHPLLRQWVAICLGRIWQNYDSARWCGVRDSAHEKLYSLLSDSIPEVRCAAVFALGTFVGNSAE---RTDHSTTIDHNVAM-MLAQLINDGSPI---ELVVALSHLVVQYESNFCTVALQF-----------MEEEKNYAVPSPANSTETGNITPSRDS 307          

HSP 2 Score: 108.997 bits (271), Expect = 2.466e-23
Identity = 87/352 (24.72%), Postives = 148/352 (42.05%), Query Frame = 2
Query: 3809 SGVSLWNWESGQRAQYMLSQSVSCKXXXXXXXXXXXXXXXXXXLEFINAEEDRGGLILVGTMDGRIKIWRNYLRDMGQDPDIVTAWIALPDQICSNRPSGLITHWSQSLGQLTISGDVKYIRLWDSLQECKISDMNTNSESCVSSIDRSQDGRLIVAGFGDGHIKMFDIRAPVNECVINAGVGDMGWIHKVAYS-DSTNQVYSIGIYGELTTWCVRQRNLPKPYITPSRRPNPLRNTQNVDIDPKATSREGLLKDPFTSDSKLTLAKSINHSLKLQPVHCADLRVSSESDKEHLAVIGYGKESRGILTAIAPTGSINSNFKYFEGFSRANIEAPTSVCVHPYQTLVGAGLED 4861
            S V+ W+WE G+R  Y  + +                   IT++E++N  +    L+L  T    ++IW+N+     ++P++VTAW  L D + + R  G++  W Q  G L  SGDV+ IR+WD+ +E K+ D+ T ++SCV+S+       L+ AG GDG ++++D R   NEC +        W+ K     +    + S+ + G++             +  P R P  +   Q V         +GL        + L    S+N  +    VH ++                               G + SN KY++GF    I A + +  HP+   +  G  D
Sbjct:  680 SVVNFWDWEKGERLDYFYNGN--------------PRYTRITAMEYLNGHD--CSLLLTATA---LRIWKNFADQ--RNPEMVTAWQGLSDMLPTTR--GMVVDWEQETGLLMTSGDVRVIRIWDTEREIKVQDIPTGADSCVTSLSCDPQRSLVAAGLGDGSVRVYDRRMGPNECRVMTYREHGAWVVKAHLQKEPEGHIISVSVNGDVR------------FFDP-RMPESVNTLQTV---------KGLTALDIHPQANLFACGSMNQFIA---VHNSN-------------------------------GDVISNIKYYDGFMGQRIGAISCLAFHPFWPHLAVGSND 952          
BLAST of Regulatory-associated protein of mTOR vs. Ensembl Xenopus
Match: rptor (regulatory associated protein of MTOR, complex 1 [Source:NCBI gene;Acc:100170605])

HSP 1 Score: 431.795 bits (1109), Expect = 1.024e-126
Identity = 209/385 (54.29%), Postives = 268/385 (69.61%), Query Frame = 2
Query:  110 DKSYPFVAFKARHLNXXXXXXXXXXXXXXKDKVRTLHVVLVLCLNLAVDPPDTLVKVSPCSKMEAWFDPKEKNLNRALEMIGKNLQIQYERWQPKARYRQSLDPTIEEIHRLCQSLRRSAREDRVLFHYNGHGVPRPTENGEIWVFNKAYTKYIPLSLYDLHSWMGGPTVYVFDCNNAGRIIRMMEQFSMKRFENNGTA--NSS----------SMDNIIILASCQENEDIPQNPEVPADLFTSCLTTPIKIALHWYLLRNQEIFPNYLNETMLELIGGSPSNRVSMFGEINWVFTAVTDTIAWSCLPPPLFQKLFRQDLLVASLFRNFLLAERIMHYYGLRPVSYPPLPKTYEHPMWDAWDHALDCYTSQLPEIYHKKQSMNNS 1228
            D + P    K RH  +      L +    KD+++T+ V LVLCLN+ VDPPD +VK +PC+++E W DP      +ALE IG NLQ QYE WQP+ARY+QSLDPT++E+ +LC SLRR+A+E+RVLFHYNGHGVPRPT NGEIWVFNK YT+YIPLS+YDL +WMG P+++V+DC+NAG I++  +QF+++R +    A  N S          SM N I LA+C   E +P NP++PADLFTSCLTTPIKIAL W+ ++        +   ++E I G  ++R +  GE+NW+FTA+TDTIAW+ LP  LFQKLFRQDLLVASLFRNFLLAERIM  Y   PVS P LP TY H MW AWD A+D   SQLP I  +  +  +S
Sbjct:   21 DWNLPSAFMKKRHCEKIEGCKSLAQSWRMKDRMKTVSVALVLCLNVGVDPPD-VVKTTPCARLECWIDPLAMGPQKALETIGANLQKQYETWQPRARYKQSLDPTVDEVKKLCTSLRRNAKEERVLFHYNGHGVPRPTVNGEIWVFNKNYTQYIPLSIYDLQTWMGSPSIFVYDCSNAGLIVKSFKQFALQREQELEVAAINPSHPLAQMPLPPSMKNCIQLAACDAAELLPMNPDLPADLFTSCLTTPIKIALRWFCMQKSVRLVPGVTLDLIEKIPGRLNDRRTPLGELNWIFTAITDTIAWNVLPRDLFQKLFRQDLLVASLFRNFLLAERIMRSYNCSPVSSPRLPPTYMHAMWQAWDLAVDICLSQLPTIIEEGTAFRHS 404          

HSP 2 Score: 235.343 bits (599), Expect = 7.395e-62
Identity = 166/474 (35.02%), Postives = 254/474 (53.59%), Query Frame = 2
Query: 1709 FKHTDFFNDHMTAFELWLKTADEKKXXXXXXXXXXXXXXXXXHRYRALRLLSEYMDLGPWAVIQCLTVGIFPYVVRLLQSPVYDVKPYLVFIWGKIISSAQTDFAKNDVVKDAGYKYFVSCLTENEPY-EIIIKTISAFALAKMLNNNPVGQKLYIKQNFMTVLIEELENNPSDLANDNYIRLRIWFILSFAKLWSDNDDAKWYGVRQQIHEKLLLYLKDISPEVRAATVYALGTFLNNKASDGIRSKHAVQVEQNICQHLLNHSVNDSSPLVRAELVVAMKYMVNLFSNQVMSMAIYYDVWLSQNNHGSINDVNNGKFMGPPSPLANRNVMPSRGSIEKISKRLFVHSPPALTDKISVRQKAVSSGDLTNFDENNNTFWLFKDSHIPFILPDMYLYGNINSTRGNLKNLGAELSFRPTFIKKVPAVSNFTTYNS--GFPIINIYAQMWFSLILLSKDPYPKVSILASKIVEAI 3121
            F+H+ FF + +TAF++WL    E +  P QLPI+LQVLLSQVHR RAL LL  ++DLGPWAV   L+VGIFPYV++LLQS   +++P LVFIW KI++   +   + D+VKD G+KYF+S L   +PY     +T+++F LA ++NN   GQ+  ++ N + + +E+L        ND +  LR W  +   ++W + D A+W GVR   HEKL   L D  PEVR++ V+ALGTF+ N A    R+ H+  ++ N+   +L   +ND SP+VR ELVVA+ ++V  + +   ++A+ +          S      G      +P+ +    P   S+        V +P  L   +     +  +G    F   N +      +      PD   Y                LSF    I K+  VS++++ NS  G    ++Y Q+W  L+ L+ DPYP+VS LA K++ +I
Sbjct:  401 FRHSPFFAEQLTAFQVWLTMGVENRNPPEQLPIVLQVLLSQVHRLRALDLLGRFLDLGPWAVSLALSVGIFPYVLKLLQSSARELRPLLVFIWAKILAVDSS--CQADLVKDNGHKYFLSVLA--DPYMPAEHRTMTSFILAVIVNNYNTGQEACLQGNLIAICLEQL--------NDPHPLLRQWVAICLGRIWQNFDAARWCGVRDSAHEKLYSLLSDPMPEVRSSAVFALGTFVGNSAE---RTDHSTTIDHNVAM-MLAQLINDGSPMVRKELVVALSHLVVQYESNFCTVALQFMEEEKNYPLPSPASTEGGSL----TPIRDSPGTPRLRSVSSYGNIRAVTTPRNLNKSLQNLSLSEETGSAITFSPGNLS--TSSSASSTLGSPDNEEY---------------ILSFET--IDKMRRVSSYSSLNSLIGVSFNSVYTQIWRVLLHLAADPYPEVSDLAMKVLNSI 835          

HSP 3 Score: 159.073 bits (401), Expect = 2.283e-38
Identity = 105/380 (27.63%), Postives = 173/380 (45.53%), Query Frame = 2
Query: 3725 QIFLQKIDSKPELLKFHPYLNYLAVVDRSGVSLWNWESGQRAQYMLSQSVSCKXXXXXXXXXXXXXXXXXXLEFINAEEDRGGLILVGTMDGRIKIWRNYLRDMGQDPDIVTAWIALPDQICSNRPSGLITHWSQSLGQLTISGDVKYIRLWDSLQECKISDMNTNSESCVSSIDRSQDGRLIVAGFGDGHIKMFDIRAPVNECVINAGVGDMGWIHKVAYS-DSTNQVYSIGIYGELTTWCVRQRNLPKPYITPSRRPNPLRNTQNVDIDPKATSREGLLKDPFTSDSKLTLAKSINHSLKLQPVHCADLRVSSESDKEHLAVIGYGKESRGILTAIAPTGSINSNFKYFEGFSRANIEAPTSVCVHPYQTLVGAGLED 4861
            QIF+ +    P ++KFHP+ + +AV D+  +  W+WE G++  Y  + +                   IT++E++N ++    L+L  T DG I++W+N+  D+ ++P++VTAW  L D + + R +G++  W Q  G L  SGDV+ IRLWD+ +E K+ D+ T ++SCV+S+       LIVAG GDG +++FD R  +NEC +        W+ K +    S   + S+ + G++             Y  P R P  L + Q V         +GL        + L    S+N  + +                       Y              G + SN KY++GF    I A + +  HPY   +  G  D
Sbjct: 1021 QIFINRNPGVPSVVKFHPFTSSIAVADKDSICFWDWEKGEKLDYFHNGN--------------PRYTRITAVEYLNGQD--CSLLLTATDDGAIRVWKNFA-DLEKNPEMVTAWQGLSDMLPTTRGAGMVVDWEQETGLLITSGDVRIIRLWDTDRETKVQDIPTGADSCVTSLSCDSHRSLIVAGLGDGSVRVFDRRMALNECRVMTYREHSAWVVKTSLQKQSDGNIVSVSVNGDIR------------YFDP-RMPECLNSLQIV---------KGLTALDIHPQANLFACGSMNQFIAI-----------------------YNG-----------NGELISNIKYYDGFMGQRIGAISCLAFHPYWPHLAVGSND 1327          
BLAST of Regulatory-associated protein of mTOR vs. Ensembl Xenopus
Match: rptor (regulatory associated protein of MTOR, complex 1 [Source:NCBI gene;Acc:100170605])

HSP 1 Score: 431.795 bits (1109), Expect = 1.343e-126
Identity = 209/385 (54.29%), Postives = 268/385 (69.61%), Query Frame = 2
Query:  110 DKSYPFVAFKARHLNXXXXXXXXXXXXXXKDKVRTLHVVLVLCLNLAVDPPDTLVKVSPCSKMEAWFDPKEKNLNRALEMIGKNLQIQYERWQPKARYRQSLDPTIEEIHRLCQSLRRSAREDRVLFHYNGHGVPRPTENGEIWVFNKAYTKYIPLSLYDLHSWMGGPTVYVFDCNNAGRIIRMMEQFSMKRFENNGTA--NSS----------SMDNIIILASCQENEDIPQNPEVPADLFTSCLTTPIKIALHWYLLRNQEIFPNYLNETMLELIGGSPSNRVSMFGEINWVFTAVTDTIAWSCLPPPLFQKLFRQDLLVASLFRNFLLAERIMHYYGLRPVSYPPLPKTYEHPMWDAWDHALDCYTSQLPEIYHKKQSMNNS 1228
            D + P    K RH  +      L +    KD+++T+ V LVLCLN+ VDPPD +VK +PC+++E W DP      +ALE IG NLQ QYE WQP+ARY+QSLDPT++E+ +LC SLRR+A+E+RVLFHYNGHGVPRPT NGEIWVFNK YT+YIPLS+YDL +WMG P+++V+DC+NAG I++  +QF+++R +    A  N S          SM N I LA+C   E +P NP++PADLFTSCLTTPIKIAL W+ ++        +   ++E I G  ++R +  GE+NW+FTA+TDTIAW+ LP  LFQKLFRQDLLVASLFRNFLLAERIM  Y   PVS P LP TY H MW AWD A+D   SQLP I  +  +  +S
Sbjct:   21 DWNLPSAFMKKRHCEKIEGCKSLAQSWRMKDRMKTVSVALVLCLNVGVDPPD-VVKTTPCARLECWIDPLAMGPQKALETIGANLQKQYETWQPRARYKQSLDPTVDEVKKLCTSLRRNAKEERVLFHYNGHGVPRPTVNGEIWVFNKNYTQYIPLSIYDLQTWMGSPSIFVYDCSNAGLIVKSFKQFALQREQELEVAAINPSHPLAQMPLPPSMKNCIQLAACDAAELLPMNPDLPADLFTSCLTTPIKIALRWFCMQKSVRLVPGVTLDLIEKIPGRLNDRRTPLGELNWIFTAITDTIAWNVLPRDLFQKLFRQDLLVASLFRNFLLAERIMRSYNCSPVSSPRLPPTYMHAMWQAWDLAVDICLSQLPTIIEEGTAFRHS 404          

HSP 2 Score: 236.498 bits (602), Expect = 3.344e-62
Identity = 167/477 (35.01%), Postives = 259/477 (54.30%), Query Frame = 2
Query: 1709 FKHTDFFNDHMTAFELWLKTADEKKXXXXXXXXXXXXXXXXXHRYRALRLLSEYMDLGPWAVIQCLTVGIFPYVVRLLQSPVYDVKPYLVFIWGKIISSAQTDFAKNDVVKDAGYKYFVSCLTENEPY-EIIIKTISAFALAKMLNNNPVGQKLYIKQNFMTVLIEELENNPSDLANDNYIRLRIWFILSFAKLWSDNDDAKWYGVRQQIHEKLLLYLKDISPEVRAATVYALGTFLNNKASDGIRSKHAVQVEQNICQHLLNHSVNDSSPLVRAELVVAMKYMVNLFSNQVMSMAIYYDVWLSQNNHGSINDVNNGKFMGPPSPLANRNVMPSRGSIEKISKRLFVHSPPALT---DKISVRQKAVSSGDLTNFDENNNTFWLFKDSHIPFILPDMYLYGNINSTRGNLKNLGAELSFRPTFIKKVPAVSNFTTYNS--GFPIINIYAQMWFSLILLSKDPYPKVSILASKIVEAI 3121
            F+H+ FF + +TAF++WL    E +  P QLPI+LQVLLSQVHR RAL LL  ++DLGPWAV   L+VGIFPYV++LLQS   +++P LVFIW KI++   +   + D+VKD G+KYF+S L   +PY     +T+++F LA ++NN   GQ+  ++ N + + +E+L        ND +  LR W  +   ++W + D A+W GVR   HEKL   L D  PEVR++ V+ALGTF+ N A    R+ H+  ++ N+   +L   +ND SP+VR ELVVA+ ++V  + +   ++A+ +          S      G      +P+ +    P   S+        V +P  L      +S+ +++ ++G    F   N +      +      PD   Y                LSF    I K+  VS++++ NS  G    ++Y Q+W  L+ L+ DPYP+VS LA K++ +I
Sbjct:  401 FRHSPFFAEQLTAFQVWLTMGVENRNPPEQLPIVLQVLLSQVHRLRALDLLGRFLDLGPWAVSLALSVGIFPYVLKLLQSSARELRPLLVFIWAKILAVDSS--CQADLVKDNGHKYFLSVLA--DPYMPAEHRTMTSFILAVIVNNYNTGQEACLQGNLIAICLEQL--------NDPHPLLRQWVAICLGRIWQNFDAARWCGVRDSAHEKLYSLLSDPMPEVRSSAVFALGTFVGNSAE---RTDHSTTIDHNVAM-MLAQLINDGSPMVRKELVVALSHLVVQYESNFCTVALQFMEEEKNYPLPSPASTEGGSL----TPIRDSPGTPRLRSVSSYGNIRAVTTPRNLNKSLQNLSLSEESKTAGSAITFSPGNLS--TSSSASSTLGSPDNEEY---------------ILSFET--IDKMRRVSSYSSLNSLIGVSFNSVYTQIWRVLLHLAADPYPEVSDLAMKVLNSI 838          

HSP 3 Score: 148.673 bits (374), Expect = 4.101e-35
Identity = 105/396 (26.52%), Postives = 173/396 (43.69%), Query Frame = 2
Query: 3725 QIFLQKIDSKPELLKFHPYLNYLAVVDRSGVSLWNWESGQRAQYMLSQSVSCKXXXXXXXXXXXXXXXXXXLEFINAEEDRGGLILVGTMDGRIKIWRNYLRDMGQDPDIVTAWIALPDQICSNRP----------------SGLITHWSQSLGQLTISGDVKYIRLWDSLQECKISDMNTNSESCVSSIDRSQDGRLIVAGFGDGHIKMFDIRAPVNECVINAGVGDMGWIHKVAYS-DSTNQVYSIGIYGELTTWCVRQRNLPKPYITPSRRPNPLRNTQNVDIDPKATSREGLLKDPFTSDSKLTLAKSINHSLKLQPVHCADLRVSSESDKEHLAVIGYGKESRGILTAIAPTGSINSNFKYFEGFSRANIEAPTSVCVHPYQTLVGAGLED 4861
            QIF+ +    P ++KFHP+ + +AV D+  +  W+WE G++  Y  + +                   IT++E++N ++    L+L  T DG I++W+N+  D+ ++P++VTAW  L D + + R                 +G++  W Q  G L  SGDV+ IRLWD+ +E K+ D+ T ++SCV+S+       LIVAG GDG +++FD R  +NEC +        W+ K +    S   + S+ + G++             Y  P R P  L + Q V         +GL        + L    S+N  + +                       Y              G + SN KY++GF    I A + +  HPY   +  G  D
Sbjct: 1018 QIFINRNPGVPSVVKFHPFTSSIAVADKDSICFWDWEKGEKLDYFHNGN--------------PRYTRITAVEYLNGQD--CSLLLTATDDGAIRVWKNFA-DLEKNPEMVTAWQGLSDMLPTTRGLARRVSIYLDRSKQGGAGMVVDWEQETGLLITSGDVRIIRLWDTDRETKVQDIPTGADSCVTSLSCDSHRSLIVAGLGDGSVRVFDRRMALNECRVMTYREHSAWVVKTSLQKQSDGNIVSVSVNGDIR------------YFDP-RMPECLNSLQIV---------KGLTALDIHPQANLFACGSMNQFIAI-----------------------YNG-----------NGELISNIKYYDGFMGQRIGAISCLAFHPYWPHLAVGSND 1340          
BLAST of Regulatory-associated protein of mTOR vs. Ensembl Xenopus
Match: rptor (regulatory associated protein of MTOR, complex 1 [Source:NCBI gene;Acc:100170605])

HSP 1 Score: 431.795 bits (1109), Expect = 1.569e-126
Identity = 209/385 (54.29%), Postives = 268/385 (69.61%), Query Frame = 2
Query:  110 DKSYPFVAFKARHLNXXXXXXXXXXXXXXKDKVRTLHVVLVLCLNLAVDPPDTLVKVSPCSKMEAWFDPKEKNLNRALEMIGKNLQIQYERWQPKARYRQSLDPTIEEIHRLCQSLRRSAREDRVLFHYNGHGVPRPTENGEIWVFNKAYTKYIPLSLYDLHSWMGGPTVYVFDCNNAGRIIRMMEQFSMKRFENNGTA--NSS----------SMDNIIILASCQENEDIPQNPEVPADLFTSCLTTPIKIALHWYLLRNQEIFPNYLNETMLELIGGSPSNRVSMFGEINWVFTAVTDTIAWSCLPPPLFQKLFRQDLLVASLFRNFLLAERIMHYYGLRPVSYPPLPKTYEHPMWDAWDHALDCYTSQLPEIYHKKQSMNNS 1228
            D + P    K RH  +      L +    KD+++T+ V LVLCLN+ VDPPD +VK +PC+++E W DP      +ALE IG NLQ QYE WQP+ARY+QSLDPT++E+ +LC SLRR+A+E+RVLFHYNGHGVPRPT NGEIWVFNK YT+YIPLS+YDL +WMG P+++V+DC+NAG I++  +QF+++R +    A  N S          SM N I LA+C   E +P NP++PADLFTSCLTTPIKIAL W+ ++        +   ++E I G  ++R +  GE+NW+FTA+TDTIAW+ LP  LFQKLFRQDLLVASLFRNFLLAERIM  Y   PVS P LP TY H MW AWD A+D   SQLP I  +  +  +S
Sbjct:   21 DWNLPSAFMKKRHCEKIEGCKSLAQSWRMKDRMKTVSVALVLCLNVGVDPPD-VVKTTPCARLECWIDPLAMGPQKALETIGANLQKQYETWQPRARYKQSLDPTVDEVKKLCTSLRRNAKEERVLFHYNGHGVPRPTVNGEIWVFNKNYTQYIPLSIYDLQTWMGSPSIFVYDCSNAGLIVKSFKQFALQREQELEVAAINPSHPLAQMPLPPSMKNCIQLAACDAAELLPMNPDLPADLFTSCLTTPIKIALRWFCMQKSVRLVPGVTLDLIEKIPGRLNDRRTPLGELNWIFTAITDTIAWNVLPRDLFQKLFRQDLLVASLFRNFLLAERIMRSYNCSPVSSPRLPPTYMHAMWQAWDLAVDICLSQLPTIIEEGTAFRHS 404          

HSP 2 Score: 234.958 bits (598), Expect = 8.341e-62
Identity = 166/474 (35.02%), Postives = 254/474 (53.59%), Query Frame = 2
Query: 1709 FKHTDFFNDHMTAFELWLKTADEKKXXXXXXXXXXXXXXXXXHRYRALRLLSEYMDLGPWAVIQCLTVGIFPYVVRLLQSPVYDVKPYLVFIWGKIISSAQTDFAKNDVVKDAGYKYFVSCLTENEPY-EIIIKTISAFALAKMLNNNPVGQKLYIKQNFMTVLIEELENNPSDLANDNYIRLRIWFILSFAKLWSDNDDAKWYGVRQQIHEKLLLYLKDISPEVRAATVYALGTFLNNKASDGIRSKHAVQVEQNICQHLLNHSVNDSSPLVRAELVVAMKYMVNLFSNQVMSMAIYYDVWLSQNNHGSINDVNNGKFMGPPSPLANRNVMPSRGSIEKISKRLFVHSPPALTDKISVRQKAVSSGDLTNFDENNNTFWLFKDSHIPFILPDMYLYGNINSTRGNLKNLGAELSFRPTFIKKVPAVSNFTTYNS--GFPIINIYAQMWFSLILLSKDPYPKVSILASKIVEAI 3121
            F+H+ FF + +TAF++WL    E +  P QLPI+LQVLLSQVHR RAL LL  ++DLGPWAV   L+VGIFPYV++LLQS   +++P LVFIW KI++   +   + D+VKD G+KYF+S L   +PY     +T+++F LA ++NN   GQ+  ++ N + + +E+L        ND +  LR W  +   ++W + D A+W GVR   HEKL   L D  PEVR++ V+ALGTF+ N A    R+ H+  ++ N+   +L   +ND SP+VR ELVVA+ ++V  + +   ++A+ +          S      G      +P+ +    P   S+        V +P  L   +     +  +G    F   N +      +      PD   Y                LSF    I K+  VS++++ NS  G    ++Y Q+W  L+ L+ DPYP+VS LA K++ +I
Sbjct:  401 FRHSPFFAEQLTAFQVWLTMGVENRNPPEQLPIVLQVLLSQVHRLRALDLLGRFLDLGPWAVSLALSVGIFPYVLKLLQSSARELRPLLVFIWAKILAVDSS--CQADLVKDNGHKYFLSVLA--DPYMPAEHRTMTSFILAVIVNNYNTGQEACLQGNLIAICLEQL--------NDPHPLLRQWVAICLGRIWQNFDAARWCGVRDSAHEKLYSLLSDPMPEVRSSAVFALGTFVGNSAE---RTDHSTTIDHNVAM-MLAQLINDGSPMVRKELVVALSHLVVQYESNFCTVALQFMEEEKNYPLPSPASTEGGSL----TPIRDSPGTPRLRSVSSYGNIRAVTTPRNLNKSLQNLSLSEETGSAITFSPGNLS--TSSSASSTLGSPDNEEY---------------ILSFET--IDKMRRVSSYSSLNSLIGVSFNSVYTQIWRVLLHLAADPYPEVSDLAMKVLNSI 835          

HSP 3 Score: 148.673 bits (374), Expect = 4.040e-35
Identity = 105/396 (26.52%), Postives = 173/396 (43.69%), Query Frame = 2
Query: 3725 QIFLQKIDSKPELLKFHPYLNYLAVVDRSGVSLWNWESGQRAQYMLSQSVSCKXXXXXXXXXXXXXXXXXXLEFINAEEDRGGLILVGTMDGRIKIWRNYLRDMGQDPDIVTAWIALPDQICSNRP----------------SGLITHWSQSLGQLTISGDVKYIRLWDSLQECKISDMNTNSESCVSSIDRSQDGRLIVAGFGDGHIKMFDIRAPVNECVINAGVGDMGWIHKVAYS-DSTNQVYSIGIYGELTTWCVRQRNLPKPYITPSRRPNPLRNTQNVDIDPKATSREGLLKDPFTSDSKLTLAKSINHSLKLQPVHCADLRVSSESDKEHLAVIGYGKESRGILTAIAPTGSINSNFKYFEGFSRANIEAPTSVCVHPYQTLVGAGLED 4861
            QIF+ +    P ++KFHP+ + +AV D+  +  W+WE G++  Y  + +                   IT++E++N ++    L+L  T DG I++W+N+  D+ ++P++VTAW  L D + + R                 +G++  W Q  G L  SGDV+ IRLWD+ +E K+ D+ T ++SCV+S+       LIVAG GDG +++FD R  +NEC +        W+ K +    S   + S+ + G++             Y  P R P  L + Q V         +GL        + L    S+N  + +                       Y              G + SN KY++GF    I A + +  HPY   +  G  D
Sbjct: 1021 QIFINRNPGVPSVVKFHPFTSSIAVADKDSICFWDWEKGEKLDYFHNGN--------------PRYTRITAVEYLNGQD--CSLLLTATDDGAIRVWKNFA-DLEKNPEMVTAWQGLSDMLPTTRGLARRVSIYLDRSKQGGAGMVVDWEQETGLLITSGDVRIIRLWDTDRETKVQDIPTGADSCVTSLSCDSHRSLIVAGLGDGSVRVFDRRMALNECRVMTYREHSAWVVKTSLQKQSDGNIVSVSVNGDIR------------YFDP-RMPECLNSLQIV---------KGLTALDIHPQANLFACGSMNQFIAI-----------------------YNG-----------NGELISNIKYYDGFMGQRIGAISCLAFHPYWPHLAVGSND 1343          
BLAST of Regulatory-associated protein of mTOR vs. Ensembl Xenopus
Match: rptor (regulatory associated protein of MTOR, complex 1 [Source:NCBI gene;Acc:100170605])

HSP 1 Score: 358.221 bits (918), Expect = 1.429e-101
Identity = 186/375 (49.60%), Postives = 231/375 (61.60%), Query Frame = 2
Query:  110 DKSYPFVAFKARHLNXXXXXXXXXXXXXXKDKVRTLHVVLVLCLNLAVDPPDTLVKVSPCSKMEAWFDPKEKNLNRALEMIGKNLQIQYERWQPKARYRQSLDPTIEEIHRLCQSLRRSAREDRVLFHYNGHGVPRPTENGEIWVFNK--AYTKYIPLSLYDLHSWMGGPTVYVFDCNNAGRIIRMMEQFSMKRFENNGTANSSSMDNIIILASCQENEDIPQNPEVPADLFTSCLTTPIKIALHWYLLRNQEIFPNYLNETMLELIGGSPSNRVSMFGEINWVFTAVTDTIAWSCLPPPLFQKLFRQDLLVASLFRNFLLAERIMHYYGLRPVSYPPLPKTYEHPMWDAWDHALDCYTSQLPEIYHKKQSMNNS 1228
            D + P    K RH  +      L +    KD+++T+ V LVLCLN+ VDPPD +VK +PC+++E W DP      +ALE IG NLQ QYE WQP+ARY+QSLDPT++E+ +LC SLRR+A+E+RVLFHYNGHGVPRPT NGEIWVFNK  A     PL+   L                                         SM N I LA+C   E +P NP++PADLFTSCLTTPIKIAL W+ ++        +   ++E I G  ++R +  GE+NW+FTA+TDTIAW+ LP  LFQKLFRQDLLVASLFRNFLLAERIM  Y   PVS P LP TY H MW AWD A+D   SQLP I  +  +  +S
Sbjct:   21 DWNLPSAFMKKRHCEKIEGCKSLAQSWRMKDRMKTVSVALVLCLNVGVDPPD-VVKTTPCARLECWIDPLAMGPQKALETIGANLQKQYETWQPRARYKQSLDPTVDEVKKLCTSLRRNAKEERVLFHYNGHGVPRPTVNGEIWVFNKVAAINPSHPLAQMPL---------------------------------------PPSMKNCIQLAACDAAELLPMNPDLPADLFTSCLTTPIKIALRWFCMQKSVRLVPGVTLDLIEKIPGRLNDRRTPLGELNWIFTAITDTIAWNVLPRDLFQKLFRQDLLVASLFRNFLLAERIMRSYNCSPVSSPRLPPTYMHAMWQAWDLAVDICLSQLPTIIEEGTAFRHS 355          

HSP 2 Score: 235.728 bits (600), Expect = 5.001e-62
Identity = 166/474 (35.02%), Postives = 254/474 (53.59%), Query Frame = 2
Query: 1709 FKHTDFFNDHMTAFELWLKTADEKKXXXXXXXXXXXXXXXXXHRYRALRLLSEYMDLGPWAVIQCLTVGIFPYVVRLLQSPVYDVKPYLVFIWGKIISSAQTDFAKNDVVKDAGYKYFVSCLTENEPY-EIIIKTISAFALAKMLNNNPVGQKLYIKQNFMTVLIEELENNPSDLANDNYIRLRIWFILSFAKLWSDNDDAKWYGVRQQIHEKLLLYLKDISPEVRAATVYALGTFLNNKASDGIRSKHAVQVEQNICQHLLNHSVNDSSPLVRAELVVAMKYMVNLFSNQVMSMAIYYDVWLSQNNHGSINDVNNGKFMGPPSPLANRNVMPSRGSIEKISKRLFVHSPPALTDKISVRQKAVSSGDLTNFDENNNTFWLFKDSHIPFILPDMYLYGNINSTRGNLKNLGAELSFRPTFIKKVPAVSNFTTYNS--GFPIINIYAQMWFSLILLSKDPYPKVSILASKIVEAI 3121
            F+H+ FF + +TAF++WL    E +  P QLPI+LQVLLSQVHR RAL LL  ++DLGPWAV   L+VGIFPYV++LLQS   +++P LVFIW KI++   +   + D+VKD G+KYF+S L   +PY     +T+++F LA ++NN   GQ+  ++ N + + +E+L        ND +  LR W  +   ++W + D A+W GVR   HEKL   L D  PEVR++ V+ALGTF+ N A    R+ H+  ++ N+   +L   +ND SP+VR ELVVA+ ++V  + +   ++A+ +          S      G      +P+ +    P   S+        V +P  L   +     +  +G    F   N +      +      PD   Y                LSF    I K+  VS++++ NS  G    ++Y Q+W  L+ L+ DPYP+VS LA K++ +I
Sbjct:  352 FRHSPFFAEQLTAFQVWLTMGVENRNPPEQLPIVLQVLLSQVHRLRALDLLGRFLDLGPWAVSLALSVGIFPYVLKLLQSSARELRPLLVFIWAKILAVDSS--CQADLVKDNGHKYFLSVLA--DPYMPAEHRTMTSFILAVIVNNYNTGQEACLQGNLIAICLEQL--------NDPHPLLRQWVAICLGRIWQNFDAARWCGVRDSAHEKLYSLLSDPMPEVRSSAVFALGTFVGNSAE---RTDHSTTIDHNVAM-MLAQLINDGSPMVRKELVVALSHLVVQYESNFCTVALQFMEEEKNYPLPSPASTEGGSL----TPIRDSPGTPRLRSVSSYGNIRAVTTPRNLNKSLQNLSLSEETGSAITFSPGNLS--TSSSASSTLGSPDNEEY---------------ILSFET--IDKMRRVSSYSSLNSLIGVSFNSVYTQIWRVLLHLAADPYPEVSDLAMKVLNSI 786          

HSP 3 Score: 124.405 bits (311), Expect = 1.024e-27
Identity = 107/427 (25.06%), Postives = 178/427 (41.69%), Query Frame = 2
Query: 3632 RNERLKKQKNIKLEGAQNWKASLNSSGTQLSQIFLQKIDSKPELLKFHPYLNYLAVVDRSGVSLWNWESGQRAQYMLSQSVSCKXXXXXXXXXXXXXXXXXXLEFINAEEDRGGLILVGTMDGRIKIWRNYLRDMGQDPDIVTAWIALPDQICSNRP----------------SGLITHWSQSLGQLTISGDVKYIRLWDSLQECKISDMNTNSESCVSSIDRSQDGRLIVAGFGDGHIKMFDIRAPVNECVINAGVGDMGWIHKVAYS-DSTNQVYSIGIYGELTTWCVRQRNLPKPYITPSRRPNPLRNTQNVDIDPKATSREGLLKDPFTSDSKLTLAKSINHSLKLQPVHCADLRVSSESDKEHLAVIGYGKESRGILTAIAPTGSINSNFKYFEGFSRANIEAPTSVCVHPYQTLVGAGLED 4861
            RN R++KQ    +   Q   + L+       QIF+ +    P ++KFHP+ + +AV                  Y   + +      +   + +     IT++E++N ++    L+L  T DG I++W+N+  D+ ++P++VTAW  L D + + R                 +G++  W Q  G L  SGDV+ IRLWD+ +E K+ D+ T ++SCV+S+       LIVAG GDG +++FD R  +NEC +        W+ K +    S   + S+ + G++             Y  P R P  L + Q V         +GL        + L    S+N  + +                       Y              G + SN KY++GF    I A + +  HPY   +  G  D
Sbjct:  950 RNTRVRKQAQRLI---QKGISRLDD------QIFINRNPGVPSVVKFHPFTSSIAVC-----------------YCFGRFLIGNILLDYFHNGNPRYTRITAVEYLNGQD--CSLLLTATDDGAIRVWKNFA-DLEKNPEMVTAWQGLSDMLPTTRGLARRVSIYLDRSKQGGAGMVVDWEQETGLLITSGDVRIIRLWDTDRETKVQDIPTGADSCVTSLSCDSHRSLIVAGLGDGSVRVFDRRMALNECRVMTYREHSAWVVKTSLQKQSDGNIVSVSVNGDIR------------YFDP-RMPECLNSLQIV---------KGLTALDIHPQANLFACGSMNQFIAI-----------------------YNG-----------NGELISNIKYYDGFMGQRIGAISCLAFHPYWPHLAVGSND 1291          
BLAST of Regulatory-associated protein of mTOR vs. Ensembl Xenopus
Match: rptor (regulatory associated protein of MTOR, complex 1 [Source:NCBI gene;Acc:100170605])

HSP 1 Score: 349.362 bits (895), Expect = 1.210e-98
Identity = 177/337 (52.52%), Postives = 225/337 (66.77%), Query Frame = 2
Query:  257 PPDTLVKVSPCSKMEAWFDPKEKNLNRALEMI-GKNLQIQYERWQPKARYRQSLDPTIEEIHRLCQSLRRSAREDRVLFHYNGHGVPRPTENGEIWVFNKAYTKYIPLSLYDLHSWMGGPTVYVFDCNNAGRIIRMMEQFSMKRFENNGTA--NSS----------SMDNIIILASCQENEDIPQNPEVPADLFTSCLTTPIKIALHWYLLRNQEIFPNYLNETMLELIGGSPSNRVSMFGEINWVFTAVTDTIAWSCLPPPLFQKLFRQDLLVASLFRNFLLAERIMHYYGLRPVSYPPLPKTYEHPMWDAWDHALDCYTSQLPEIYHKKQSMNNS 1228
            P   LV     + +  W  P      R  E I G     Q  R + +ARY+QSLDPT++E+ +LC SLRR+A+E+RVLFHYNGHGVPRPT NGEIWVFNK YT+YIPLS+YDL +WMG P+++V+DC+NAG I++  +QF+++R +    A  N S          SM N I LA+C   E +P NP++PADLFTSCLTTPIKIAL W+ ++        +   ++E I G  ++R +  GE+NW+FTA+TDTIAW+ LP  LFQKLFRQDLLVASLFRNFLLAERIM  Y   PVS P LP TY H MW AWD A+D   SQLP I  +  +  +S
Sbjct:    6 PALGLVGEDEETDLSDWNLPSAFMKKRHCEKIEGCKSLAQSWRMKDRARYKQSLDPTVDEVKKLCTSLRRNAKEERVLFHYNGHGVPRPTVNGEIWVFNKNYTQYIPLSIYDLQTWMGSPSIFVYDCSNAGLIVKSFKQFALQREQELEVAAINPSHPLAQMPLPPSMKNCIQLAACDAAELLPMNPDLPADLFTSCLTTPIKIALRWFCMQKSVRLVPGVTLDLIEKIPGRLNDRRTPLGELNWIFTAITDTIAWNVLPRDLFQKLFRQDLLVASLFRNFLLAERIMRSYNCSPVSSPRLPPTYMHAMWQAWDLAVDICLSQLPTIIEEGTAFRHS 342          

HSP 2 Score: 235.343 bits (599), Expect = 5.897e-62
Identity = 166/474 (35.02%), Postives = 254/474 (53.59%), Query Frame = 2
Query: 1709 FKHTDFFNDHMTAFELWLKTADEKKXXXXXXXXXXXXXXXXXHRYRALRLLSEYMDLGPWAVIQCLTVGIFPYVVRLLQSPVYDVKPYLVFIWGKIISSAQTDFAKNDVVKDAGYKYFVSCLTENEPY-EIIIKTISAFALAKMLNNNPVGQKLYIKQNFMTVLIEELENNPSDLANDNYIRLRIWFILSFAKLWSDNDDAKWYGVRQQIHEKLLLYLKDISPEVRAATVYALGTFLNNKASDGIRSKHAVQVEQNICQHLLNHSVNDSSPLVRAELVVAMKYMVNLFSNQVMSMAIYYDVWLSQNNHGSINDVNNGKFMGPPSPLANRNVMPSRGSIEKISKRLFVHSPPALTDKISVRQKAVSSGDLTNFDENNNTFWLFKDSHIPFILPDMYLYGNINSTRGNLKNLGAELSFRPTFIKKVPAVSNFTTYNS--GFPIINIYAQMWFSLILLSKDPYPKVSILASKIVEAI 3121
            F+H+ FF + +TAF++WL    E +  P QLPI+LQVLLSQVHR RAL LL  ++DLGPWAV   L+VGIFPYV++LLQS   +++P LVFIW KI++   +   + D+VKD G+KYF+S L   +PY     +T+++F LA ++NN   GQ+  ++ N + + +E+L        ND +  LR W  +   ++W + D A+W GVR   HEKL   L D  PEVR++ V+ALGTF+ N A    R+ H+  ++ N+   +L   +ND SP+VR ELVVA+ ++V  + +   ++A+ +          S      G      +P+ +    P   S+        V +P  L   +     +  +G    F   N +      +      PD   Y                LSF    I K+  VS++++ NS  G    ++Y Q+W  L+ L+ DPYP+VS LA K++ +I
Sbjct:  339 FRHSPFFAEQLTAFQVWLTMGVENRNPPEQLPIVLQVLLSQVHRLRALDLLGRFLDLGPWAVSLALSVGIFPYVLKLLQSSARELRPLLVFIWAKILAVDSS--CQADLVKDNGHKYFLSVLA--DPYMPAEHRTMTSFILAVIVNNYNTGQEACLQGNLIAICLEQL--------NDPHPLLRQWVAICLGRIWQNFDAARWCGVRDSAHEKLYSLLSDPMPEVRSSAVFALGTFVGNSAE---RTDHSTTIDHNVAM-MLAQLINDGSPMVRKELVVALSHLVVQYESNFCTVALQFMEEEKNYPLPSPASTEGGSL----TPIRDSPGTPRLRSVSSYGNIRAVTTPRNLNKSLQNLSLSEETGSAITFSPGNLS--TSSSASSTLGSPDNEEY---------------ILSFET--IDKMRRVSSYSSLNSLIGVSFNSVYTQIWRVLLHLAADPYPEVSDLAMKVLNSI 773          

HSP 3 Score: 148.673 bits (374), Expect = 3.899e-35
Identity = 105/396 (26.52%), Postives = 173/396 (43.69%), Query Frame = 2
Query: 3725 QIFLQKIDSKPELLKFHPYLNYLAVVDRSGVSLWNWESGQRAQYMLSQSVSCKXXXXXXXXXXXXXXXXXXLEFINAEEDRGGLILVGTMDGRIKIWRNYLRDMGQDPDIVTAWIALPDQICSNRP----------------SGLITHWSQSLGQLTISGDVKYIRLWDSLQECKISDMNTNSESCVSSIDRSQDGRLIVAGFGDGHIKMFDIRAPVNECVINAGVGDMGWIHKVAYS-DSTNQVYSIGIYGELTTWCVRQRNLPKPYITPSRRPNPLRNTQNVDIDPKATSREGLLKDPFTSDSKLTLAKSINHSLKLQPVHCADLRVSSESDKEHLAVIGYGKESRGILTAIAPTGSINSNFKYFEGFSRANIEAPTSVCVHPYQTLVGAGLED 4861
            QIF+ +    P ++KFHP+ + +AV D+  +  W+WE G++  Y  + +                   IT++E++N ++    L+L  T DG I++W+N+  D+ ++P++VTAW  L D + + R                 +G++  W Q  G L  SGDV+ IRLWD+ +E K+ D+ T ++SCV+S+       LIVAG GDG +++FD R  +NEC +        W+ K +    S   + S+ + G++             Y  P R P  L + Q V         +GL        + L    S+N  + +                       Y              G + SN KY++GF    I A + +  HPY   +  G  D
Sbjct:  953 QIFINRNPGVPSVVKFHPFTSSIAVADKDSICFWDWEKGEKLDYFHNGN--------------PRYTRITAVEYLNGQD--CSLLLTATDDGAIRVWKNFA-DLEKNPEMVTAWQGLSDMLPTTRGLARRVSIYLDRSKQGGAGMVVDWEQETGLLITSGDVRIIRLWDTDRETKVQDIPTGADSCVTSLSCDSHRSLIVAGLGDGSVRVFDRRMALNECRVMTYREHSAWVVKTSLQKQSDGNIVSVSVNGDIR------------YFDP-RMPECLNSLQIV---------KGLTALDIHPQANLFACGSMNQFIAI-----------------------YNG-----------NGELISNIKYYDGFMGQRIGAISCLAFHPYWPHLAVGSND 1275          
BLAST of Regulatory-associated protein of mTOR vs. Ensembl Mouse
Match: Rptor (regulatory associated protein of MTOR, complex 1 [Source:MGI Symbol;Acc:MGI:1921620])

HSP 1 Score: 402.905 bits (1034), Expect = 7.653e-127
Identity = 199/378 (52.65%), Postives = 262/378 (69.31%), Query Frame = 2
Query:   89 LIDIVEEDKS------YPFVAFKARHLNXXXXXXXXXXXXXXKDKVRTLHVVLVLCLNLAVDPPDTLVKVSPCSKMEAWFDPKEKNLNRALEMIGKNLQIQYERWQPKARYRQSLDPTIEEIHRLCQSLRRSAREDRVLFHYNGHGVPRPTENGEIWVFNKAYTKYIPLSLYDLHSWMGGPTVYVFDCNNAGRIIRMMEQFSMKRFENNGTANSS------------SMDNIIILASCQENEDIPQNPEVPADLFTSCLTTPIKIALHWYLLRNQEIFPNYLNETMLELIGGSPSNRVSMFGEINWVFTAVTDTIAWSCLPPPLFQKLFRQDLLVASLFRNFLLAERIMHYYGLRPVSYPPLPKTYEHPMWDAWDHAL 1168
            L+ + EED++       P    K RH  +      L +    KD+++T+ V LVLCLN+ VDPPD +VK +PC+++E W DP      +ALE IG NLQ QYE WQP+ARY+QSLDPT++E+ +LC SLRR+A+E+RVLFHYNGHGVPRPT NGE+WVFNK YT+YIPLS+YDL +WMG P+++V+DC+NAG I++  +QF+++R +    A  +            SM N I LA+C+ +E +P  P++PADLFTSCLTTPIKIAL W+ ++        +   ++E I G  ++R +  GE+NW+FTA+TDTIAW+ LP  LFQKLFRQDLLVASLFRNFLLAERIM  Y   PVS P LP TY H M  A  H+L
Sbjct:   10 LMGLGEEDEADLTDWNLPLAFMKKRHCEKIEGSKSLAQSWRMKDRMKTVSVALVLCLNVGVDPPD-VVKTTPCARLECWIDPLSMGPQKALETIGANLQKQYENWQPRARYKQSLDPTVDEVKKLCTSLRRNAKEERVLFHYNGHGVPRPTVNGEVWVFNKNYTQYIPLSIYDLQTWMGSPSIFVYDCSNAGLIVKSFKQFALQREQELEVAAINPNHPLAQMPLPPSMKNCIQLAACEAHELLPMIPDLPADLFTSCLTTPIKIALRWFCMQKCVSLVPGVTLDLIEKIPGRLNDRRTPLGELNWIFTAITDTIAWNVLPRDLFQKLFRQDLLVASLFRNFLLAERIMRSYNCTPVSSPRLPPTYMHAMCTA--HSL 384          
BLAST of Regulatory-associated protein of mTOR vs. Ensembl Mouse
Match: Rptor (regulatory associated protein of MTOR, complex 1 [Source:MGI Symbol;Acc:MGI:1921620])

HSP 1 Score: 431.409 bits (1108), Expect = 1.185e-126
Identity = 208/398 (52.26%), Postives = 273/398 (68.59%), Query Frame = 2
Query:   89 LIDIVEEDKS------YPFVAFKARHLNXXXXXXXXXXXXXXKDKVRTLHVVLVLCLNLAVDPPDTLVKVSPCSKMEAWFDPKEKNLNRALEMIGKNLQIQYERWQPKARYRQSLDPTIEEIHRLCQSLRRSAREDRVLFHYNGHGVPRPTENGEIWVFNKAYTKYIPLSLYDLHSWMGGPTVYVFDCNNAGRIIRMMEQFSMKRFENNGTAN------------SSSMDNIIILASCQENEDIPQNPEVPADLFTSCLTTPIKIALHWYLLRNQEIFPNYLNETMLELIGGSPSNRVSMFGEINWVFTAVTDTIAWSCLPPPLFQKLFRQDLLVASLFRNFLLAERIMHYYGLRPVSYPPLPKTYEHPMWDAWDHALDCYTSQLPEIYHKKQSMNNS 1228
            L+ + EED++       P    K RH  +      L +    KD+++T+ V LVLCLN+ VDPPD +VK +PC+++E W DP      +ALE IG NLQ QYE WQP+ARY+QSLDPT++E+ +LC SLRR+A+E+RVLFHYNGHGVPRPT NGE+WVFNK YT+YIPLS+YDL +WMG P+++V+DC+NAG I++  +QF+++R +    A               SM N I LA+C+ +E +P  P++PADLFTSCLTTPIKIAL W+ ++        +   ++E I G  ++R +  GE+NW+FTA+TDTIAW+ LP  LFQKLFRQDLLVASLFRNFLLAERIM  Y   PVS P LP TY H MW AWD A+D   SQLP I  +  +  +S
Sbjct:   10 LMGLGEEDEADLTDWNLPLAFMKKRHCEKIEGSKSLAQSWRMKDRMKTVSVALVLCLNVGVDPPD-VVKTTPCARLECWIDPLSMGPQKALETIGANLQKQYENWQPRARYKQSLDPTVDEVKKLCTSLRRNAKEERVLFHYNGHGVPRPTVNGEVWVFNKNYTQYIPLSIYDLQTWMGSPSIFVYDCSNAGLIVKSFKQFALQREQELEVAAINPNHPLAQMPLPPSMKNCIQLAACEAHELLPMIPDLPADLFTSCLTTPIKIALRWFCMQKCVSLVPGVTLDLIEKIPGRLNDRRTPLGELNWIFTAITDTIAWNVLPRDLFQKLFRQDLLVASLFRNFLLAERIMRSYNCTPVSSPRLPPTYMHAMWQAWDLAVDICLSQLPTIIEEGTAFRHS 406          

HSP 2 Score: 234.958 bits (598), Expect = 6.975e-62
Identity = 170/474 (35.86%), Postives = 263/474 (55.49%), Query Frame = 2
Query: 1709 FKHTDFFNDHMTAFELWLKTADEKKXXXXXXXXXXXXXXXXXHRYRALRLLSEYMDLGPWAVIQCLTVGIFPYVVRLLQSPVYDVKPYLVFIWGKIISSAQTDFAKNDVVKDAGYKYFVSCLTENEPY-EIIIKTISAFALAKMLNNNPVGQKLYIKQNFMTVLIEELENNPSDLANDNYIRLRIWFILSFAKLWSDNDDAKWYGVRQQIHEKLLLYLKDISPEVRAATVYALGTFLNNKASDGIRSKHAVQVEQNICQHLLNHSVNDSSPLVRAELVVAMKYMVNLFSNQVMSMAIYYDVWLSQNNHGSINDVNNGKFMGPPSPLANRNVMPSRGSIEKISKRLFVHSPPALTDKISVRQKAVSSGDLTNFDENNNTFWLFKDSHIPFILPDMYLYGNINSTRGNLKNLGAELSFRPTFIKKVPAVSNFTTYNS--GFPIINIYAQMWFSLILLSKDPYPKVSILASKIVEAI 3121
            F+H+ FF + +TAF++WL    E +  P QLPI+LQVLLSQVHR RAL LL  ++DLGPWAV   L+VGIFPYV++LLQS   +++P LVFIW KI++   +   + D+VKD G+KYF+S L   +PY     +T++AF LA ++N+   GQ+  ++ N + + +E+L        +D +  LR W  +   ++W + D A+W GVR   HEKL   L D  PEVR A V+ALGTF+ N A    R+ H+  ++ N+   +L   +ND SP+VR ELVVA+ ++V  + +   ++A+ +              +   K    PSP A        GS+  +          +++   ++R  AV++    N    N +      S + F   ++    + +ST G+ +N    LSF    I K+  VS+++  NS  G    ++Y Q+W  L+ L+ DPYP VS LA K++ +I
Sbjct:  403 FRHSPFFAEQLTAFQVWLTMGVENRSPPEQLPIVLQVLLSQVHRLRALDLLGRFLDLGPWAVSLALSVGIFPYVLKLLQSSARELRPLLVFIWAKILAVDSS--CQADLVKDNGHKYFLSVLA--DPYMPAEHRTMTAFILAVIVNSYTTGQEACLQGNLIAICLEQL--------SDPHPLLRQWVAICLGRIWQNFDSARWCGVRDSAHEKLYSLLSDPIPEVRCAAVFALGTFVGNSAE---RTDHSTTIDHNVAM-MLAQLINDGSPMVRKELVVALSHLVVQYESNFCTVALQF--------------MEEEKNYPLPSPAATEG-----GSLTPVRDSPCTPRLRSVSSYGNIR--AVTTARNLNKSLQNLSLTEESGSSVAFSPGNLSTSSSASSTLGSPENEEYILSFET--IDKMRRVSSYSALNSLIGVSFNSVYTQIWRVLLHLAADPYPDVSDLAMKVLNSI 837          

HSP 3 Score: 152.14 bits (383), Expect = 2.319e-36
Identity = 83/281 (29.54%), Postives = 151/281 (53.74%), Query Frame = 2
Query: 3602 HVIDSAKYEDRNERLKKQKNIKLEGAQNWKASLNSSGTQLS-QIFLQKIDSKPELLKFHPYLNYLAVVDRSGVSLWNWESGQRAQYMLSQSVSCKXXXXXXXXXXXXXXXXXXLEFINAEEDRGGLILVGTMDGRIKIWRNYLRDMGQDPDIVTAWIALPDQICSNRPSGLITHWSQSLGQLTISGDVKYIRLWDSLQECKISDMNTNSESCVSSIDRSQDGRLIVAGFGDGHIKMFDIRAPVNECVINAGVGDMGWIHKVAY--SDSTNQVYSIGIYGEL 4435
            H ++S   ++R  R  +   ++ +  Q  +  +    T+L  QIFL +    P ++KFHP+   +AV D+  +  W+WE G++  Y  + +                   +T++E++N ++    L+L  T DG I++W+N+  D+ ++P++VTAW  L D + + R +G++  W Q  G L  SGDV+ +R+WD+ +E K+ D+ T ++SCV+S+       LIVAG GDG I+++D R  ++EC +        W+ K AY        + S+ + G++
Sbjct:  978 HDLESQIRKEREWRFLRNTRVRKQAQQVIQKGI----TRLDDQIFLNRNPGVPSVVKFHPFTPCIAVADKDSICFWDWEKGEKLDYFHNGN--------------PRYTRVTAMEYLNGQD--CSLLLTATDDGAIRVWKNFA-DLEKNPEMVTAWQGLSDMLPTTRGAGMVVDWEQETGLLMSSGDVRIVRIWDTDRETKVQDIPTGADSCVTSLSCDSHRSLIVAGLGDGSIRVYDRRMALSECRVMTYREHTAWVVK-AYLQKHPEGHIVSVSVNGDV 1236          
BLAST of Regulatory-associated protein of mTOR vs. Ensembl Mouse
Match: Rptor (regulatory associated protein of MTOR, complex 1 [Source:MGI Symbol;Acc:MGI:1921620])

HSP 1 Score: 127.102 bits (318), Expect = 5.821e-33
Identity = 72/208 (34.62%), Postives = 110/208 (52.88%), Query Frame = 2
Query: 1937 LLQSPVYDVKPYLVFIWGKIISSAQTDFAKNDVVKDAGYKYFVSCLTENEPYEIIIKTISAFALAKMLNNNPVGQKLYIKQNFMTVLIEELENNPSDLANDNYIRLRIWFILSFAKLWSDNDDAKWYGVRQQIHEKLLLYLKDISPEVRAATVYALGTFLNNKASDGIRSKHAVQVEQNICQHLLNHSVNDSSPLVRAELVVAMKYMV 2560
            LLQS   +++P LVFIW KI++   +   + D+VKD G+KYF+S L +                       P   +  ++ N + + +E+L        +D +  LR W  +   ++W + D A+W GVR   HEKL   L D  PEVR A V+ALGTF+ N A    R+ H+  ++ N+   +L   +ND SP+VR ELVVA+ ++V
Sbjct:    1 LLQSSARELRPLLVFIWAKILAVDSS--CQADLVKDNGHKYFLSVLAD-----------------------PYMPEACLQGNLIAICLEQL--------SDPHPLLRQWVAICLGRIWQNFDSARWCGVRDSAHEKLYSLLSDPIPEVRCAAVFALGTFVGNSAE---RTDHSTTIDHNVAM-MLAQLINDGSPMVRKELVVALSHLV 171          
BLAST of Regulatory-associated protein of mTOR vs. Ensembl Mouse
Match: Rptor (regulatory associated protein of MTOR, complex 1 [Source:MGI Symbol;Acc:MGI:1921620])

HSP 1 Score: 110.538 bits (275), Expect = 3.859e-28
Identity = 55/82 (67.07%), Postives = 62/82 (75.61%), Query Frame = 2
Query:  908 GSPSNRVSMFGEINWVFTAVTDTIAWSCLPPPLFQKLFRQDLLVASLFRNFLLAERIMHYYGLRPVSYPPLPKTYEHPMWDA 1153
            G  ++R +  GE+NW+FTA+TDTIAW+ LP  LFQKLFRQDLLVASLFRNFLLAERIM  Y   PVS P LP TY H M  A
Sbjct:    2 GRLNDRRTPLGELNWIFTAITDTIAWNVLPRDLFQKLFRQDLLVASLFRNFLLAERIMRSYNCTPVSSPRLPPTYMHAMCTA 83          
BLAST of Regulatory-associated protein of mTOR vs. UniProt/SwissProt
Match: sp|Q8N122|RPTOR_HUMAN (Regulatory-associated protein of mTOR OS=Homo sapiens OX=9606 GN=RPTOR PE=1 SV=1)

HSP 1 Score: 431.795 bits (1109), Expect = 5.723e-126
Identity = 208/398 (52.26%), Postives = 272/398 (68.34%), Query Frame = 2
Query:   89 LIDIVEEDKS------YPFVAFKARHLNXXXXXXXXXXXXXXKDKVRTLHVVLVLCLNLAVDPPDTLVKVSPCSKMEAWFDPKEKNLNRALEMIGKNLQIQYERWQPKARYRQSLDPTIEEIHRLCQSLRRSAREDRVLFHYNGHGVPRPTENGEIWVFNKAYTKYIPLSLYDLHSWMGGPTVYVFDCNNAGRIIRMMEQFSMKRFENNGTAN------------SSSMDNIIILASCQENEDIPQNPEVPADLFTSCLTTPIKIALHWYLLRNQEIFPNYLNETMLELIGGSPSNRVSMFGEINWVFTAVTDTIAWSCLPPPLFQKLFRQDLLVASLFRNFLLAERIMHYYGLRPVSYPPLPKTYEHPMWDAWDHALDCYTSQLPEIYHKKQSMNNS 1228
            L+ + EED++       P    K RH  +      L +    KD+++T+ V LVLCLN+ VDPPD +VK +PC+++E W DP      +ALE IG NLQ QYE WQP+ARY+QSLDPT++E+ +LC SLRR+A+E+RVLFHYNGHGVPRPT NGE+WVFNK YT+YIPLS+YDL +WMG P+++V+DC+NAG I++  +QF+++R +    A               SM N I LA+C+  E +P  P++PADLFTSCLTTPIKIAL W+ ++        +   ++E I G  ++R +  GE+NW+FTA+TDTIAW+ LP  LFQKLFRQDLLVASLFRNFLLAERIM  Y   PVS P LP TY H MW AWD A+D   SQLP I  +  +  +S
Sbjct:   10 LLGLGEEDEADLTDWNLPLAFMKKRHCEKIEGSKSLAQSWRMKDRMKTVSVALVLCLNVGVDPPD-VVKTTPCARLECWIDPLSMGPQKALETIGANLQKQYENWQPRARYKQSLDPTVDEVKKLCTSLRRNAKEERVLFHYNGHGVPRPTVNGEVWVFNKNYTQYIPLSIYDLQTWMGSPSIFVYDCSNAGLIVKSFKQFALQREQELEVAAINPNHPLAQMPLPPSMKNCIQLAACEATELLPMIPDLPADLFTSCLTTPIKIALRWFCMQKCVSLVPGVTLDLIEKIPGRLNDRRTPLGELNWIFTAITDTIAWNVLPRDLFQKLFRQDLLVASLFRNFLLAERIMRSYNCTPVSSPRLPPTYMHAMWQAWDLAVDICLSQLPTIIEEGTAFRHS 406          

HSP 2 Score: 232.646 bits (592), Expect = 2.672e-60
Identity = 167/474 (35.23%), Postives = 262/474 (55.27%), Query Frame = 2
Query: 1709 FKHTDFFNDHMTAFELWLKTADEKKXXXXXXXXXXXXXXXXXHRYRALRLLSEYMDLGPWAVIQCLTVGIFPYVVRLLQSPVYDVKPYLVFIWGKIISSAQTDFAKNDVVKDAGYKYFVSCLTENEPY-EIIIKTISAFALAKMLNNNPVGQKLYIKQNFMTVLIEELENNPSDLANDNYIRLRIWFILSFAKLWSDNDDAKWYGVRQQIHEKLLLYLKDISPEVRAATVYALGTFLNNKASDGIRSKHAVQVEQNICQHLLNHSVNDSSPLVRAELVVAMKYMVNLFSNQVMSMAIYYDVWLSQNNHGSINDVNNGKFMGPPSPLANRNVMPSRGSIEKISKRLFVHSPPALTDKISVRQKAVSSGDLTNFDENNNTFWLFKDSHIPFILPDMYLYGNINSTRGNLKNLGAELSFRPTFIKKVPAVSNFTTYNS--GFPIINIYAQMWFSLILLSKDPYPKVSILASKIVEAI 3121
            F+H+ FF + +TAF++WL    E +  P QLPI+LQVLLSQVHR RAL LL  ++DLGPWAV   L+VGIFPYV++LLQS   +++P LVFIW KI++   +   + D+VKD G+KYF+S L   +PY     +T++AF LA ++N+   GQ+  ++ N + + +E+L        ND +  LR W  +   ++W + D A+W GVR   HEKL   L D  PEVR A V+ALGTF+ N A    R+ H+  ++ N+   +L   V+D SP+VR ELVVA+ ++V  + +   ++A+ +              +   K    PSP          GS+  +          +++   ++R  AV++    N    N +        + F   ++    + +ST G+ +N    LSF    I K+   S++++ NS  G    ++Y Q+W  L+ L+ DPYP+VS +A K++ +I
Sbjct:  403 FRHSPFFAEQLTAFQVWLTMGVENRNPPEQLPIVLQVLLSQVHRLRALDLLGRFLDLGPWAVSLALSVGIFPYVLKLLQSSARELRPLLVFIWAKILAVDSS--CQADLVKDNGHKYFLSVLA--DPYMPAEHRTMTAFILAVIVNSYHTGQEACLQGNLIAICLEQL--------NDPHPLLRQWVAICLGRIWQNFDSARWCGVRDSAHEKLYSLLSDPIPEVRCAAVFALGTFVGNSAE---RTDHSTTIDHNVAM-MLAQLVSDGSPMVRKELVVALSHLVVQYESNFCTVALQF--------------IEEEKNYALPSPATTEG-----GSLTPVRDSPCTPRLRSVSSYGNIR--AVATARSLNKSLQNLSLTEESGGAVAFSPGNLSTSSSASSTLGSPENEEHILSFET--IDKMRRASSYSSLNSLIGVSFNSVYTQIWRVLLHLAADPYPEVSDVAMKVLNSI 837          

HSP 3 Score: 153.295 bits (386), Expect = 6.819e-36
Identity = 81/280 (28.93%), Postives = 151/280 (53.93%), Query Frame = 2
Query: 3602 HVIDSAKYEDRNERLKKQKNIKLEGAQNWKASLNSSGTQLS-QIFLQKIDSKPELLKFHPYLNYLAVVDRSGVSLWNWESGQRAQYMLSQSVSCKXXXXXXXXXXXXXXXXXXLEFINAEEDRGGLILVGTMDGRIKIWRNYLRDMGQDPDIVTAWIALPDQICSNRPSGLITHWSQSLGQLTISGDVKYIRLWDSLQECKISDMNTNSESCVSSIDRSQDGRLIVAGFGDGHIKMFDIRAPVNECVINAGVGDMGWIHKVAYSDSTN-QVYSIGIYGEL 4435
            H ++S   ++R  R  +   ++ +  Q  +  +    T+L  QIFL +    P ++KFHP+   +AV D+  +  W+WE G++  Y  + +                   +T++E++N ++    L+L  T DG I++W+N+  D+ ++P++VTAW  L D + + R +G++  W Q  G L  SGDV+ +R+WD+ +E K+ D+ T ++SCV+S+       LIVAG GDG I+++D R  ++EC +        W+ K +     +  + S+ + G++
Sbjct:  978 HDLESQIRKEREWRFLRNSRVRRQAQQVIQKGI----TRLDDQIFLNRNPGVPSVVKFHPFTPCIAVADKDSICFWDWEKGEKLDYFHNGN--------------PRYTRVTAMEYLNGQD--CSLLLTATDDGAIRVWKNFA-DLEKNPEMVTAWQGLSDMLPTTRGAGMVVDWEQETGLLMSSGDVRIVRIWDTDREMKVQDIPTGADSCVTSLSCDSHRSLIVAGLGDGSIRVYDRRMALSECRVMTYREHTAWVVKASLQKRPDGHIVSVSVNGDV 1236          
BLAST of Regulatory-associated protein of mTOR vs. UniProt/SwissProt
Match: sp|Q8K4Q0|RPTOR_MOUSE (Regulatory-associated protein of mTOR OS=Mus musculus OX=10090 GN=Rptor PE=1 SV=1)

HSP 1 Score: 431.795 bits (1109), Expect = 5.950e-126
Identity = 208/398 (52.26%), Postives = 273/398 (68.59%), Query Frame = 2
Query:   89 LIDIVEEDKS------YPFVAFKARHLNXXXXXXXXXXXXXXKDKVRTLHVVLVLCLNLAVDPPDTLVKVSPCSKMEAWFDPKEKNLNRALEMIGKNLQIQYERWQPKARYRQSLDPTIEEIHRLCQSLRRSAREDRVLFHYNGHGVPRPTENGEIWVFNKAYTKYIPLSLYDLHSWMGGPTVYVFDCNNAGRIIRMMEQFSMKRFENNGTAN------------SSSMDNIIILASCQENEDIPQNPEVPADLFTSCLTTPIKIALHWYLLRNQEIFPNYLNETMLELIGGSPSNRVSMFGEINWVFTAVTDTIAWSCLPPPLFQKLFRQDLLVASLFRNFLLAERIMHYYGLRPVSYPPLPKTYEHPMWDAWDHALDCYTSQLPEIYHKKQSMNNS 1228
            L+ + EED++       P    K RH  +      L +    KD+++T+ V LVLCLN+ VDPPD +VK +PC+++E W DP      +ALE IG NLQ QYE WQP+ARY+QSLDPT++E+ +LC SLRR+A+E+RVLFHYNGHGVPRPT NGE+WVFNK YT+YIPLS+YDL +WMG P+++V+DC+NAG I++  +QF+++R +    A               SM N I LA+C+ +E +P  P++PADLFTSCLTTPIKIAL W+ ++        +   ++E I G  ++R +  GE+NW+FTA+TDTIAW+ LP  LFQKLFRQDLLVASLFRNFLLAERIM  Y   PVS P LP TY H MW AWD A+D   SQLP I  +  +  +S
Sbjct:   10 LMGLGEEDEADLTDWNLPLAFMKKRHCEKIEGSKSLAQSWRMKDRMKTVSVALVLCLNVGVDPPD-VVKTTPCARLECWIDPLSMGPQKALETIGANLQKQYENWQPRARYKQSLDPTVDEVKKLCTSLRRNAKEERVLFHYNGHGVPRPTVNGEVWVFNKNYTQYIPLSIYDLQTWMGSPSIFVYDCSNAGLIVKSFKQFALQREQELEVAAINPNHPLAQMPLPPSMKNCIQLAACEAHELLPMIPDLPADLFTSCLTTPIKIALRWFCMQKCVSLVPGVTLDLIEKIPGRLNDRRTPLGELNWIFTAITDTIAWNVLPRDLFQKLFRQDLLVASLFRNFLLAERIMRSYNCTPVSSPRLPPTYMHAMWQAWDLAVDICLSQLPTIIEEGTAFRHS 406          

HSP 2 Score: 234.958 bits (598), Expect = 4.398e-61
Identity = 170/474 (35.86%), Postives = 263/474 (55.49%), Query Frame = 2
Query: 1709 FKHTDFFNDHMTAFELWLKTADEKKXXXXXXXXXXXXXXXXXHRYRALRLLSEYMDLGPWAVIQCLTVGIFPYVVRLLQSPVYDVKPYLVFIWGKIISSAQTDFAKNDVVKDAGYKYFVSCLTENEPY-EIIIKTISAFALAKMLNNNPVGQKLYIKQNFMTVLIEELENNPSDLANDNYIRLRIWFILSFAKLWSDNDDAKWYGVRQQIHEKLLLYLKDISPEVRAATVYALGTFLNNKASDGIRSKHAVQVEQNICQHLLNHSVNDSSPLVRAELVVAMKYMVNLFSNQVMSMAIYYDVWLSQNNHGSINDVNNGKFMGPPSPLANRNVMPSRGSIEKISKRLFVHSPPALTDKISVRQKAVSSGDLTNFDENNNTFWLFKDSHIPFILPDMYLYGNINSTRGNLKNLGAELSFRPTFIKKVPAVSNFTTYNS--GFPIINIYAQMWFSLILLSKDPYPKVSILASKIVEAI 3121
            F+H+ FF + +TAF++WL    E +  P QLPI+LQVLLSQVHR RAL LL  ++DLGPWAV   L+VGIFPYV++LLQS   +++P LVFIW KI++   +   + D+VKD G+KYF+S L   +PY     +T++AF LA ++N+   GQ+  ++ N + + +E+L        +D +  LR W  +   ++W + D A+W GVR   HEKL   L D  PEVR A V+ALGTF+ N A    R+ H+  ++ N+   +L   +ND SP+VR ELVVA+ ++V  + +   ++A+ +              +   K    PSP A        GS+  +          +++   ++R  AV++    N    N +      S + F   ++    + +ST G+ +N    LSF    I K+  VS+++  NS  G    ++Y Q+W  L+ L+ DPYP VS LA K++ +I
Sbjct:  403 FRHSPFFAEQLTAFQVWLTMGVENRSPPEQLPIVLQVLLSQVHRLRALDLLGRFLDLGPWAVSLALSVGIFPYVLKLLQSSARELRPLLVFIWAKILAVDSS--CQADLVKDNGHKYFLSVLA--DPYMPAEHRTMTAFILAVIVNSYTTGQEACLQGNLIAICLEQL--------SDPHPLLRQWVAICLGRIWQNFDSARWCGVRDSAHEKLYSLLSDPIPEVRCAAVFALGTFVGNSAE---RTDHSTTIDHNVAM-MLAQLINDGSPMVRKELVVALSHLVVQYESNFCTVALQF--------------MEEEKNYPLPSPAATEG-----GSLTPVRDSPCTPRLRSVSSYGNIR--AVTTARNLNKSLQNLSLTEESGSSVAFSPGNLSTSSSASSTLGSPENEEYILSFET--IDKMRRVSSYSALNSLIGVSFNSVYTQIWRVLLHLAADPYPDVSDLAMKVLNSI 837          

HSP 3 Score: 152.14 bits (383), Expect = 1.554e-35
Identity = 83/281 (29.54%), Postives = 151/281 (53.74%), Query Frame = 2
Query: 3602 HVIDSAKYEDRNERLKKQKNIKLEGAQNWKASLNSSGTQLS-QIFLQKIDSKPELLKFHPYLNYLAVVDRSGVSLWNWESGQRAQYMLSQSVSCKXXXXXXXXXXXXXXXXXXLEFINAEEDRGGLILVGTMDGRIKIWRNYLRDMGQDPDIVTAWIALPDQICSNRPSGLITHWSQSLGQLTISGDVKYIRLWDSLQECKISDMNTNSESCVSSIDRSQDGRLIVAGFGDGHIKMFDIRAPVNECVINAGVGDMGWIHKVAY--SDSTNQVYSIGIYGEL 4435
            H ++S   ++R  R  +   ++ +  Q  +  +    T+L  QIFL +    P ++KFHP+   +AV D+  +  W+WE G++  Y  + +                   +T++E++N ++    L+L  T DG I++W+N+  D+ ++P++VTAW  L D + + R +G++  W Q  G L  SGDV+ +R+WD+ +E K+ D+ T ++SCV+S+       LIVAG GDG I+++D R  ++EC +        W+ K AY        + S+ + G++
Sbjct:  978 HDLESQIRKEREWRFLRNTRVRKQAQQVIQKGI----TRLDDQIFLNRNPGVPSVVKFHPFTPCIAVADKDSICFWDWEKGEKLDYFHNGN--------------PRYTRVTAMEYLNGQD--CSLLLTATDDGAIRVWKNF-ADLEKNPEMVTAWQGLSDMLPTTRGAGMVVDWEQETGLLMSSGDVRIVRIWDTDRETKVQDIPTGADSCVTSLSCDSHRSLIVAGLGDGSIRVYDRRMALSECRVMTYREHTAWVVK-AYLQKHPEGHIVSVSVNGDV 1236          
BLAST of Regulatory-associated protein of mTOR vs. UniProt/SwissProt
Match: sp|Q0IQN5|RTOR2_ORYSJ (Regulatory-associated protein of TOR 2 OS=Oryza sativa subsp. japonica OX=39947 GN=RAPTOR2 PE=1 SV=2)

HSP 1 Score: 399.053 bits (1024), Expect = 1.809e-114
Identity = 182/334 (54.49%), Postives = 253/334 (75.75%), Query Frame = 2
Query:  197 KDKVRTLHVVLVLCLNLAVDPPDTLVKVSPCSKMEAWFDPKEKNLNRALEMIGKNLQIQYERWQPKARYRQSLDPTIEEIHRLCQSLRRSAREDRVLFHYNGHGVPRPTENGEIWVFNKAYTKYIPLSLYDLHSWMGGPTVYVFDCNNAGRIIRMMEQFSMKRFENNGTANSSSMDNIIILASCQENEDIPQNPEVPADLFTSCLTTPIKIALHWYLLRNQEIFPNYLNETMLELIGGSPSNRVSMFGEINWVFTAVTDTIAWSCLPPPLFQKLFRQDLLVASLFRNFLLAERIMHYYGLRPVSYPPLPKTYEHPMWDAWDHALDCYTSQLPEI 1198
            KD+++T  V LVLCLN++VDPPD ++K+SPC++ E W DP      +ALE IGK L  QYERWQPKARY+  LDPT+EE+ +LC + R+ AR +RVLFHYNGHGVP+PT NGEIWVFNK+YT+YIPL + DL SW+  P++YVFDC+ AG I++      ++R + + ++++SS  + I+LA+C+ ++ +PQ+ E PAD+FT+CLTTPIK+ALHW+   N+ +  + +   +++ I G  ++R ++ GE+NW+FTA+TDTIAW+ LP  LFQ+LFRQDLLVASLFRNFLLAERIM      P+SYP LP T++H MWDAWD A +   S+LP++
Sbjct:  102 KDRMKTGCVALVLCLNISVDPPD-VIKISPCARKECWIDPFSMAPPKALETIGKTLHSQYERWQPKARYKLQLDPTLEEVKKLCNTCRKFARTERVLFHYNGHGVPKPTANGEIWVFNKSYTQYIPLPITDLDSWLKTPSIYVFDCSAAGMIVKAF----LERLDWSSSSSASSSKDCILLAACEAHQTLPQSAEFPADVFTACLTTPIKMALHWFC--NRSLLRDSMEHNLIDQIPGRQNDRKTLLGELNWIFTAITDTIAWNVLPHDLFQRLFRQDLLVASLFRNFLLAERIMRSANCSPISYPLLPPTHQHHMWDAWDMAAEICLSKLPQL 428          

HSP 2 Score: 167.548 bits (423), Expect = 2.889e-40
Identity = 121/335 (36.12%), Postives = 187/335 (55.82%), Query Frame = 2
Query: 1709 FKHTDFFNDHMTAFELWLKTADEKKXXXXXXXXXXXXXXXXXHRYRALRLLSEYMDLGPWAVIQCLTVGIFPYVVRLLQSPVYDVKPYLVFIWGKIISSAQTDFAKNDVVKDAGYKYFVSCLTENEPYEIIIKTISAFALAKMLNNNPVGQKLYIKQNFMTVLIEELE-NNPSDLANDNYIRLRIWFILSFAKLWSDNDDAKWYGVRQQIHEKLLLYLKDISPEVRAATVYALGTFLN------NKASDGIRSKHAVQVEQNICQHLLNHSVNDSSPLVRAELVVAMKYMVNLFSNQVMSMAIYYDVWLSQNNH-----GSINDVNNGKFMGPPS 2677
            F+ + FF + +TAFE+WL    E K  P QLPI+LQVLLSQ HR+RAL LL  ++D+GPWAV   L+VGIFPYV++LLQ+   +++  LVFIW KI+S  ++   + D+VKD G+ YF+  L   + Y    + ++AF LA +++ + +GQ+       + V +  L+  NP+D   +  +   +   L   KLW D  +A+  G++    E ++  L +  PEVRA+ V+ALG  ++      N A D       V+ E N+ + LL  S +D SPLVR+E+ VA+       +  + S+A  Y  W  Q N       S+ ++N+     P S
Sbjct:  436 FQPSPFFTEQLTAFEVWLDHGSEDKKPPEQLPIVLQVLLSQSHRFRALVLLGRFLDMGPWAVDLALSVGIFPYVLKLLQTSAMELRQILVFIWTKILSLDKS--CQVDLVKDGGHAYFIRFLDSLDAYP-EQRAMAAFVLAVIVDGHRIGQEACANAGLIDVCLRHLQPENPNDAQTEPLLLQWL--CLCLGKLWEDFPEAQLLGLQSNAPEIVICLLSEPQPEVRASAVFALGNLVDIGSPSLNGADDDSDDDEKVRAEINVVRSLLQIS-SDGSPLVRSEVAVALTRFAMGHNKHIKSVAAEY--WKPQTNSLLKSLPSLANINSSNVYSPSS 762          

HSP 3 Score: 70.0922 bits (170), Expect = 2.029e-10
Identity = 44/130 (33.85%), Postives = 74/130 (56.92%), Query Frame = 2
Query: 3938 LEFINAEEDRGGLILVGTMDGRIKIWRNYLRDMGQDPDIVTAWIALPDQICSNRPSGLITHWSQSLGQLTISGDVKYIRLWDSLQECKISDMNTNSESCVSSIDRSQ-DGRLIVAGFGDGHIKMFDIRAP 4324
            L  IN  +D   L+LVG+ DG ++IWRNY +  GQ   +VTA+ ++     + R   ++  W Q  G L  SGD+  I +WD L + +++ + + ++S +S++  SQ       AGF D  +++FD+R P
Sbjct: 1094 LLLINELDD--SLLLVGSSDGNVRIWRNYTQKGGQ--KLVTAFSSVQGYRSAGR--SIVFDWQQQSGYLYASGDMSSILVWD-LDKEQVNTIQSTADSGISALSASQVRCGQFAAGFLDASVRIFDVRTP 1216          
BLAST of Regulatory-associated protein of mTOR vs. UniProt/SwissProt
Match: sp|Q93YQ1|RTOR1_ARATH (Regulatory-associated protein of TOR 1 OS=Arabidopsis thaliana OX=3702 GN=RAPTOR1 PE=1 SV=1)

HSP 1 Score: 388.652 bits (997), Expect = 5.646e-111
Identity = 180/334 (53.89%), Postives = 248/334 (74.25%), Query Frame = 2
Query:  197 KDKVRTLHVVLVLCLNLAVDPPDTLVKVSPCSKMEAWFDPKEKNLNRALEMIGKNLQIQYERWQPKARYRQSLDPTIEEIHRLCQSLRRSAREDRVLFHYNGHGVPRPTENGEIWVFNKAYTKYIPLSLYDLHSWMGGPTVYVFDCNNAGRIIRMMEQFSMKRFENNGTANSSSMDNIIILASCQENEDIPQNPEVPADLFTSCLTTPIKIALHWYLLRNQEIFPNYLNETMLELIGGSPSNRVSMFGEINWVFTAVTDTIAWSCLPPPLFQKLFRQDLLVASLFRNFLLAERIMHYYGLRPVSYPPLPKTYEHPMWDAWDHALDCYTSQLPEI 1198
            K++++T  V LVLCLN+ VDPPD ++K+SPC+++EAW DP      +ALE IGKNL  QYERWQP+ARY+  LDPT++E+ +LC + R+ A+ +RVLFHYNGHGVP+PT NGEIWVFNK+YT+YIPL + +L SW+  P++YVFDC+ A  I+    +      +   + +S S  + I+LA+C  +E +PQ+ E PAD+FTSCLTTPIK+AL W+  R+  +    ++E++++ I G  ++R ++ GE+NW+FTAVTDTIAW+ LP  LFQ+LFRQDLLVASLFRNFLLAERIM      P+S+P LP T++H MWDAWD A +   SQLP++
Sbjct:  101 KERMKTGCVALVLCLNITVDPPD-VIKISPCARIEAWIDPFSMAPPKALETIGKNLSTQYERWQPRARYKVQLDPTVDEVRKLCLTCRKYAKTERVLFHYNGHGVPKPTANGEIWVFNKSYTQYIPLPISELDSWLKTPSIYVFDCSAARMILNAFAEL----HDWGSSGSSGSSRDCILLAACDVHETLPQSVEFPADVFTSCLTTPIKMALKWFCRRS--LLKEIIDESLIDRIPGRQNDRKTLLGELNWIFTAVTDTIAWNVLPHELFQRLFRQDLLVASLFRNFLLAERIMRSANCNPISHPMLPPTHQHHMWDAWDMAAEICLSQLPQL 427          

HSP 2 Score: 168.703 bits (426), Expect = 1.454e-40
Identity = 124/331 (37.46%), Postives = 183/331 (55.29%), Query Frame = 2
Query: 1709 FKHTDFFNDHMTAFELWLKTADEKKXXXXXXXXXXXXXXXXXHRYRALRLLSEYMDLGPWAVIQCLTVGIFPYVVRLLQSPVYDVKPYLVFIWGKIISSAQTDFAKNDVVKDAGYKYFVSCLTENEPYEIIIKTISAFALAKMLNNNPVGQKLYIKQNFMTVLIEELE-NNPSDLANDNYIRLRIWFILSFAKLWSDNDDAKWYGVRQQIHEKLLLYLKDISPEVRAATVYALGTFLN-----NKA--SDGIRSKHAVQVEQNICQHLLNHSVNDSSPLVRAELVVAMKYMVNLFSNQVMSMAIYYDVWLSQNNHGSINDVNNGKFMGPPS 2677
            F+ + FF + +TAFE+WL    E K  P QLPI+LQVLLSQ HR+RAL LL  ++D+G WAV   L+VGIFPYV++LLQ+   +++  LVFIW KI++  ++   + D+VKD G+ YF+  L  +  +    + ++AF LA +++ +  GQ+  ++ N + V +  LE + PSD   +       W  L   KLW D  +A+  G      EKL   L +  PEVRAA V+ALGT L+     NK+   D       ++ E  I + LL+  V+D SPLVRAE+ VA+          +   A  Y  W  Q++    +  +  KF  P S
Sbjct:  435 FQPSPFFTEQLTAFEVWLDHGSEHKKPPEQLPIVLQVLLSQCHRFRALVLLGRFLDMGSWAVDLALSVGIFPYVLKLLQTTTNELRQILVFIWTKILALDKS--CQIDLVKDGGHTYFIRFLDSSGAFP-EQRAMAAFVLAVIVDGHRRGQEACLEANLIGVCLGHLEASRPSDPQPEPLFLQ--WLCLCLGKLWEDFMEAQIMGREANAFEKLAPLLSEPQPEVRAAAVFALGTLLDIGFDSNKSVVEDEFDDDEKIRAEDAIIKSLLD-VVSDGSPLVRAEVAVALARFAFGHKQHLKLAAASY--WKPQSSSLLTSLPSIAKFHDPGS 757          

HSP 3 Score: 74.7146 bits (182), Expect = 8.106e-12
Identity = 77/310 (24.84%), Postives = 128/310 (41.29%), Query Frame = 2
Query: 3938 LEFINAEEDRGGLILVGTMDGRIKIWRNYLRDMGQDPDIVTAWIALPDQICSNRPSGLITHWSQSLGQLTISGDVKYIRLWDSLQECKISDMNTNSESCVSSIDRSQ-DGRLIVAGFGDGHIKMFDIRAPVNECVINAGVGDMGWIHKVAYSDSTNQVYSIGIYGELTTWCVRQRNLPKPYITPSRRPNPLRNTQNVDIDPKATSREGLLKDPFTSDSKLTLAKSINHSLKLQPVHCADLRVSSESDKEHLAVIGYGKESRGILTAIAPTGSINSNFKYFEGFSRANIEAPTSVCVHPYQTLVGAGLEDS 4864
            L  IN  +D   L+LV + DG ++IW+NY     Q   +VT + ++       R    +  W Q  G L  SG+   + LWD  +E  +  + + SE  V+++  SQ  G  + AGF DG ++++D+R+P  E ++ A                  +V  +                 +P + P++    +  +Q  DI          L    T D+ LT+  +   SL    VH     ++S S K+ + V     E  GI+             +Y+  F    I + + +  HPYQ L+ AG  DS
Sbjct: 1078 LCLINELDD--SLLLVASCDGSVRIWKNYATKGKQK--LVTGFSSIQGHKPGARDLNAVVDWQQQSGYLYASGETSTVTLWDLEKEQLVRSVPSESECGVTALSASQVHGGQLAAGFADGSLRLYDVRSP--EPLVCA----------TRPHQKVERVVGLSF---------------QPGLDPAKV---VSASQAGDIQ--------FLDLRTTRDTYLTI-DAHRGSLTALAVHRHAPIIASGSAKQLIKVFSLQGEQLGII-------------RYYPSFMAQKIGSVSCLTFHPYQVLLAAGAADS 1331          
BLAST of Regulatory-associated protein of mTOR vs. UniProt/SwissProt
Match: sp|P87141|MIP1_SCHPO (Target of rapamycin complex 1 subunit mip1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mip1 PE=1 SV=1)

HSP 1 Score: 382.104 bits (980), Expect = 7.409e-109
Identity = 180/342 (52.63%), Postives = 242/342 (70.76%), Query Frame = 2
Query:  197 KDKVRTLHVVLVLCLNLAVDPPDTLVKVSPCSKMEAWFDPKEKNLNRALEMIGKNLQIQYERWQPKARYRQSLDPTIEEIHRLCQSLRRSAREDRVLFHYNGHGVPRPTENGEIWVFNKAYTKYIPLSLYDLHSWMGGPTVYVFDCNNAGRIIRMMEQFSMKR--------FENNGTANSSSMDNIIILASCQENEDIPQNPEVPADLFTSCLTTPIKIALHWYLLRNQEIFPNYLNETMLELIGGSPSNRVSMFGEINWVFTAVTDTIAWSCLPPPLFQKLFRQDLLVASLFRNFLLAERIMHYYGLRPVSYPPLPKTYEHPMWDAWDHALDCYTSQLPEI 1198
            +++++T+   L++CLN+ VDPPD ++K +P +K E W DP     ++ALE IGKNLQ QYE    + RYR  LDP IEE+ +LC   RR+A+E+R+LFHYNGHGVP PT +GEIWVFNK YT+YIP+SLYDL SW+G P +YV+DC+ AG II    +F+ +R         +N       S  + I LA+C   E +P NP++PADLFTSCLT+PI+I++ WY+L+N   FPN LN  ML  I G   +R +  GE+NW+FTA+TDTIAW+  P  LF++LFRQDL+VA+LFRNFLLAERIM  +   P S P LP T++HPMW++WD A+D   SQLP++
Sbjct:  111 RERLKTVSAALLVCLNIGVDPPD-VIKPNPAAKYECWIDPFSLPASKALEAIGKNLQQQYETLSMRTRYRHYLDPAIEEVKKLCIGQRRNAKEERILFHYNGHGVPMPTASGEIWVFNKNYTQYIPVSLYDLQSWLGAPCIYVYDCSAAGNIIVNFNRFAEQRDKEALRIAKQNPNVLAMPSHTSCIQLAACGPKETLPMNPDLPADLFTSCLTSPIEISVRWYVLQNP--FPNKLNLNMLLKIPGRLQDRRTPLGELNWIFTAITDTIAWNVFPKHLFRRLFRQDLMVAALFRNFLLAERIMLVHSCHPQSSPELPPTHDHPMWNSWDLAIDNCLSQLPDM 449          

HSP 2 Score: 168.703 bits (426), Expect = 1.305e-40
Identity = 125/320 (39.06%), Postives = 180/320 (56.25%), Query Frame = 2
Query: 1703 FPFKHTDFFNDHMTAFELWLKTADEKKXXXXXXXXXXXXXXXXXHRYRALRLLSEYMDLGPWAVIQCLTVGIFPYVVRLLQSPVYDVKPYLVFIWGKIISSAQTDFAKNDVVKDAGYKYFVSCLTENE---PYEIII--KTISAFALAKMLNNNPVGQKLYIKQNFMTVLIEELENNPSDLANDNYIRLRIWFILSFAKLWSDNDDAKWYGVRQQIHEKLLLYLKDISPEVRAATVYALGTFLNNKASDGIRSKHAVQVEQNICQHLLNHSVNDSSPLVRAELVVAMKYMVNLFSNQVMSMAIYYDVW--LSQNNHGSIN 2641
            + +KH+ FF++ +TAFE+WL      +  P QLP++LQVLLSQVHR RAL LLS+++DLG WAV   L++GIFPYV++LLQSP  ++KP LVFIW +I+  A  D  + D++KD GY YFV  L  N    P   I   + + AF L+      P GQ   +    ++  +  L N+P  L       LR W  L  ++LW +  +AKW G R   H KL   + D  PEVRA+ + A  TFL        +++  V VE          +++D+SPLVR ELV+ + + V  +  Q+M +A    +   L + NH SI+
Sbjct:  459 YEYKHSTFFSEQLTAFEVWLSQGLISRKPPDQLPLVLQVLLSQVHRLRALILLSKFLDLGVWAVDLALSIGIFPYVLKLLQSPAIELKPVLVFIWARIL--AVDDSCQADLLKDNGYGYFVQILNPNSSIFPSSNISEHRAMCAFILSVFCRGFPQGQLACLNPQVLSHCLSHL-NSPDSL-------LRQWACLCISQLWENYSEAKWSGTRDNAHVKLAEIIVDSVPEVRASVLTAFTTFLGFPE----KTEEVVAVE-TYIAIAALAALSDASPLVRHELVIFLSHFVVNYKKQLMVVAYESSLADILEKKNHNSIS 763          

HSP 3 Score: 95.5153 bits (236), Expect = 3.195e-18
Identity = 72/277 (25.99%), Postives = 135/277 (48.74%), Query Frame = 2
Query: 3635 NERL-KKQKNIKLEGAQNWKASLNSSGTQLSQIFLQKIDSKPELLKFHPYLNYLAVV-DRSGVSLWNWESGQRAQYMLSQSVSCKXXXXXXXXXXXXXXXXXXLEFINAEEDRGGLILVGTMDGRIKIWRNYLRDMGQDPDIVTAWIALPDQICSNRPSGLITHWSQSLGQLTISGDVKYIRLWDSLQECKISDMNTNSESCVSSIDRSQDG-RLIVAGFGDGHIKMFDIRAPVNECVINAGVGDMGWIHKVAY-SDSTNQVYSIGIYGELTTWCVR 4453
            N+RL ++ +N KL       A  +++G    Q+        P  L FH + + L  + D+  + +W+W   +R + + S   S    T +             ++ +N  ED   L++ G+ DG IK++R+Y     +  ++VT+W +L D +  +R + L+  W Q+ G L ++GDV+ IR+WD+ +E   +++   S + ++S+     G  +IVAGF DG ++++D R P  + + +        I  V   S    ++ S    GE+  W +R
Sbjct:  952 NQRLWRRNRNEKLIYRTRPLAEYSTNGRWNQQLMTFNNTIAPRKLMFHQFEDQLITLGDKDIIQVWDW---RRNRCLNSFKTSASATTNVTD-----------MQLLN--EDDVALLMTGSSDGTIKLYRDY---ENEKVELVTSWNSLSDLVFGDRNASLLMSWQQNCGHLLVAGDVRVIRIWDASKEICYANLPVRSSNSITSLTSDLVGCNIIVAGFSDGVLRVYDKRLPARDSLTDVWKEHSSEIVNVEMQSSGMRELISASSDGEVKLWDIR 1209          
BLAST of Regulatory-associated protein of mTOR vs. TrEMBL
Match: H9XVZ5 (Raptor OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 2010.73 bits (5208), Expect = 0.000e+0
Identity = 1069/1164 (91.84%), Postives = 1070/1164 (91.92%), Query Frame = 2
Query:   71 MRNIKKLIDIVEEDKSYPFVAFKARHLNXXXXXXXXXXXXXXKDKVRTLHVVLVLCLNLAVDPPDTLVKVSPCSKMEAWFDPKEKNLNRALEMIGKNLQIQYERWQPKARYRQSLDPTIEEIHRLCQSLRRSAREDRVLFHYNGHGVPRPTENGEIWVFNKAYTKYIPLSLYDLHSWMGGPTVYVFDCNNAGRIIRMMEQFSMKRFEN------------------------NGTANSSSMDNIIILASCQENEDIPQNPEVPADLFTSCLTTPIKIALHWYLLRNQEIFPNYLNETMLELIGGSPSNRVSMFGEINWVFTAVTDTIAWSCLPPPLFQKLFRQDLLVASLFRNFLLAERIMHYYGLRPVSYPPLPKTYEHPMWDAWDHALDCYTSQLPEIYHKKQSMNNSNNTENLLIIRHPSFDPLIVXXXXXXXXXXXXXXXXXXXXXXXTKDKIMQSTLDQQKLIPRNVLLTDDFQELLNIKNESTKGFNQTEKFQQERSQKQDLIQTAWNDALKQHNNTNVFNTRKPQILPNPRVLRQNSQSGKVFPISKTNNLNPLNGPICDLFPFKHTDFFNDHMTAFELWLKTADEKKXXXXXXXXXXXXXXXXXHRYRALRLLSEYMDLGPWAVIQCLTVGIFPYVVRLLQSPVYDVKPYLVFIWGKIISSAQ-------TDFAKNDVVKDAGYKYFVSCLTENEPYEIIIKTISAFALAKMLNNNPVGQKLYIKQNFMTVLIEELENNPSDLANDNYIRLRIWFILSFAKLWSDNDDAKWYGVRQQIHEKLLLYLKDISPE--------------------------------------------VRAATVYALGTFLNNKASDGIRSKHAVQVEQNICQHLLNHSVNDSSPLVRAELVVAMKYMVNLFSNQVMSMAIYYDVWLSQNNHGSINDVNNGKFMGPPSPLANRNVMPSRGSIEKISKRLFVHSPPALTDKISVRQKAVSSGDLTNFDENNNTFWLFKDSHIPFILPDMYLYGNINSTRGNLKNLGAELSFRPTFIKKVPAVSNFTTYNSGFPIINIYAQMWFSLILLSKDPYPKVSILASKIVEAINLYKKITQKSESNELNQQNTDFQISPKLNCSPAQFIQPIHSALFPSHNRKXXXXXXXXXXXXXXXKYLNSFE 3337
            MRNIKKLIDIVEEDKSYPFVAFKARHLNEEIEGIELYEEIYGKDKVRTLHVVLVLCLNLAVDPPDTLVKVSPCSKMEAWFDPKEKNLNRALEMIGKNLQIQYERWQPKARYRQSLDPTIEEIHRLCQSLRRSAREDRVLFHYNGHGVPRPTENGEIWVFNKAYTKYIPLSLYDLHSWMGGPTVYVFDCNNAGRIIRMMEQFSMKRFEN                        NGTANSSSMDNIIILASCQENEDIPQNPEVPADLFTSCLTTPIKIALHWYLLRNQEIFPNYLNETMLELIGGSPSNRVSMFGEINWVFTAVTDTIAWSCLPPPLFQKLFRQDLLVASLFRNFLLAERIMHYYGLRPVSYPPLPKTYEHPMWDAWDHALDCYTSQLPEIYHKKQSMNNSNNTENLLIIRHPSFDPLIVNNMSNNDSSEEDDDDIDEDEDMSTKDKIMQSTLDQQ                   KNE+TKGFNQTEKFQQERSQKQDLIQTAWNDALKQHNNTNVFNTRKPQILPNPRVLRQNSQSGKVFPISKTNNLNPLNGPICDLFPFKHTDFFNDHMTAFELWLKTADEKKPVPIQLPILLQVLLSQVHRYRALRLLSEYMDLGPWAVIQCLTVGIFPYVVRLLQSPVYDVKPYLVFIWGKIISSAQ       TDFAKNDVVKDAGYKYFVSCLTENEPYEIIIKTISAFALAKMLNNNPVGQKLYIKQNFMTVLIEELENNPSDLANDNYIRLRIWFILSFAKLWSDNDDAKWYGVRQQIHEKLLLYLKDISPE                                            VRAATVYALGTFLNNKASDGIRSKHAVQVEQNICQHLLNHSVNDSSPLVRAELVVAMKYMVNLFSNQVMSMAIYYDVWLSQNNHGSINDVNNGKFMGPPSPLANRNVMPSRGSIEKISKRLFVHSPPALTDKISVRQKAVSSGDLTNFDENNNTFWLFKDSHIPFILPDMYLYGNINSTRGNLKNLGAELSFRPTFIKKVPAVSNFTTYNSGFPIINIYAQMWFSLILLSKDPYPKVSILASKIVEAINLYKKITQKSESNELNQQNTDFQISPKLNCSPAQFIQPIHSALFPSHNRKIDAISSFISTDTSSDKYLNSFE
Sbjct:    1 MRNIKKLIDIVEEDKSYPFVAFKARHLNEEIEGIELYEEIYGKDKVRTLHVVLVLCLNLAVDPPDTLVKVSPCSKMEAWFDPKEKNLNRALEMIGKNLQIQYERWQPKARYRQSLDPTIEEIHRLCQSLRRSAREDRVLFHYNGHGVPRPTENGEIWVFNKAYTKYIPLSLYDLHSWMGGPTVYVFDCNNAGRIIRMMEQFSMKRFENDKNTKQNSFMKVKISKHVLVASGENGTANSSSMDNIIILASCQENEDIPQNPEVPADLFTSCLTTPIKIALHWYLLRNQEIFPNYLNETMLELIGGSPSNRVSMFGEINWVFTAVTDTIAWSCLPPPLFQKLFRQDLLVASLFRNFLLAERIMHYYGLRPVSYPPLPKTYEHPMWDAWDHALDCYTSQLPEIYHKKQSMNNSNNTENLLIIRHPSFDPLIVNNMSNNDSSEEDDDDIDEDEDMSTKDKIMQSTLDQQ-------------------KNENTKGFNQTEKFQQERSQKQDLIQTAWNDALKQHNNTNVFNTRKPQILPNPRVLRQNSQSGKVFPISKTNNLNPLNGPICDLFPFKHTDFFNDHMTAFELWLKTADEKKPVPIQLPILLQVLLSQVHRYRALRLLSEYMDLGPWAVIQCLTVGIFPYVVRLLQSPVYDVKPYLVFIWGKIISSAQLVTSFYVTDFAKNDVVKDAGYKYFVSCLTENEPYEIIIKTISAFALAKMLNNNPVGQKLYIKQNFMTVLIEELENNPSDLANDNYIRLRIWFILSFAKLWSDNDDAKWYGVRQQIHEKLLLYLKDISPEFYTMHPFMLNDRKFKCTIVDNDHLYYSFECHINRELLAYTTLSRVRAATVYALGTFLNNKASDGIRSKHAVQVEQNICQHLLNHSVNDSSPLVRAELVVAMKYMVNLFSNQVMSMAIYYDVWLSQNNHGSINDVNNGKFMGPPSPLANRNVMPSRGSIEKISKRLFVHSPPALTDKISVRQKAVSSGDLTNFDENNNTFWLFKDSHIPFILPDMYLYGNINSTRGNLKNLGAELSFRPTFIKKVPAVSNFTTYNSGFPIINIYAQMWFSLILLSKDPYPKVSILASKIVEAINLYKKITQKSESNELNQQNTDFQISPKLNCSPAQFIQPIHSALFPSHNRKIDAISSFISTDTSSDKYLNSFE 1145          

HSP 2 Score: 741.495 bits (1913), Expect = 0.000e+0
Identity = 382/431 (88.63%), Postives = 385/431 (89.33%), Query Frame = 2
Query: 3683 NWKASLNSSGTQLSQIFLQKIDSKPELLKFHPYLNYLAVVDRSGVSLWNWESGQRAQYMLSQSVSCKXXXXXXXXXXXXXXXXXXLEFINAEEDRGGLILVGTMDGRIKIWRNYLRDMGQDPDIVTAWIALPDQICSNRPSGLITHWSQSLGQLTISGDVKYIRLWDSLQECKISDMNTNSESCVSSIDRSQDGRLIVAGFGDGHIKMFDIRAPVNEC----VINAGVGDMGWIHKVAYSDSTNQVYSIGIYGELTTWCVRQRNLPKPYITPSRRPNPLRNTQNVDIDPKATSREGLLKDPFTSDSKLTLAKSINHSLKLQPVHCADLR--------------------------------VSSESDKEHLAVIGYGKESRGILTAIAPTGSINSNFKYFEGFSRANIEAPTSVCVHPYQTLVGAGLEDSS 4867
            NW    +     + +IFLQKIDSKPELLKFHPYLNYLAVVDRSGVSLWNWESGQRAQYMLSQSVSCKEETEIDSSSSETSGYITSLEFINAEEDRGGLILVGTMDGRIKIWRNYLRDMGQDPDIVTAWIALPDQICSNRPSGLITHWSQSLGQLTISGDVKYIRLWDSLQECKISDMNTNSESCVSSIDRSQDGRLIVAGFGDGHIKMFDIRAPVNEC    VINAGVGDMGWIHKVAYSDSTNQVYSIGIYGELTTWCVRQRNLPKPYITPSRRPNPLRNTQNVDIDPKATSREGLLKDPFTSDSKLTLAKSINHSLKLQPVHCADLR                                VSSESDKEHLAVIGYGKESRGILTAIAPTGSINSNFKYFEGFSRANIEAPTSVCVHPYQTLVGAGLEDSS
Sbjct: 1613 NWDLFFSKHQAMMQKIFLQKIDSKPELLKFHPYLNYLAVVDRSGVSLWNWESGQRAQYMLSQSVSCKEETEIDSSSSETSGYITSLEFINAEEDRGGLILVGTMDGRIKIWRNYLRDMGQDPDIVTAWIALPDQICSNRPSGLITHWSQSLGQLTISGDVKYIRLWDSLQECKISDMNTNSESCVSSIDRSQDGRLIVAGFGDGHIKMFDIRAPVNECIYNSVINAGVGDMGWIHKVAYSDSTNQVYSIGIYGELTTWCVRQRNLPKPYITPSRRPNPLRNTQNVDIDPKATSREGLLKDPFTSDSKLTLAKSINHSLKLQPVHCADLRNTLYSRSQPLSKELNLVTCIIEIMTNSFQDNFVSSESDKEHLAVIGYGKESRGILTAIAPTGSINSNFKYFEGFSRANIEAPTSVCVHPYQTLVGAGLEDSS 2043          

HSP 3 Score: 246.128 bits (627), Expect = 1.359e-61
Identity = 135/151 (89.40%), Postives = 137/151 (90.73%), Query Frame = 2
Query: 3338 EGYQFDFKDVSTDFFNWSSKYFTLPLLPFHKLAHLSIPGTNFHNENIKSINSMQYLNQSKSFDKVSYKKLPNLIISESKSKSSARRLMHVIDSAKYEDRNERLKKQKNIKLEGAQNWKASLNSSGTQLSQ---IFLQKIDSKPELLKFHPY 3781
            EGYQFDFKDVSTDFFNWSSKYFTLPLLPFHKLAHLSIPGTNFHNENIKSINSMQYLNQSKSFDKVSYKKLPNLIISESKSKSSARRLMHVIDSAKYEDRNERLKKQKNIKLEGAQNWKASLNSSGTQLSQ   ++     S  EL K   Y
Sbjct: 1335 EGYQFDFKDVSTDFFNWSSKYFTLPLLPFHKLAHLSIPGTNFHNENIKSINSMQYLNQSKSFDKVSYKKLPNLIISESKSKSSARRLMHVIDSAKYEDRNERLKKQKNIKLEGAQNWKASLNSSGTQLSQYVEMYFWNHGSLKELSKLRKY 1485          
BLAST of Regulatory-associated protein of mTOR vs. TrEMBL
Match: A0A1B6EH72 (Raptor_N domain-containing protein (Fragment) OS=Clastoptera arizonana OX=38151 GN=g.36309 PE=4 SV=1)

HSP 1 Score: 446.047 bits (1146), Expect = 9.298e-137
Identity = 211/383 (55.09%), Postives = 275/383 (71.80%), Query Frame = 2
Query:  101 VEEDKSYPFVAFKARHLNXXXXXXXXXXXXXXKDKVRTLHVVLVLCLNLAVDPPDTLVKVSPCSKMEAWFDPKEKNLNRALEMIGKNLQIQYERWQPKARYRQSLDPTIEEIHRLCQSLRRSAREDRVLFHYNGHGVPRPTENGEIWVFNKAYTKYIPLSLYDLHSWMGGPTVYVFDCNNAGRIIRMMEQFS---MKRFENNGTANSS----SMDNIIILASCQENEDIPQNPEVPADLFTSCLTTPIKIALHWYLLRNQEIFPNYLNETMLELIGGSPSNRVSMFGEINWVFTAVTDTIAWSCLPPPLFQKLFRQDLLVASLFRNFLLAERIMHYYGLRPVSYPPLPKTYEHPMWDAWDHALDCYTSQLPEIYHKKQSMNNS 1228
            VEED   P    K  H         + +    K++++T+ V LVLCLN+ VDPPD +VK  PC+++E W DP     ++A+E+IG NLQ QYERWQP+ARY+QSLDPT EE+ +LC SLRR+A+E+RVLFHYNGHGVP+PT NGE+WVFNK YT+YIPLS+YDL +WMG P++YV+DC+NAG II + +QF+    K +E   +ANS     +  N I LA+C  ++ +P NP++PAD+FTSCLTTPIKIAL W++++N     N +   +++ I G  ++R +M GE+NW+FTA+TDTIAW+ LP  LFQKLFRQDLLVASLFRNFLLAERIM  Y   PVS P LP TY+HPMW AWD ALD   SQLP +   + S  +S
Sbjct:   15 VEEDWQLPLAFLKKHHTEPIEGVNAIAQTWRMKERMKTVSVALVLCLNVGVDPPD-IVKTQPCARLECWIDPLSIGPHKAMEVIGANLQKQYERWQPRARYKQSLDPTGEEVRKLCTSLRRNAKEERVLFHYNGHGVPKPTANGELWVFNKMYTQYIPLSVYDLQTWMGAPSIYVYDCSNAGIIIDLFKQFADQHEKEYEQQ-SANSRITPPTFKNCIQLAACSADQILPMNPDLPADIFTSCLTTPIKIALRWFVMQNMSRLENKITLDLIDKIPGQINDRRTMLGELNWIFTAITDTIAWNTLPRDLFQKLFRQDLLVASLFRNFLLAERIMRSYDCAPVSSPKLPPTYQHPMWQAWDLALDLSLSQLPAVLQSEDSFRHS 395          

HSP 2 Score: 144.436 bits (363), Expect = 7.789e-32
Identity = 88/195 (45.13%), Postives = 133/195 (68.21%), Query Frame = 2
Query: 1709 FKHTDFFNDHMTAFELWLKTADEKKXXXXXXXXXXXXXXXXXHRYRALRLLSEYMDLGPWAVIQCLTVGIFPYVVRLLQSPVYDVKPYLVFIWGKIISSAQTDFAKNDVVKDAGYKYFVSCLTENE-PYEIIIKTISAFALAKMLNNNPVGQKLYIKQNFMTVLIEELENNPSDLANDNYIRLRIWFILSFAKLW 2290
            F+H+ FF + +TAF++WL    EK+  P QLPI+LQVLLSQVHR RAL LL +++DLGPWAV   L+VGIFPYV++LLQS   D++P LVFIW KI++  +T   + D+V+D G+KYF+S L +   P E   +T++AF LA +++N   GQ+  ++ + +++ +E+L N+P+ +       LR W  +   +LW
Sbjct:  392 FRHSPFFEEQLTAFQVWLHLGSEKRNPPEQLPIVLQVLLSQVHRLRALELLGKFLDLGPWAVNLALSVGIFPYVLKLLQSSANDLRPLLVFIWAKILAVDKT--CQADLVRDGGHKYFLSILQDTTIPSE--HRTMAAFVLACIVHNYLAGQEAALQGSLVSICLEQL-NDPNPM-------LRQWLAICLGRLW 574          
BLAST of Regulatory-associated protein of mTOR vs. TrEMBL
Match: A0A1B6JPA9 (Raptor_N domain-containing protein (Fragment) OS=Homalodisca liturata OX=320908 GN=g.49168 PE=4 SV=1)

HSP 1 Score: 441.425 bits (1134), Expect = 6.494e-135
Identity = 209/386 (54.15%), Postives = 275/386 (71.24%), Query Frame = 2
Query:   95 DIVEEDKSYPFVAFKARHLNXXXXXXXXXXXXXXKDKVRTLHVVLVLCLNLAVDPPDTLVKVSPCSKMEAWFDPKEKNLNRALEMIGKNLQIQYERWQPKARYRQSLDPTIEEIHRLCQSLRRSAREDRVLFHYNGHGVPRPTENGEIWVFNKAYTKYIPLSLYDLHSWMGGPTVYVFDCNNAGRIIRMMEQFS---MKRFE--NNGTANS---SSMDNIIILASCQENEDIPQNPEVPADLFTSCLTTPIKIALHWYLLRNQEIFPNYLNETMLELIGGSPSNRVSMFGEINWVFTAVTDTIAWSCLPPPLFQKLFRQDLLVASLFRNFLLAERIMHYYGLRPVSYPPLPKTYEHPMWDAWDHALDCYTSQLPEIYHKKQSMNNS 1228
            +   ED   P    K  H+        ++     K++++T+ V LVLCLN+ VDPPD +VK  PC+++E W DP   +  +ALE IG NLQ QYERWQPKARY+QSLDPT+EE+ +LC SLRR+A+E+RVLFHYNGHGVP+PT NGEIWVFN+ YT+YIPLS+YDL +WMG P++YV+DC++AG I+ +  QF+    + FE  N+ TAN     S  N I LA+C  ++ +P NP++PAD+FTSCLTTPIKIAL W++++NQ      +   +++ I G  S+R +M GE+NW+FTA+TDTIAW+ LP  LFQKLFRQDLLVASLFRN+LLAERIM  Y   PVS P LP TY+HPMW AWD ALD   +QLP +   + +  +S
Sbjct:   12 EAANEDWQLPLSFLKNHHVEAIEGAPTVFHSWRMKERMKTVSVALVLCLNVGVDPPD-IVKTQPCARLECWVDPLSMSPQKALENIGANLQKQYERWQPKARYKQSLDPTVEEVKKLCTSLRRNAKEERVLFHYNGHGVPKPTSNGEIWVFNRTYTQYIPLSVYDLQTWMGAPSIYVYDCSSAGVIVDLFRQFAEQHEREFEQGNSSTANRVPPPSFKNCIQLAACSADQILPMNPDLPADIFTSCLTTPIKIALRWFVMQNQNRLEPRVTLDLIDKIPGQLSDRRTMLGELNWIFTAITDTIAWNTLPRDLFQKLFRQDLLVASLFRNYLLAERIMRSYDCTPVSSPALPPTYQHPMWQAWDLALDLSLAQLPAVLANEDNFTHS 396          

HSP 2 Score: 130.568 bits (327), Expect = 2.625e-27
Identity = 84/194 (43.30%), Postives = 126/194 (64.95%), Query Frame = 2
Query: 1709 FKHTDFFNDHMTAFELWLKTADEKKXXXXXXXXXXXXXXXXXHRYRALRLLSEYMDLGPWAVIQCLTVGIFPYVVRLLQSPVYDVKPYLVFIWGKIISSAQTDFAKNDVVKDAGYKYFVSCLTENEPYEIIIKTISAFALAKMLNNNPVGQKLYIKQNFMTVLIEELENNPSDLANDNYIRLRIWFILSFAKLW 2290
            F H+ FF + +TAF++WL+   E++  P QLPI+LQVLLSQ+HR RAL LL +++DLGPWAV   L+VGIFPYV++LLQ    +++P LVFIW KI++   T   + D+V+D G+KYF+S L ++       +T++ FALA +++ +  GQ      N ++V +E+L  +P+ L       LR W  L   +LW
Sbjct:  393 FTHSPFFEEQLTAFQVWLQLGSEQRNPPEQLPIVLQVLLSQIHRLRALELLGKFLDLGPWAVNLALSVGIFPYVLKLLQG-AKELRPLLVFIWAKILAVDVT--CQADLVRDNGHKYFLSIL-QDTTIRSEDRTMATFALACVVHRHAAGQDAARVSNLVSVCLEQL-GDPNPL-------LRQWLALCLGRLW 574          
BLAST of Regulatory-associated protein of mTOR vs. TrEMBL
Match: A0A1S3IXK1 (regulatory-associated protein of mTOR-like OS=Lingula unguis OX=7574 GN=LOC106167922 PE=4 SV=2)

HSP 1 Score: 442.195 bits (1136), Expect = 3.929e-134
Identity = 210/385 (54.55%), Postives = 274/385 (71.17%), Query Frame = 2
Query:  128 VAFKA-RHLNXXXXXXXXXXXXXXKDKVRTLHVVLVLCLNLAVDPPDTLVKVSPCSKMEAWFDPKEKNLNRALEMIGKNLQIQYERWQPKARYRQSLDPTIEEIHRLCQSLRRSAREDRVLFHYNGHGVPRPTENGEIWVFNKAYTKYIPLSLYDLHSWMGGPTVYVFDCNNAGRIIRMMEQFSMKRFENNGTANSSSMDN-----------------IIILASCQENEDIPQNPEVPADLFTSCLTTPIKIALHWYLLRNQEIFPNYLNETMLELIGGSPSNRVSMFGEINWVFTAVTDTIAWSCLPPPLFQKLFRQDLLVASLFRNFLLAERIMHYYGLRPVSYPPLPKTYEHPMWDAWDHALDCYTSQLPEIYHKKQSMNNS 1228
            +AF + RH+ +      + +    K++++T+ V LVLCLN+ VDPPDT VK +PC+++E W DP   +  +ALE IG NLQ QYERWQP+ARY+QSLDPT++E+ +LC SLRR+A+++RVLFHYNGHGVPRPT NGEIWVFNK+YT+YIPLS+YDL +WMG P++YV+DC+NAG I+   +QFS +R +   T++  S  N                  I LA+C   E +P NPE+PADLFTSCLTTPIKIAL W++L+N       ++  +++ I G  ++R +M GE+NW+FTA+TDTIAW+ LP  LFQKLFRQDLLVASLFRNFLLAERIM  Y   PVS P LP TY+HPMW AWD ALD   SQL  I  +  +  +S
Sbjct:   24 LAFTSPRHMEKIEGTKSVTQTWRMKERMKTVSVALVLCLNVGVDPPDT-VKTTPCARLECWIDPLSMSPQKALEAIGTNLQKQYERWQPRARYKQSLDPTVDEVKKLCTSLRRNAKDERVLFHYNGHGVPRPTVNGEIWVFNKSYTQYIPLSVYDLQTWMGSPSIYVYDCSNAGIILDSFKQFSQQREQEGDTSSRQSAANNNFSSPSTMLSAAAVKSCIQLAACGPTELLPMNPELPADLFTSCLTTPIKIALRWFVLQNTAKLVPSISMELVDKIPGQLNDRRTMLGELNWIFTAITDTIAWNVLPRELFQKLFRQDLLVASLFRNFLLAERIMRAYNCTPVSAPRLPPTYQHPMWQAWDLALDLCLSQLTGILDESSTFQHS 407          

HSP 2 Score: 202.216 bits (513), Expect = 1.712e-50
Identity = 126/287 (43.90%), Postives = 183/287 (63.76%), Query Frame = 2
Query: 1670 LNPLNGPICDLFPFKHTDFFNDHMTAFELWLKTADEKKXXXXXXXXXXXXXXXXXHRYRALRLLSEYMDLGPWAVIQCLTVGIFPYVVRLLQSPVYDVKPYLVFIWGKIISSAQTDFAKNDVVKDAGYKYFVSCLTENEPY-EIIIKTISAFALAKMLNNNPVGQKLYIKQNFMTVLIEELENNPSDLANDNYIRLRIWFILSFAKLWSDNDDAKWYGVRQQIHEKLLLYLKDISPEVRAATVYALGTFLNNKASDGIRSKHAVQVEQNICQHLLNHSVNDSSPLVR 2527
            L+ L G + +   F+H+ FF + +TAF++WL    E +  P QLPI+LQVLLSQVHR RAL LL  ++DLG WAV   L+VGIFPYV++LLQS   +++P LVFIW KI++  ++   + D+VKD G+KYF+S L   +PY     +T++AF LA ++N    GQ+  ++ N +++ +E+L+++ +        +LR W  L   K+W++   A+W GVR   HEKL   L D +PEVRA+TVYALGTF+ +      R+ HA  V+ N+   LL   V D SPLVR
Sbjct:  391 LSQLTGILDESSTFQHSPFFAEQLTAFQVWLSYGSELRSPPEQLPIVLQVLLSQVHRLRALDLLGRFLDLGSWAVSLALSVGIFPYVLKLLQSSARELRPLLVFIWAKILAVDKS--CQADLVKDNGHKYFLSVLA--DPYMPAEHRTMAAFVLAMIVNKYQPGQEAAMQGNLISICLEQLDSSNA--------QLRQWLALCLGKIWTNFSAARWCGVRDSAHEKLYTLLNDKTPEVRASTVYALGTFITSTHE---RTDHANNVDHNVGMMLLT-IVQDGSPLVR 661          
BLAST of Regulatory-associated protein of mTOR vs. TrEMBL
Match: A0A1A8H1Z2 (Regulatory associated protein of MTOR, complex 1 (Fragment) OS=Nothobranchius korthausae OX=1143690 GN=RPTOR PE=4 SV=1)

HSP 1 Score: 438.343 bits (1126), Expect = 2.530e-133
Identity = 212/385 (55.06%), Postives = 271/385 (70.39%), Query Frame = 2
Query:  110 DKSYPFVAFKARHLNXXXXXXXXXXXXXXKDKVRTLHVVLVLCLNLAVDPPDTLVKVSPCSKMEAWFDPKEKNLNRALEMIGKNLQIQYERWQPKARYRQSLDPTIEEIHRLCQSLRRSAREDRVLFHYNGHGVPRPTENGEIWVFNKAYTKYIPLSLYDLHSWMGGPTVYVFDCNNAGRIIRMMEQFSMKRFENNGTA--NSS----------SMDNIIILASCQENEDIPQNPEVPADLFTSCLTTPIKIALHWYLLRNQEIFPNYLNETMLELIGGSPSNRVSMFGEINWVFTAVTDTIAWSCLPPPLFQKLFRQDLLVASLFRNFLLAERIMHYYGLRPVSYPPLPKTYEHPMWDAWDHALDCYTSQLPEIYHKKQSMNNS 1228
            D   P    K RHL +      L +    KD+++T+ V LVLCLN+ VDPPD +VK SPC+++E W DP   +  +ALE IG NLQ QYE WQP+ARY+QSLDPT++E+ +LC SLRR+A+E+RVLFHYNGHGVPRPT NGEIWVFNK YT+YIPLS+YDL +WMG P+++V+DC+NAG I++  +QF+++R +    A  N S          SM N I LA+C+ NE +P NP++PADLFTSCLTTPIKIAL W+ ++        +   ++E I G  ++R +  GE+NW+FTA+TDTIAW+ LP  LFQKLFRQDLLVASLFRNFLLAERIM  Y   PVS P LP TY H MW AWD A+D   SQLP I  +  +  +S
Sbjct:   68 DWKLPLAFMKKRHLEKIEGSKALAQSWRMKDRMKTVSVALVLCLNVGVDPPD-VVKTSPCARLECWIDPLSMSPQKALETIGANLQKQYENWQPRARYKQSLDPTVDEVKKLCTSLRRNAKEERVLFHYNGHGVPRPTVNGEIWVFNKNYTQYIPLSIYDLQTWMGSPSIFVYDCSNAGIIVKSFKQFALQREQELEVAAINPSHPLAQMPLPPSMKNCIQLAACEANELLPMNPDLPADLFTSCLTTPIKIALRWFCMQKSAKLVPGVTLDLIEKIPGRLNDRRTPLGELNWIFTAITDTIAWNVLPRDLFQKLFRQDLLVASLFRNFLLAERIMRSYNCTPVSSPRLPPTYMHAMWQAWDLAVDICLSQLPTIIEEGTAFRHS 451          

HSP 2 Score: 130.954 bits (328), Expect = 3.050e-27
Identity = 79/170 (46.47%), Postives = 118/170 (69.41%), Query Frame = 2
Query: 1709 FKHTDFFNDHMTAFELWLKTADEKKXXXXXXXXXXXXXXXXXHRYRALRLLSEYMDLGPWAVIQCLTVGIFPYVVRLLQSPVYDVKPYLVFIWGKIISSAQTDFAKNDVVKDAGYKYFVSCLTEN-EPYEIIIKTISAFALAKMLNNNPVGQKLYIKQNFMTVLIEELEN 2215
            F+H+ FF + +TAF++WL    E +  P QLPI+LQVLLSQVHR RAL LL  ++DLGPWAV   L+VGIFPYV++LLQS   +++P LVFIW KI++   +   + D+VKD G+KYF+S L ++  P E   +T++ F LA ++N+   GQ+  ++ N + + +E+L +
Sbjct:  448 FRHSPFFAEQLTAFQVWLTMGVENRNPPEQLPIVLQVLLSQVHRLRALDLLGRFLDLGPWAVSLALSVGIFPYVLKLLQSSARELRPLLVFIWAKILAVDSS--CQADLVKDNGHKYFLSVLADSYMPAE--HRTMAVFILAVIVNSYNTGQEACLQGNLIAICLEQLSD 613          
BLAST of Regulatory-associated protein of mTOR vs. Ensembl Cavefish
Match: rptor (regulatory associated protein of MTOR, complex 1 [Source:ZFIN;Acc:ZDB-GENE-130530-685])

HSP 1 Score: 419.083 bits (1076), Expect = 1.001e-122
Identity = 207/385 (53.77%), Postives = 263/385 (68.31%), Query Frame = 2
Query:  110 DKSYPFVAFKARHLNXXXXXXXXXXXXXXKDKVRTLHVVLVLCLNLAVDPPDTLVKVSPCSKMEAWFDPKEKNLNRALEMIGKNLQIQYERWQPKARYRQSLDPTIEEIHRLCQSLRRSAREDRVLFHYNGHGVPRPTENGEIWVFNKAYTKYIPLSLYDLHSWMGGPTVYVFDCNNAGRIIRMMEQFSMKRFENNGTAN------------SSSMDNIIILASCQENEDIPQNPEVPADLFTSCLTTPIKIALHWYLLRNQEIFPNYLNETMLELIGGSPSNRVSMFGEINWVFTAVTDTIAWSCLPPPLFQKLFRQDLLVASLFRNFLLAERIMHYYGLRPVSYPPLPKTYEHPMWDAWDHALDCYTSQLPEIYHKKQSMNNS 1228
            D + P    K RHL +      L +    KD+++T+ V LVLCLN+ VDPPD +VK SPC+++E W DP   +  +ALE IG NLQ QYE WQP+ARY+QSLDPT++E+ +LC SLRR+A+E+RVLFHYNGHGVPRPT NGEIWVFNK YT+YIPLS+YDL +WMG P+++V+DC+NAG I++  +QF+++R +    A               SM N I LA+C+ NE +P NP++PADLFTSCLTTPIKI     L+        +        I G  ++R +  GE+NW+FTA+TDTIAW+ LP  LFQKLFRQDLLVASLFRNFLLAERIM  Y   PVS P LP TY H MW AWD A+D   SQLP I  +  +  +S
Sbjct:   23 DWNLPLAFMKKRHLEKIEGSKALAQSWRMKDRMKTVSVALVLCLNVGVDPPD-VVKTSPCARLECWIDPLSMSPQKALETIGANLQKQYENWQPRARYKQSLDPTVDEVKKLCTSLRRNAKEERVLFHYNGHGVPRPTVNGEIWVFNKNYTQYIPLSIYDLQTWMGSPSIFVYDCSNAGIIVKSFKQFALQREQELEVAAINPNHPLAQMPLPPSMKNCIQLAACEANELLPMNPDLPADLFTSCLTTPIKILCK--LMCVCVCVCVF-------RIPGRLNDRRTPLGELNWIFTAITDTIAWNVLPRDLFQKLFRQDLLVASLFRNFLLAERIMRSYNCTPVSSPRLPPTYMHAMWQAWDLAVDICLSQLPTIIEEGTAFRHS 397          

HSP 2 Score: 234.572 bits (597), Expect = 7.090e-62
Identity = 169/480 (35.21%), Postives = 263/480 (54.79%), Query Frame = 2
Query: 1709 FKHTDFFNDHMTAFELWLKTADEKKXXXXXXXXXXXXXXXXXHRYRALRLLSEYMDLGPWAVIQCLTVGIFPYVVRLLQSPVYDVKPYLVFIWGKIISSAQTDFAKNDVVKDAGYKYFVSCLTENEPY-EIIIKTISAFALAKMLNNNPVGQKLYIKQNFMTVLIEELENNPSDLANDNYIRLRIWFILSFAKLWSDNDDAKWYGVRQQIHEKLLLYLKDISPEVRAATVYALGTFLNNKASDGIRSKHAVQVEQNICQHLLNHSVNDSSPLVRAELVVAMKYMVNLFSNQVMSMAIYYDVWLSQNNHGSINDVNNGKFMGPPSPLANRNVMPSRGSIEKISKRLFVHSPPALTDKISVRQKAVSSGDLTNFDENNNTFWLFKDSHIPFILPDMYLYGNINSTRGNLKNLGAE------LSFRPTFIKKVPAVSNFTTYNS--GFPIINIYAQMWFSLILLSKDPYPKVSILASKIVEAI 3121
            F+H+ FF + +TAF++WL    E +  P QLPI+LQVLLSQVHR RAL LL  ++DLGPWAV   L+VGIFPYV++LLQS   +++P LVFIW KI++   +   + D+VKD G+KYF+S L   +PY     +T++ F LA ++N+   GQ+  ++ N + + +E+L        +D +  LR W  +   ++W + D A+W GVR   HEKL   L D  PEVR A V+ALGTF+ N A    R+ H+  ++ N+   +L   +ND SP+VR ELVVA+ ++V  + +   ++A+ +           + +  N     P +     N+ P R S   I +   V+S   +    + R    S  +L N +E                 P  +  GN++++      LG+       LSF    I K+  VS++++ NS  G    ++Y Q+W  L+ L+ DP+P+VS LA K++ +I
Sbjct:  394 FRHSPFFAEQLTAFQVWLTMGVENRNPPEQLPIVLQVLLSQVHRLRALDLLGCFLDLGPWAVSLALSVGIFPYVLKLLQSSARELRPLLVFIWAKILAVDSS--CQADLVKDNGHKYFLSVLA--DPYMPAEHRTMAVFILAVIVNSYNTGQEACLQGNLIAICLEQL--------SDPHPLLRQWVAICLGRIWQNFDSARWCGVRDSAHEKLYSLLSDPIPEVRCAAVFALGTFVGNSAE---RTDHSTTIDHNVAM-MLAQLINDGSPVVRKELVVALSHLVVQYESNFCTVALQF-----------MEEEKNYAAPSPANTTEPGNLTPVRES-PAIPRLRSVNSYTNIRAATTARNLNKSLQNL-NLNEEGG--------------PVTFSPGNLSASSSASSTLGSPDNDEYILSFET--IDKMRRVSSYSSLNSLIGVSFNSVYTQIWRVLLHLAADPFPEVSDLAMKVLNSI 828          

HSP 3 Score: 124.405 bits (311), Expect = 5.015e-28
Identity = 72/257 (28.02%), Postives = 127/257 (49.42%), Query Frame = 2
Query: 3680 QNWKASLNSSGTQLSQIFLQK----IDSKPELLKFHPYLNYLAVVDRSGVSLWNWESGQRAQYMLSQSVSCKXXXXXXXXXXXXXXXXXXLEFINAEEDRGGLILVGTMDGRIKIWRNYLRDMGQDPDIVTAWIALPDQICSNRPSGLITHWSQSLGQLTISGDVKYIRLWDSLQECKISDMNTNSESCVSSIDRSQDGRLIVAGFGDGHIKMFDIRAPVNECVINAGVGDMGWIHKVAYSDSTN-QVYSIGIYGEL 4435
            + W+   N+   + SQ  +Q+    + +  +   F PY              W+WE G+R  Y  + +                   IT++E++N  +    L+L  T DG ++IW+N+     ++P++VTAW  L D + S R +G++  W Q  G L  SGDV+ +R+WD+ +E K+ D+ T ++SCV+S+       L+VAG GDG ++++D R   NEC +        W+ K      T+  + S+ + G++
Sbjct:  978 REWRFLRNAGVRRQSQRIIQRGTTTLHNSTQHCTFQPY----------SALFWDWEKGERLDYFYNGN--------------PRYTRITAMEYLNGHD--CSLLLTATDDGALRIWKNFADQ--RNPEMVTAWQGLSDMLPSTRGAGMVVDWEQETGLLMTSGDVRVVRIWDTEREMKVQDIPTGADSCVTSLSCDPQRSLVVAGLGDGSVRVYDRRMGPNECRVMTYREHGAWVVKAHLQRETDGHIISVSVNGDV 1206          
BLAST of Regulatory-associated protein of mTOR vs. Ensembl Yeast
Match: KOG1 (Subunit of TORC1; TORC1 is a rapamycin-sensitive complex involved in growth control that contains Tor1p or Tor2p, Lst8p and Tco89p; contains four HEAT repeats and seven WD-40 repeats; may act as a scaffold protein to couple TOR and its effectors [Source:SGD;Acc:S000001229])

HSP 1 Score: 358.992 bits (920), Expect = 7.029e-102
Identity = 171/357 (47.90%), Postives = 243/357 (68.07%), Query Frame = 2
Query:  197 KDKVRTLHVVLVLCLNLAVDPPDTLVKVSPCSKMEAWFDPKE-KNLNRALEMIGKNLQIQYERWQPKARYRQSLDPTIEEIHRLCQSLRRSAREDRVLFHYNGHGVPRPTENGEIWVFNKAYTKYIPLSLYDLHSWMGGPTVYVFDCNNAGRIIRMMEQFSMKRFENNGTAN--------SSSMDNIIILASCQENEDIPQNPEVPADLFTSCLTTPIKIALHWYLLRN------QEIFPNYLNETMLELIG----------------GSPSNRVSMFGEINWVFTAVTDTIAWSCLPPPLFQKLFRQDLLVASLFRNFLLAERIMHYYGLRPVSYPPLPKTY-EHPMWDAWDHALD 1171
            KD+ +T+   L+LCLNL VDPPD + K  PC+++EAW DP   ++  +A+E IGKNLQ QYE    + RY+QSLDP +E++ R C SLRR+++EDR+LFHYNGHGVP+PT++GEIWVFN+ YT+YIP+SLYDL +W+G P ++V+DCN+A  I+   ++F  KR +++   N        +S+  +   LASC  +E +  +PE+PADLF+ CLT PI+I++  +L+++       +IF  + N T  +  G                G  S+R +  GE+NW+FTA+TDTIAW+ LP PLF+KLFR DL++A+LFRNFLLA+RIM +Y   PVS P LP +   HPMW +WD A+D
Sbjct:   77 KDRQKTVSAALLLCLNLGVDPPDVM-KTHPCARVEAWVDPLNFQDSKKAIEQIGKNLQAQYETLSLRTRYKQSLDPCVEDVKRFCNSLRRTSKEDRILFHYNGHGVPKPTKSGEIWVFNRGYTQYIPVSLYDLQTWLGAPCIFVYDCNSAENILINFQKFVQKRIKDDEEGNHDVAAPSPTSAYQDCFQLASCTSDELLLMSPELPADLFSCCLTCPIEISIRIFLMQSPLKDSKYKIF--FENSTSNQPFGDSKNSFKSKIPNVNIPGMLSDRRTPLGELNWIFTAITDTIAWTSLPRPLFKKLFRHDLMIAALFRNFLLAKRIMPWYNCHPVSDPELPDSITTHPMWKSWDLAMD 430          

HSP 2 Score: 112.464 bits (280), Expect = 3.930e-25
Identity = 68/119 (57.14%), Postives = 90/119 (75.63%), Query Frame = 2
Query: 1718 TDFFNDHMTAFELWLKTADEKKXXXXXXXXXXXXXXXXXHRYRALRLLSEYMDLGPWAVIQCLTVGIFPYVVRLLQSPVYDVKPYLVFIWGKIISSAQTDFAKNDVVKDAGYKYFVSCL 2074
            T FF  ++TAFELWLK A   +  P QLPI+LQVLLSQVHR RAL LLS ++DLGPWAV   L++GIFPYV++LLQSP  ++KP LVFIW +I+S    +  +++++K+ GY YFV+ L
Sbjct:  527 TGFFEQNLTAFELWLKYASNVRHPPEQLPIVLQVLLSQVHRIRALVLLSRFLDLGPWAVYLSLSIGIFPYVLKLLQSPAPELKPILVFIWARIMSIDYKN-TQSELIKEKGYMYFVTVL 644          

HSP 3 Score: 107.842 bits (268), Expect = 8.230e-24
Identity = 88/291 (30.24%), Postives = 137/291 (47.08%), Query Frame = 2
Query: 3629 DRNERL--KKQKNIKLEGAQNWKASLNSSGTQLSQIFLQKIDSKPELLKFHPYLNYLAVVD-RSGVSLWNWESGQR-AQYMLSQSVSCKXXXXXXXXXXXXXXXXXXLEFINAEEDRGGLILVGTMDGRIKIWRNYLRDMGQDPD---IVTAWIALPDQICSNRPSGLITHWSQSLGQLTISGDVKYIRLWDSLQECKISDMNTNSESCVSSIDRSQ-DGRLIVAGFGDGHIKMFDIRAPVNECVI---NAGVGDMG-WIHKVAYS-DSTNQVYSIGIYGELTTWCVRQRN 4462
            +RNE +  + Q   KL    NW   L S   +          S+P+L+KF  + + L   D RS +++++WE G+  +++        K                  L+ IN  ED   L+L G+ DG IKI+R+Y     QD D   IV+AW  L D + + R +GL+T W Q  G L  +GDVK IR+WD+  E    D+   + S ++S+   Q  G + VAGF DG ++++D R    + +I    AG    G WI+ V        ++ S    G +  W +R  +
Sbjct: 1178 NRNETIIQETQGEKKLSIYGNWSKKLISLNNK----------SQPKLMKFAQFEDQLITADDRSTITVFDWEKGKTLSKFSNGTPFGTKVTD---------------LKLIN--EDDSALLLTGSSDGVIKIYRDY-----QDVDTFKIVSAWRGLTDMLLTPRSTGLLTEWLQIRGSLLTTGDVKVIRVWDAHTETVEVDIPAKTSSLITSLTADQLAGNIFVAGFADGSLRVYDRRLDPRDSMIRRWRAGNDKQGVWINNVHLQRGGYRELVSGATNGVVELWDIRSED 1436          
BLAST of Regulatory-associated protein of mTOR vs. Ensembl Nematostella
Match: EDO47933 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKM5])

HSP 1 Score: 430.254 bits (1105), Expect = 6.814e-127
Identity = 203/385 (52.73%), Postives = 265/385 (68.83%), Query Frame = 2
Query:  110 DKSYPFVAFKARHLNXXXXXXXXXXXXXXKDKVRTLHVVLVLCLNLAVDPPDTLVKVSPCSKMEAWFDPKEKNLNRALEMIGKNLQIQYERWQPKARYRQSLDPTIEEIHRLCQSLRRSAREDRVLFHYNGHGVPRPTENGEIWVFNKAYTKYIPLSLYDLHSWMGGPTVYVFDCNNAGRIIRMMEQFSMKRFENNGTANSS------------SMDNIIILASCQENEDIPQNPEVPADLFTSCLTTPIKIALHWYLLRNQEIFPNYLNETMLELIGGSPSNRVSMFGEINWVFTAVTDTIAWSCLPPPLFQKLFRQDLLVASLFRNFLLAERIMHYYGLRPVSYPPLPKTYEHPMWDAWDHALDCYTSQLPEIYHKKQSMNNS 1228
            D   P    K RH         L +    K++++T+ V LVLCLN+ VDPPD +VK SPC+++E W DP     ++ALE +G  LQ QYERWQP+ARY+QSLDPT+EE+ +LC SLRR+A+E+RVLFHYNGHGVPRPT NGEIWVFNK+YT+YIPLS+YDL +WMG P+++V+DCNNAG I++    F+ +R + +  + +             ++ N I LA+C  N+ +P NPE+PADLFTSCLTTPIK+AL W+  +N       +   ++E I G  ++R +  GE+NW+FTAVTDTIAW+ LP  LF KLFRQDLLVASLFRNFLLAER++  +   PVS P LP TY HPMW AWD A+D    QLPE+     +  NS
Sbjct:   23 DWQLPLCFMKKRHKEPIAGAELLAQTWRMKERMKTVSVALVLCLNVGVDPPD-IVKTSPCARLECWIDPLSVTPHKALETVGNKLQEQYERWQPRARYKQSLDPTVEEVKKLCTSLRRNAKEERVLFHYNGHGVPRPTVNGEIWVFNKSYTQYIPLSVYDLQTWMGSPSIFVYDCNNAGLILQSFNTFASQREQEHEVSTTRCLTQGTPMPVPLAVKNCIQLAACAANQLLPMNPELPADLFTSCLTTPIKVALRWFCSQNSSKIVPGMTLELIEKIPGRLNDRRTPLGELNWIFTAVTDTIAWNMLPRELFHKLFRQDLLVASLFRNFLLAERVLRSFNCTPVSSPQLPPTYMHPMWHAWDLAVDLCLLQLPEVIENPANFKNS 406          

HSP 2 Score: 213.001 bits (541), Expect = 1.172e-55
Identity = 134/301 (44.52%), Postives = 187/301 (62.13%), Query Frame = 2
Query: 1709 FKHTDFFNDHMTAFELWLKTADEKKXXXXXXXXXXXXXXXXXHRYRALRLLSEYMDLGPWAVIQCLTVGIFPYVVRLLQSPVYDVKPYLVFIWGKIISSAQTDFAKNDVVKDAGYKYFVSCLTENEPY-EIIIKTISAFALAKMLNNNPVGQKLYIKQNFMTVLIEELENNPSDLANDNYIRLRIWFILSFAKLWSDNDDAKWYGVRQQIHEKLLLYLKDISPEVRAATVYALGTFLNNKASDGIRSKHAVQVEQNICQHL--LNHSVNDSSPLVRAELVVAMKYMVNLFSNQVMSMAIYY 2602
            FK++ FF+  +TAF++WL    E +  P QLPI+LQVLLSQVHR RAL LL  ++DLGPWAV   L+VGIFPYV++LLQS   +++P LVFIW KI++   +   ++D+VKD G+KYF+S L   +PY     +T++AF L+ ++N  P GQ+  ++ N + + +E+L         D +  LR W  +  AK+W+  D A+W GVR    EKL   L D  PEVRAA VYALGTF+ N    G RS HA Q++  +   L  L H   D SPLVR ELVV++  +V  F      +A+ +
Sbjct:  403 FKNSAFFSQQLTAFQVWLAMGSEMRDPPEQLPIVLQVLLSQVHRLRALDLLGRFLDLGPWAVNLALSVGIFPYVLKLLQSSARELRPLLVFIWAKILAVDSS--CQSDLVKDNGHKYFLSVLA--DPYMPAEHRTMAAFVLSAIINGFPSGQEACLQGNLIAICLEQL--------TDPHPLLRQWLAVCLAKVWASYDAARWCGVRDTAPEKLYCLLSDPLPEVRAAAVYALGTFIANT---GDRSDHANQIDFGVAMTLTQLGH---DGSPLVRKELVVSLHGLVIQFETNFGVVALQF 685          

HSP 3 Score: 162.54 bits (410), Expect = 3.863e-40
Identity = 140/482 (29.05%), Postives = 220/482 (45.64%), Query Frame = 2
Query: 3026 NIYAQMWFSLILLSKDPYPKVSILASKIVEAINLYKKIT---QKSESNELNQQNTDFQISPKLNCSPAQFIQPIHSALFPSHNRKXXXXXXXXXXXXXXXKYLNSFEEGYQFDFKDVSTDFFNWSSKYFTLPLLPFHKLAHLSIPGTNFHNENIK-SINSMQYLNQSKSFDKVSYKKLPNLIISESKSKSSARRLMHVIDSAKYEDRNERLKKQKNIKLEGAQNWKASLNSSGTQLSQIFLQKIDSKPELLKFHPYLNYLAVVDRSGVSLWNWESGQRAQYMLSQSVSCKXXXXXXXXXXXXXXXXXXLEFINAEEDRGGLILVGTMDGRIKIWRNYLRDMGQDP-DIVTAWIALPDQICSNRPSG--LITHWSQSLGQLTISGDVKYIRLWDSLQECKISDMNTNSESCVSSIDRSQDGR-LIVAGFGDGHIKMFDIRAPVNECVINAGVGDMGWIHKVAYSDSTN-QVYSIGIYGELTTW 4444
            N+YA  W +L+ LS DP   V   A KIV  I L   I+   QK     +  Q+T    SP       ++  P     FP    +        S  + S     S  E  +      +   ++  S  F +    F K   ++   ++     +K  I    +     S+   S  K P     +S+        +H+    ++E RN R++++   +   A   K           QIF+ K    P +L+FHPY  +LAV DR GVS+WNWE G R  Y  + +                   ITS+EF+NA +    L+L GT DG +++WR+Y  D  + P ++VTAW AL   + S R SG  L+ +W Q  G L  SGDV++IR+WD+ +E K+ D+ T ++SCV+S+     GR L++AG GDG ++++D R P ++  + A     GW+  V      +  + S  + G++  W
Sbjct:  789 NVYANTWKALLNLSVDPDRSVCDKAKKIVNNITLKATISANPQKVTGTNIRSQSTSAPSSPS-----GRYTNP-----FPHQREQNSPPVHHRSHQSISQPTTPSRGEAPRMGGAQGNPGIYHPHSYEFHVKRKVFGKGPDVNEVDSDDETSPMKPQIIRTNFAEWCASYFAQSVMKPPEEHDPQSQ--------LHLQREWRFE-RNSRVRREAARQQARADVCKLD--------DQIFINKNIHPPGILRFHPYEPHLAVADRGGVSIWNWEQGARMNYFNNNN--------------SKLTRITSMEFLNAHDLT--LLLTGTDDGSVRVWRDY--DGVESPVEVVTAWQALSGMLPSTRGSGSGLVVNWEQETGILLASGDVRFIRVWDTQREMKMQDIPTGADSCVTSLACDSVGRSLLIAGCGDGSVRLYDRRLPPSDSRVMALREHTGWVTSVFLQKGGDGNIISGSVAGDVRFW 1225          
BLAST of Regulatory-associated protein of mTOR vs. Ensembl Nematostella
Match: EDO26130 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TCT4])

HSP 1 Score: 65.4698 bits (158), Expect = 9.887e-13
Identity = 34/64 (53.12%), Postives = 44/64 (68.75%), Query Frame = 2
Query:  716 SMDNIIILASCQENEDIPQNPEVPADLFTSCLTTPIKIALHWYLLRN-QEIFPNYLNETMLELI 904
            ++ N I LA+C  N+ +P NPE+PADLFTSCLTTPIK+AL W+  +N  +I P       LELI
Sbjct:    6 AVKNCIQLAACAANQLLPMNPELPADLFTSCLTTPIKVALRWFCSQNSSKIVPGM----TLELI 65          
BLAST of Regulatory-associated protein of mTOR vs. Ensembl Medaka
Match: rptor (regulatory associated protein of MTOR complex 1 [Source:NCBI gene;Acc:101156464])

HSP 1 Score: 434.106 bits (1115), Expect = 1.058e-127
Identity = 209/375 (55.73%), Postives = 266/375 (70.93%), Query Frame = 2
Query:  110 DKSYPFVAFKARHLNXXXXXXXXXXXXXXKDKVRTLHVVLVLCLNLAVDPPDTLVKVSPCSKMEAWFDPKEKNLNRALEMIGKNLQIQYERWQPKARYRQSLDPTIEEIHRLCQSLRRSAREDRVLFHYNGHGVPRPTENGEIWVFNKAYTKYIPLSLYDLHSWMGGPTVYVFDCNNAGRIIRMMEQFSMKRFENNGTA--NSS----------SMDNIIILASCQENEDIPQNPEVPADLFTSCLTTPIKIALHWYLLRNQEIFPNYLNETMLELIGGSPSNRVSMFGEINWVFTAVTDTIAWSCLPPPLFQKLFRQDLLVASLFRNFLLAERIMHYYGLRPVSYPPLPKTYEHPMWDAWDHALDCYTSQLPEI 1198
            D   P    K RHL +      L +    KD+++T+ V LVLCLN+ VDPPD +VK SPC+++E W DP   +  +ALE IG NLQ QYE WQP+ARY+QSLDPT++E+ +LC SLRR+A+E+RVLFHYNGHGVPRPT NGEIWVFNK YT+YIPLS+YDL +WMG P+++V+DC+NAG I++  +QF+++R +    A  N S          SM N I LA+C+ +E +P NP++PADLFTSCLTTPI IAL W+ ++        +   ++E I G  ++R +  GE+NW+FTA+TDTIAW+ LP  LFQKLFRQDLLVASLFRNFLLAERIM  Y   PVS P LP TY H MW AWD A+D   SQLP I
Sbjct:   25 DWKLPLTFMKKRHLEKIEGSKALAQSWRMKDRMKTVSVALVLCLNVGVDPPD-VVKTSPCARLECWIDPLSMSPQKALETIGANLQKQYENWQPRARYKQSLDPTVDEVKKLCTSLRRNAKEERVLFHYNGHGVPRPTVNGEIWVFNKNYTQYIPLSIYDLQTWMGSPSIFVYDCSNAGIIVKSFKQFALQREQELEVAAINPSHPLAQMPLPPSMKNCIQLAACEASELLPMNPDLPADLFTSCLTTPITIALRWFCMQKSAKLVPGVTLDLIEKIPGRLNDRRTPLGELNWIFTAITDTIAWNVLPRDLFQKLFRQDLLVASLFRNFLLAERIMRSYNCTPVSSPRLPPTYMHAMWQAWDLAVDICLSQLPTI 398          

HSP 2 Score: 231.876 bits (590), Expect = 5.055e-61
Identity = 166/474 (35.02%), Postives = 257/474 (54.22%), Query Frame = 2
Query: 1709 FKHTDFFNDHMTAFELWLKTADEKKXXXXXXXXXXXXXXXXXHRYRALRLLSEYMDLGPWAVIQCLTVGIFPYVVRLLQSPVYDVKPYLVFIWGKIISSAQTDFAKNDVVKDAGYKYFVSCLTEN-EPYEIIIKTISAFALAKMLNNNPVGQKLYIKQNFMTVLIEELENNPSDLANDNYIRLRIWFILSFAKLWSDNDDAKWYGVRQQIHEKLLLYLKDISPEVRAATVYALGTFLNNKASDGIRSKHAVQVEQNICQHLLNHSVNDSSPLVRAELVVAMKYMVNLFSNQVMSMAIYYDVWLSQNNHGSINDVNNGKFMGPPSPLANRNVMPSRGSIEKISKRLFVHSPPALTDKISVRQKAVSSGDLTNFDENNNTFWLFKDSHIPFILPDMYLYGNINSTRGNLKNLGAELSFRPTFIKKVPAVSNFTTYNS--GFPIINIYAQMWFSLILLSKDPYPKVSILASKIVEAI 3121
            F+ ++FF   +TAFE+WL    E +  P QLPI+LQVLLSQVHR RAL LL +++DLGPWAV   L+VGIFPYV++LLQS   +++P LVFIW KI++   +   + D+VKD G+KYF+S L +N  P E   +T++ F LA ++NN   GQ+  ++ N +   +E+L        +D +  LR W  +   ++W + D A+W GVR   HEKL   L D  PEVR A V+ALGTF+ N    G R+ H+  ++ N+   +L   +ND SP+VR ELVVA+ ++V  + +   ++A+ +   + +  + S+    N    G  +P+ +   +P   S+   +    V +   L   +         G    F   N +      S +     D Y+                 LSF    I K+  VS++++ NS  G    ++Y Q+W  L+ L+ DP+P+VS LA K++ +I
Sbjct:  404 FRPSEFFTQQLTAFEVWLTMGVENRNPPEQLPIVLQVLLSQVHRLRALELLGQFLDLGPWAVSLALSVGIFPYVLKLLQSSARELRPLLVFIWAKILAVDSS--CQADLVKDNGHKYFLSVLADNYMPAEH--RTMAVFILAVIVNNYSTGQEACLQGNLIANCLEQL--------SDPHPLLRQWVAICLGRIWQNFDPARWCGVRDSAHEKLYTLLSDPIPEVRCAAVFALGTFVGNS---GERTDHSTTIDHNVAM-MLAQLINDGSPVVRKELVVALSHLVVQYESNFCTVALQF---IEEEKNYSVPSPANTTEPGNLTPVRDSPAIPRLRSVNSYTNIRAVTTARNLNKSLQ-NLNLNEEGGPAAFSPGNLSTSSSASSTLGSPDNDEYI-----------------LSFET--IDKMRRVSSYSSLNSLIGVSFNSVYTQIWRVLLHLAADPFPEVSDLAMKVLNSI 838          

HSP 3 Score: 137.502 bits (345), Expect = 5.357e-32
Identity = 80/285 (28.07%), Postives = 141/285 (49.47%), Query Frame = 2
Query: 3632 RNERLKKQKNIKLEGAQNWKASLNSSGTQLSQIFLQKIDSKPELLKFHPYLNYLAVVDRSGVSLWNWESGQRAQYMLSQSVSCKXXXXXXXXXXXXXXXXXXLEFINAEEDRGGLILVGTMDGRIKIWRNYLRDMGQDPDIVTAWIALPDQICSNRP----------------SGLITHWSQSLGQLTISGDVKYIRLWDSLQECKISDMNTNSESCVSSIDRSQDGRLIVAGFGDGHIKMFDIRAPVNECVINAGVGDMGWIHKVAYS-DSTNQVYSIGIYGEL 4435
            RN R+++Q  +     Q   + L+       QIF+ +    P ++KFHP+   +AV D+  +  W+WE G+R  Y  + +                   IT+++++N  +    L+L  T DG ++IW+N+     ++P++VTAW  L D + + R                 +G++  W Q  G L  SGDV+ IR+WD+ +E K+ D+ T ++SCV+S+       L+VAG GDG +++FD R   NEC +        W+ K     ++   + S+ + G++
Sbjct:  993 RNARVRRQSRVI---TQRGISRLDD------QIFINRNPGVPSVVKFHPFNTCIAVADKDSICFWDWEKGERLDYFYNGN--------------PRYTRITAMQYLNGHD--CSLLLTATDDGALRIWKNFADQ--KNPEMVTAWQGLSDMLPTTRGLARRVSIYLDRSKQGGAGMVVDWEQETGLLMTSGDVRIIRIWDTDREMKVQDIPTGADSCVTSLSCDSHRSLVVAGLGDGSVRVFDRRMGPNECRVMTYREHGAWVVKAHLQKEADGNIISVSVNGDV 1250          
BLAST of Regulatory-associated protein of mTOR vs. Ensembl Medaka
Match: rptor (regulatory associated protein of MTOR complex 1 [Source:NCBI gene;Acc:101156464])

HSP 1 Score: 434.106 bits (1115), Expect = 1.222e-127
Identity = 209/375 (55.73%), Postives = 266/375 (70.93%), Query Frame = 2
Query:  110 DKSYPFVAFKARHLNXXXXXXXXXXXXXXKDKVRTLHVVLVLCLNLAVDPPDTLVKVSPCSKMEAWFDPKEKNLNRALEMIGKNLQIQYERWQPKARYRQSLDPTIEEIHRLCQSLRRSAREDRVLFHYNGHGVPRPTENGEIWVFNKAYTKYIPLSLYDLHSWMGGPTVYVFDCNNAGRIIRMMEQFSMKRFENNGTA--NSS----------SMDNIIILASCQENEDIPQNPEVPADLFTSCLTTPIKIALHWYLLRNQEIFPNYLNETMLELIGGSPSNRVSMFGEINWVFTAVTDTIAWSCLPPPLFQKLFRQDLLVASLFRNFLLAERIMHYYGLRPVSYPPLPKTYEHPMWDAWDHALDCYTSQLPEI 1198
            D   P    K RHL +      L +    KD+++T+ V LVLCLN+ VDPPD +VK SPC+++E W DP   +  +ALE IG NLQ QYE WQP+ARY+QSLDPT++E+ +LC SLRR+A+E+RVLFHYNGHGVPRPT NGEIWVFNK YT+YIPLS+YDL +WMG P+++V+DC+NAG I++  +QF+++R +    A  N S          SM N I LA+C+ +E +P NP++PADLFTSCLTTPI IAL W+ ++        +   ++E I G  ++R +  GE+NW+FTA+TDTIAW+ LP  LFQKLFRQDLLVASLFRNFLLAERIM  Y   PVS P LP TY H MW AWD A+D   SQLP I
Sbjct:   25 DWKLPLTFMKKRHLEKIEGSKALAQSWRMKDRMKTVSVALVLCLNVGVDPPD-VVKTSPCARLECWIDPLSMSPQKALETIGANLQKQYENWQPRARYKQSLDPTVDEVKKLCTSLRRNAKEERVLFHYNGHGVPRPTVNGEIWVFNKNYTQYIPLSIYDLQTWMGSPSIFVYDCSNAGIIVKSFKQFALQREQELEVAAINPSHPLAQMPLPPSMKNCIQLAACEASELLPMNPDLPADLFTSCLTTPITIALRWFCMQKSAKLVPGVTLDLIEKIPGRLNDRRTPLGELNWIFTAITDTIAWNVLPRDLFQKLFRQDLLVASLFRNFLLAERIMRSYNCTPVSSPRLPPTYMHAMWQAWDLAVDICLSQLPTI 398          

HSP 2 Score: 216.853 bits (551), Expect = 2.179e-56
Identity = 128/299 (42.81%), Postives = 189/299 (63.21%), Query Frame = 2
Query: 1709 FKHTDFFNDHMTAFELWLKTADEKKXXXXXXXXXXXXXXXXXHRYRALRLLSEYMDLGPWAVIQCLTVGIFPYVVRLLQSPVYDVKPYLVFIWGKIISSAQTDFAKNDVVKDAGYKYFVSCLTEN-EPYEIIIKTISAFALAKMLNNNPVGQKLYIKQNFMTVLIEELENNPSDLANDNYIRLRIWFILSFAKLWSDNDDAKWYGVRQQIHEKLLLYLKDISPEVRAATVYALGTFLNNKASDGIRSKHAVQVEQNICQHLLNHSVNDSSPLVRAELVVAMKYMVNLFSNQVMSMAIYY 2602
            F+ ++FF   +TAFE+WL    E +  P QLPI+LQVLLSQVHR RAL LL +++DLGPWAV   L+VGIFPYV++LLQS   +++P LVFIW KI++   +   + D+VKD G+KYF+S L +N  P E   +T++ F LA ++NN   GQ+  ++ N +   +E+L        +D +  LR W  +   ++W + D A+W GVR   HEKL   L D  PEVR A V+ALGTF+ N    G R+ H+  ++ N+   +L   +ND SP+VR ELVVA+ ++V  + +   ++A+ +
Sbjct:  404 FRPSEFFTQQLTAFEVWLTMGVENRNPPEQLPIVLQVLLSQVHRLRALELLGQFLDLGPWAVSLALSVGIFPYVLKLLQSSARELRPLLVFIWAKILAVDSS--CQADLVKDNGHKYFLSVLADNYMPAE--HRTMAVFILAVIVNNYSTGQEACLQGNLIANCLEQL--------SDPHPLLRQWVAICLGRIWQNFDPARWCGVRDSAHEKLYTLLSDPIPEVRCAAVFALGTFVGNS---GERTDHSTTIDHNVAM-MLAQLINDGSPVVRKELVVALSHLVVQYESNFCTVALQF 686          

HSP 3 Score: 147.902 bits (372), Expect = 3.809e-35
Identity = 80/269 (29.74%), Postives = 141/269 (52.42%), Query Frame = 2
Query: 3632 RNERLKKQKNIKLEGAQNWKASLNSSGTQLSQIFLQKIDSKPELLKFHPYLNYLAVVDRSGVSLWNWESGQRAQYMLSQSVSCKXXXXXXXXXXXXXXXXXXLEFINAEEDRGGLILVGTMDGRIKIWRNYLRDMGQDPDIVTAWIALPDQICSNRPSGLITHWSQSLGQLTISGDVKYIRLWDSLQECKISDMNTNSESCVSSIDRSQDGRLIVAGFGDGHIKMFDIRAPVNECVINAGVGDMGWIHKVAYS-DSTNQVYSIGIYGEL 4435
            RN R+++Q  +     Q   + L+       QIF+ +    P ++KFHP+   +AV D+  +  W+WE G+R  Y  + +                   IT+++++N  +    L+L  T DG ++IW+N+     ++P++VTAW  L D + + R +G++  W Q  G L  SGDV+ IR+WD+ +E K+ D+ T ++SCV+S+       L+VAG GDG +++FD R   NEC +        W+ K     ++   + S+ + G++
Sbjct: 1016 RNARVRRQSRVI---TQRGISRLDD------QIFINRNPGVPSVVKFHPFNTCIAVADKDSICFWDWEKGERLDYFYNGN--------------PRYTRITAMQYLNGHD--CSLLLTATDDGALRIWKNFADQ--KNPEMVTAWQGLSDMLPTTRGAGMVVDWEQETGLLMTSGDVRIIRIWDTDREMKVQDIPTGADSCVTSLSCDSHRSLVVAGLGDGSVRVFDRRMGPNECRVMTYREHGAWVVKAHLQKEADGNIISVSVNGDV 1257          
BLAST of Regulatory-associated protein of mTOR vs. Ensembl Medaka
Match: rptor (regulatory associated protein of MTOR complex 1 [Source:NCBI gene;Acc:101156464])

HSP 1 Score: 434.491 bits (1116), Expect = 1.316e-127
Identity = 209/375 (55.73%), Postives = 266/375 (70.93%), Query Frame = 2
Query:  110 DKSYPFVAFKARHLNXXXXXXXXXXXXXXKDKVRTLHVVLVLCLNLAVDPPDTLVKVSPCSKMEAWFDPKEKNLNRALEMIGKNLQIQYERWQPKARYRQSLDPTIEEIHRLCQSLRRSAREDRVLFHYNGHGVPRPTENGEIWVFNKAYTKYIPLSLYDLHSWMGGPTVYVFDCNNAGRIIRMMEQFSMKRFENNGTA--NSS----------SMDNIIILASCQENEDIPQNPEVPADLFTSCLTTPIKIALHWYLLRNQEIFPNYLNETMLELIGGSPSNRVSMFGEINWVFTAVTDTIAWSCLPPPLFQKLFRQDLLVASLFRNFLLAERIMHYYGLRPVSYPPLPKTYEHPMWDAWDHALDCYTSQLPEI 1198
            D   P    K RHL +      L +    KD+++T+ V LVLCLN+ VDPPD +VK SPC+++E W DP   +  +ALE IG NLQ QYE WQP+ARY+QSLDPT++E+ +LC SLRR+A+E+RVLFHYNGHGVPRPT NGEIWVFNK YT+YIPLS+YDL +WMG P+++V+DC+NAG I++  +QF+++R +    A  N S          SM N I LA+C+ +E +P NP++PADLFTSCLTTPI IAL W+ ++        +   ++E I G  ++R +  GE+NW+FTA+TDTIAW+ LP  LFQKLFRQDLLVASLFRNFLLAERIM  Y   PVS P LP TY H MW AWD A+D   SQLP I
Sbjct:   25 DWKLPLTFMKKRHLEKIEGSKALAQSWRMKDRMKTVSVALVLCLNVGVDPPD-VVKTSPCARLECWIDPLSMSPQKALETIGANLQKQYENWQPRARYKQSLDPTVDEVKKLCTSLRRNAKEERVLFHYNGHGVPRPTVNGEIWVFNKNYTQYIPLSIYDLQTWMGSPSIFVYDCSNAGIIVKSFKQFALQREQELEVAAINPSHPLAQMPLPPSMKNCIQLAACEASELLPMNPDLPADLFTSCLTTPITIALRWFCMQKSAKLVPGVTLDLIEKIPGRLNDRRTPLGELNWIFTAITDTIAWNVLPRDLFQKLFRQDLLVASLFRNFLLAERIMRSYNCTPVSSPRLPPTYMHAMWQAWDLAVDICLSQLPTI 398          

HSP 2 Score: 217.238 bits (552), Expect = 1.908e-56
Identity = 128/299 (42.81%), Postives = 189/299 (63.21%), Query Frame = 2
Query: 1709 FKHTDFFNDHMTAFELWLKTADEKKXXXXXXXXXXXXXXXXXHRYRALRLLSEYMDLGPWAVIQCLTVGIFPYVVRLLQSPVYDVKPYLVFIWGKIISSAQTDFAKNDVVKDAGYKYFVSCLTEN-EPYEIIIKTISAFALAKMLNNNPVGQKLYIKQNFMTVLIEELENNPSDLANDNYIRLRIWFILSFAKLWSDNDDAKWYGVRQQIHEKLLLYLKDISPEVRAATVYALGTFLNNKASDGIRSKHAVQVEQNICQHLLNHSVNDSSPLVRAELVVAMKYMVNLFSNQVMSMAIYY 2602
            F+ ++FF   +TAFE+WL    E +  P QLPI+LQVLLSQVHR RAL LL +++DLGPWAV   L+VGIFPYV++LLQS   +++P LVFIW KI++   +   + D+VKD G+KYF+S L +N  P E   +T++ F LA ++NN   GQ+  ++ N +   +E+L        +D +  LR W  +   ++W + D A+W GVR   HEKL   L D  PEVR A V+ALGTF+ N    G R+ H+  ++ N+   +L   +ND SP+VR ELVVA+ ++V  + +   ++A+ +
Sbjct:  404 FRPSEFFTQQLTAFEVWLTMGVENRNPPEQLPIVLQVLLSQVHRLRALELLGQFLDLGPWAVSLALSVGIFPYVLKLLQSSARELRPLLVFIWAKILAVDSS--CQADLVKDNGHKYFLSVLADNYMPAE--HRTMAVFILAVIVNNYSTGQEACLQGNLIANCLEQL--------SDPHPLLRQWVAICLGRIWQNFDPARWCGVRDSAHEKLYTLLSDPIPEVRCAAVFALGTFVGNS---GERTDHSTTIDHNVAM-MLAQLINDGSPVVRKELVVALSHLVVQYESNFCTVALQF 686          

HSP 3 Score: 137.502 bits (345), Expect = 5.668e-32
Identity = 80/285 (28.07%), Postives = 141/285 (49.47%), Query Frame = 2
Query: 3632 RNERLKKQKNIKLEGAQNWKASLNSSGTQLSQIFLQKIDSKPELLKFHPYLNYLAVVDRSGVSLWNWESGQRAQYMLSQSVSCKXXXXXXXXXXXXXXXXXXLEFINAEEDRGGLILVGTMDGRIKIWRNYLRDMGQDPDIVTAWIALPDQICSNRP----------------SGLITHWSQSLGQLTISGDVKYIRLWDSLQECKISDMNTNSESCVSSIDRSQDGRLIVAGFGDGHIKMFDIRAPVNECVINAGVGDMGWIHKVAYS-DSTNQVYSIGIYGEL 4435
            RN R+++Q  +     Q   + L+       QIF+ +    P ++KFHP+   +AV D+  +  W+WE G+R  Y  + +                   IT+++++N  +    L+L  T DG ++IW+N+     ++P++VTAW  L D + + R                 +G++  W Q  G L  SGDV+ IR+WD+ +E K+ D+ T ++SCV+S+       L+VAG GDG +++FD R   NEC +        W+ K     ++   + S+ + G++
Sbjct: 1016 RNARVRRQSRVI---TQRGISRLDD------QIFINRNPGVPSVVKFHPFNTCIAVADKDSICFWDWEKGERLDYFYNGN--------------PRYTRITAMQYLNGHD--CSLLLTATDDGALRIWKNFADQ--KNPEMVTAWQGLSDMLPTTRGLARRVSIYLDRSKQGGAGMVVDWEQETGLLMTSGDVRIIRIWDTDREMKVQDIPTGADSCVTSLSCDSHRSLVVAGLGDGSVRVFDRRMGPNECRVMTYREHGAWVVKAHLQKEADGNIISVSVNGDV 1273          
BLAST of Regulatory-associated protein of mTOR vs. Ensembl Medaka
Match: rptor (regulatory associated protein of MTOR complex 1 [Source:NCBI gene;Acc:101156464])

HSP 1 Score: 422.935 bits (1086), Expect = 9.228e-124
Identity = 209/375 (55.73%), Postives = 259/375 (69.07%), Query Frame = 2
Query:  110 DKSYPFVAFKARHLNXXXXXXXXXXXXXXKDKVRTLHVVLVLCLNLAVDPPDTLVKVSPCSKMEAWFDPKEKNLNRALEMIGKNLQIQYERWQPKARYRQSLDPTIEEIHRLCQSLRRSAREDRVLFHYNGHGVPRPTENGEIWVFNKAYTKYIPLSLYDLHSWMGGPTVYVFDCNNAGRIIRMMEQFSMKRFENNGTA--NSS----------SMDNIIILASCQENEDIPQNPEVPADLFTSCLTTPIKIALHWYLLRNQEIFPNYLNETMLELIGGSPSNRVSMFGEINWVFTAVTDTIAWSCLPPPLFQKLFRQDLLVASLFRNFLLAERIMHYYGLRPVSYPPLPKTYEHPMWDAWDHALDCYTSQLPEI 1198
            D   P    K RHL +      L +    KD+++T+ V LVLCLN+ VDPPD +VK SPC+++E W DP   +  +ALE IG NLQ QYE WQP+ARY+QSLDPT++E+ +LC SLRR+A+E+RVLFHYNGHGVPRPT NGEIWVFNK YT+YIPLS+YDL +WMG P+++V+DC+NAG I++  +QF+++R +    A  N S          SM N I LA+C+ +E +P NP++PADLFTSCLTTPI IAL W         P  LN+            R +  GE+NW+FTA+TDTIAW+ LP  LFQKLFRQDLLVASLFRNFLLAERIM  Y   PVS P LP TY H MW AWD A+D   SQLP I
Sbjct:   25 DWKLPLTFMKKRHLEKIEGSKALAQSWRMKDRMKTVSVALVLCLNVGVDPPD-VVKTSPCARLECWIDPLSMSPQKALETIGANLQKQYENWQPRARYKQSLDPTVDEVKKLCTSLRRNAKEERVLFHYNGHGVPRPTVNGEIWVFNKNYTQYIPLSIYDLQTWMGSPSIFVYDCSNAGIIVKSFKQFALQREQELEVAAINPSHPLAQMPLPPSMKNCIQLAACEASELLPMNPDLPADLFTSCLTTPITIALRW--------IPGRLND------------RRTPLGELNWIFTAITDTIAWNVLPRDLFQKLFRQDLLVASLFRNFLLAERIMRSYNCTPVSSPRLPPTYMHAMWQAWDLAVDICLSQLPTI 378          

HSP 2 Score: 216.853 bits (551), Expect = 2.036e-56
Identity = 128/299 (42.81%), Postives = 189/299 (63.21%), Query Frame = 2
Query: 1709 FKHTDFFNDHMTAFELWLKTADEKKXXXXXXXXXXXXXXXXXHRYRALRLLSEYMDLGPWAVIQCLTVGIFPYVVRLLQSPVYDVKPYLVFIWGKIISSAQTDFAKNDVVKDAGYKYFVSCLTEN-EPYEIIIKTISAFALAKMLNNNPVGQKLYIKQNFMTVLIEELENNPSDLANDNYIRLRIWFILSFAKLWSDNDDAKWYGVRQQIHEKLLLYLKDISPEVRAATVYALGTFLNNKASDGIRSKHAVQVEQNICQHLLNHSVNDSSPLVRAELVVAMKYMVNLFSNQVMSMAIYY 2602
            F+ ++FF   +TAFE+WL    E +  P QLPI+LQVLLSQVHR RAL LL +++DLGPWAV   L+VGIFPYV++LLQS   +++P LVFIW KI++   +   + D+VKD G+KYF+S L +N  P E   +T++ F LA ++NN   GQ+  ++ N +   +E+L        +D +  LR W  +   ++W + D A+W GVR   HEKL   L D  PEVR A V+ALGTF+ N    G R+ H+  ++ N+   +L   +ND SP+VR ELVVA+ ++V  + +   ++A+ +
Sbjct:  384 FRPSEFFTQQLTAFEVWLTMGVENRNPPEQLPIVLQVLLSQVHRLRALELLGQFLDLGPWAVSLALSVGIFPYVLKLLQSSARELRPLLVFIWAKILAVDSS--CQADLVKDNGHKYFLSVLADNYMPAE--HRTMAVFILAVIVNNYSTGQEACLQGNLIANCLEQL--------SDPHPLLRQWVAICLGRIWQNFDPARWCGVRDSAHEKLYTLLSDPIPEVRCAAVFALGTFVGNS---GERTDHSTTIDHNVAM-MLAQLINDGSPVVRKELVVALSHLVVQYESNFCTVALQF 666          

HSP 3 Score: 137.502 bits (345), Expect = 5.892e-32
Identity = 80/285 (28.07%), Postives = 141/285 (49.47%), Query Frame = 2
Query: 3632 RNERLKKQKNIKLEGAQNWKASLNSSGTQLSQIFLQKIDSKPELLKFHPYLNYLAVVDRSGVSLWNWESGQRAQYMLSQSVSCKXXXXXXXXXXXXXXXXXXLEFINAEEDRGGLILVGTMDGRIKIWRNYLRDMGQDPDIVTAWIALPDQICSNRP----------------SGLITHWSQSLGQLTISGDVKYIRLWDSLQECKISDMNTNSESCVSSIDRSQDGRLIVAGFGDGHIKMFDIRAPVNECVINAGVGDMGWIHKVAYS-DSTNQVYSIGIYGEL 4435
            RN R+++Q  +     Q   + L+       QIF+ +    P ++KFHP+   +AV D+  +  W+WE G+R  Y  + +                   IT+++++N  +    L+L  T DG ++IW+N+     ++P++VTAW  L D + + R                 +G++  W Q  G L  SGDV+ IR+WD+ +E K+ D+ T ++SCV+S+       L+VAG GDG +++FD R   NEC +        W+ K     ++   + S+ + G++
Sbjct:  996 RNARVRRQSRVI---TQRGISRLDD------QIFINRNPGVPSVVKFHPFNTCIAVADKDSICFWDWEKGERLDYFYNGN--------------PRYTRITAMQYLNGHD--CSLLLTATDDGALRIWKNFADQ--KNPEMVTAWQGLSDMLPTTRGLARRVSIYLDRSKQGGAGMVVDWEQETGLLMTSGDVRIIRIWDTDREMKVQDIPTGADSCVTSLSCDSHRSLVVAGLGDGSVRVFDRRMGPNECRVMTYREHGAWVVKAHLQKEADGNIISVSVNGDV 1253          
BLAST of Regulatory-associated protein of mTOR vs. Ensembl Medaka
Match: rptor (regulatory associated protein of MTOR complex 1 [Source:NCBI gene;Acc:101156464])

HSP 1 Score: 350.132 bits (897), Expect = 3.167e-99
Identity = 174/316 (55.06%), Postives = 220/316 (69.62%), Query Frame = 2
Query:  290 SKMEAWFDPKEKNLNRALEMI-GKNLQIQYERWQPKARYRQSLDPTIEEIHRLCQSLRRSAREDRVLFHYNGHGVPRPTENGEIWVFNKAYTKYIPLSLYDLHSWMGGPTVYVFDCNNAGRIIRMMEQFSMKRFENNGTA--NSS----------SMDNIIILASCQENEDIPQNPEVPADLFTSCLTTPIKIALHWYLLRNQEIFPNYLNETMLELIGGSPSNRVSMFGEINWVFTAVTDTIAWSCLPPPLFQKLFRQDLLVASLFRNFLLAERIMHYYGLRPVSYPPLPKTYEHPMWDAWDHALDCYTSQLPEI 1198
            + M  W  P      R LE I G     Q  R + +ARY+QSLDPT++E+ +LC SLRR+A+E+RVLFHYNGHGVPRPT NGEIWVFNK YT+YIPLS+YDL +WMG P+++V+DC+NAG I++  +QF+++R +    A  N S          SM N I LA+C+ +E +P NP++PADLFTSCLTTPI IAL W+ ++        +   ++E I G  ++R +  GE+NW+FTA+TDTIAW+ LP  LFQKLFRQDLLVASLFRNFLLAERIM  Y   PVS P LP TY H MW AWD A+D   SQLP I
Sbjct:   19 ADMNDWKLPLTFMKKRHLEKIEGSKALAQSWRMKDRARYKQSLDPTVDEVKKLCTSLRRNAKEERVLFHYNGHGVPRPTVNGEIWVFNKNYTQYIPLSIYDLQTWMGSPSIFVYDCSNAGIIVKSFKQFALQREQELEVAAINPSHPLAQMPLPPSMKNCIQLAACEASELLPMNPDLPADLFTSCLTTPITIALRWFCMQKSAKLVPGVTLDLIEKIPGRLNDRRTPLGELNWIFTAITDTIAWNVLPRDLFQKLFRQDLLVASLFRNFLLAERIMRSYNCTPVSSPRLPPTYMHAMWQAWDLAVDICLSQLPTI 334          

HSP 2 Score: 231.491 bits (589), Expect = 5.058e-61
Identity = 166/474 (35.02%), Postives = 257/474 (54.22%), Query Frame = 2
Query: 1709 FKHTDFFNDHMTAFELWLKTADEKKXXXXXXXXXXXXXXXXXHRYRALRLLSEYMDLGPWAVIQCLTVGIFPYVVRLLQSPVYDVKPYLVFIWGKIISSAQTDFAKNDVVKDAGYKYFVSCLTEN-EPYEIIIKTISAFALAKMLNNNPVGQKLYIKQNFMTVLIEELENNPSDLANDNYIRLRIWFILSFAKLWSDNDDAKWYGVRQQIHEKLLLYLKDISPEVRAATVYALGTFLNNKASDGIRSKHAVQVEQNICQHLLNHSVNDSSPLVRAELVVAMKYMVNLFSNQVMSMAIYYDVWLSQNNHGSINDVNNGKFMGPPSPLANRNVMPSRGSIEKISKRLFVHSPPALTDKISVRQKAVSSGDLTNFDENNNTFWLFKDSHIPFILPDMYLYGNINSTRGNLKNLGAELSFRPTFIKKVPAVSNFTTYNS--GFPIINIYAQMWFSLILLSKDPYPKVSILASKIVEAI 3121
            F+ ++FF   +TAFE+WL    E +  P QLPI+LQVLLSQVHR RAL LL +++DLGPWAV   L+VGIFPYV++LLQS   +++P LVFIW KI++   +   + D+VKD G+KYF+S L +N  P E   +T++ F LA ++NN   GQ+  ++ N +   +E+L        +D +  LR W  +   ++W + D A+W GVR   HEKL   L D  PEVR A V+ALGTF+ N    G R+ H+  ++ N+   +L   +ND SP+VR ELVVA+ ++V  + +   ++A+ +   + +  + S+    N    G  +P+ +   +P   S+   +    V +   L   +         G    F   N +      S +     D Y+                 LSF    I K+  VS++++ NS  G    ++Y Q+W  L+ L+ DP+P+VS LA K++ +I
Sbjct:  340 FRPSEFFTQQLTAFEVWLTMGVENRNPPEQLPIVLQVLLSQVHRLRALELLGQFLDLGPWAVSLALSVGIFPYVLKLLQSSARELRPLLVFIWAKILAVDSS--CQADLVKDNGHKYFLSVLADNYMPAEH--RTMAVFILAVIVNNYSTGQEACLQGNLIANCLEQL--------SDPHPLLRQWVAICLGRIWQNFDPARWCGVRDSAHEKLYTLLSDPIPEVRCAAVFALGTFVGNS---GERTDHSTTIDHNVAM-MLAQLINDGSPVVRKELVVALSHLVVQYESNFCTVALQF---IEEEKNYSVPSPANTTEPGNLTPVRDSPAIPRLRSVNSYTNIRAVTTARNLNKSLQ-NLNLNEEGGPAAFSPGNLSTSSSASSTLGSPDNDEYI-----------------LSFET--IDKMRRVSSYSSLNSLIGVSFNSVYTQIWRVLLHLAADPFPEVSDLAMKVLNSI 774          

HSP 3 Score: 147.902 bits (372), Expect = 3.588e-35
Identity = 80/269 (29.74%), Postives = 141/269 (52.42%), Query Frame = 2
Query: 3632 RNERLKKQKNIKLEGAQNWKASLNSSGTQLSQIFLQKIDSKPELLKFHPYLNYLAVVDRSGVSLWNWESGQRAQYMLSQSVSCKXXXXXXXXXXXXXXXXXXLEFINAEEDRGGLILVGTMDGRIKIWRNYLRDMGQDPDIVTAWIALPDQICSNRPSGLITHWSQSLGQLTISGDVKYIRLWDSLQECKISDMNTNSESCVSSIDRSQDGRLIVAGFGDGHIKMFDIRAPVNECVINAGVGDMGWIHKVAYS-DSTNQVYSIGIYGEL 4435
            RN R+++Q  +     Q   + L+       QIF+ +    P ++KFHP+   +AV D+  +  W+WE G+R  Y  + +                   IT+++++N  +    L+L  T DG ++IW+N+     ++P++VTAW  L D + + R +G++  W Q  G L  SGDV+ IR+WD+ +E K+ D+ T ++SCV+S+       L+VAG GDG +++FD R   NEC +        W+ K     ++   + S+ + G++
Sbjct:  929 RNARVRRQSRVI---TQRGISRLDD------QIFINRNPGVPSVVKFHPFNTCIAVADKDSICFWDWEKGERLDYFYNGN--------------PRYTRITAMQYLNGHD--CSLLLTATDDGALRIWKNFADQ--KNPEMVTAWQGLSDMLPTTRGAGMVVDWEQETGLLMTSGDVRIIRIWDTDREMKVQDIPTGADSCVTSLSCDSHRSLVVAGLGDGSVRVFDRRMGPNECRVMTYREHGAWVVKAHLQKEADGNIISVSVNGDV 1170          
BLAST of Regulatory-associated protein of mTOR vs. Planmine SMEST
Match: SMESG000039024.1 (SMESG000039024.1)

HSP 1 Score: 2813.1 bits (7291), Expect = 0.000e+0
Identity = 1490/1601 (93.07%), Postives = 1502/1601 (93.82%), Query Frame = 2
Query:   71 MRNIKKLIDIVEEDKSYPFVAFKARHLNXXXXXXXXXXXXXXKDKVRTLHVVLVLCLNLAVDPPDTLVKVSPCSKMEAWFDPKEKNLNRALEMIGKNLQIQYERWQPKARYRQSLDPTIEEIHRLCQSLRRSAREDRVLFHYNGHGVPRPTENGEIWVFNKAYTKYIPLSLYDLHSWMGGPTVYVFDCNNAGRIIRMMEQFSMKRFENNGTANSSSMDNIIILASCQENEDIPQNPEVPADLFTSCLTTPIKIALHWYLLRNQEIFPNYLNETMLELIGGSPSNRVSMFGEINWVFTAVTDTIAWSCLPPPLFQKLFRQDLLVASLFRNFLLAERIMHYYGLRPVSYPPLPKTYEHPMWDAWDHALDCYTSQLPEIYHKKQSMNNSNNTENLLIIRHPSFDPLIVXXXXXXXXXXXXXXXXXXXXXXXTKDKIMQSTLDQQKLIPRNVLLTDDFQELLNIKNESTKGFNQTEKFQQERSQKQDLIQTAWNDALKQHNNTNVFNTRKPQILPNPRVLRQNSQSGKVFPISKTNNLNPLNGPICDLFPFKHTDFFNDHMTAFELWLKTADEKKXXXXXXXXXXXXXXXXXHRYRALRLLSEYMDLGPWAVIQCLTVGIFPYVVRLLQSPVYDVKPYLVFIWGKIISSAQTDFAKNDVVKDAGYKYFVSCLTENEPYEIIIKTISAFALAKMLNNNPVGQKLYIKQNFMTVLIEELENNPSDLANDNYIRLRIWFILSFAKLWSDNDDAKWYGVRQQIHEKLLLYLKDISPEVRAATVYALGTFLNNKASDGIRSKHAVQVEQNICQHLLNHSVNDSSPLVRAELVVAMKYMVNLFSNQVMSMAIYYDVWLSQNNHGSINDVNNGKFMGPPSPLANRNVMPSRGSIEKISKRLFVHSP--PALTDKISVRQKAVSSGDLTNFDENNNTFWLFKDSHIPFILPDMYLYGNINSTRGNLKNLGAELSFRPTFIKKVPAVSNFTTYNSGFPIINIYAQMWFSLILLSKDPYPKVSILASKIVEAINLYKKITQKSESNELNQQNTDFQISPKLNCSPAQFIQPIHSALFPSHNRKXXXXXXXXXXXXXXXKYLNSFEEGYQFDFKDVSTDFFNWSSKYFTLPLLPFHKLAHLSIPGTNFHNENIKSINSMQYLNQSKSFDKVSYKKLPNLIISESKSKSSARRLMHVIDSAKYEDRNERLKKQKNIKLEGAQNWKASLNSSGTQLSQIFLQKIDSKPELLKFHPYLNYLAVVDRSGVSLWNWESGQRAQYMLSQSVSCKXXXXXXXXXXXXXXXXXXLEFINAEEDRGGLILVGTMDGRIKIWRNYLRDMGQDPDIVTAWIALPDQICSNRPSGLITHWSQSLGQLTISGDVKYIRLWDSLQECKISDMNTNSESCVSSIDRSQDGRLIVAGFGDGHIKMFDIRAPVNECVINAGVGDMGWIHKVAYSDSTNQVYSIGIYGELTTWCVRQRNLPKPYITPSRRPNPLRNTQNVDIDPKATSREGLLKDPFTSDSKLTLAKSINHSLKLQPVHCADLRVSSESDKEHLAVIGYGKESRGILTAIAPTGSINSNFKYFEGFSRANIEAPTSVCVHPYQTLVGAGLEDSS 4867
            MRNIKKLIDIVEEDKSYPFVAFKARHLNEEIEGIELYEEIYGKDKVRTLHVVLVLCLNLAVDPPDTLVKVSPCSKMEAWFDPKEKNLNRALEMIGKNLQIQYERWQPKARYRQSLDPTIEEIHRLCQSLRRSAREDRVLFHYNGHGVPRPTENGEIWVFNKAYTKYIPLSLYDLHSWMGGPTVYVFDCNNAGRIIRMMEQFSMKRFENNGTANSSSMDNIIILASCQENEDIPQNPEVPADLFTSCLTTPIKIALHWYLLRNQEIFPNYLNETMLELIGGSPSNRVSMFGEINWVFTAVTDTIAWSCLPPPLFQKLFRQDLLVASLFRNFLLAERIMHYYGLRPVSYPPLPKTYEHPMWDAWDHALDCYTSQLPEIYHKKQSMNNSNNTENLLIIRHPSFDPLIVNNMSNNDSSEEDDDDIDEDEDMSTKDKIMQSTLDQQKLIPRNVLLTDDFQELLNIKNE+TKGFNQTEKFQQERSQKQDLIQTAWNDALKQHNNTNVFNTRKPQILPNPRVLRQNSQSGKVFPISKTNNLNPLNGPICDLFPFKHTDFFNDHMTAFELWLKTADEKKPVPIQLPILLQVLLSQVHRYRALRLLSEYMDLGPWAVIQCLTVGIFPYVVRLLQSPVYDVKPYLVFIWGKIISSAQTDFAKNDVVKDAGYKYFVSCLTENEPYEIIIKTISAFALAKMLNNNPVGQKLYIKQNFMTVLIEELENNPSDLANDNYIRLRIWFILSFAKLWSDNDDAKWYGVRQQIHEKLLLYLKDISPEVRAATVYALGTFLNNKASDGIRSKHAVQVEQNICQHLLNHSVNDSSPLVRAELVVAMKYMVNLFSNQVMSMAIYYDVWLSQNNHGSINDVNNGKFMGPPSPLANRNVMPSRGSI    K L       P    K+           ++NF   N+ F        P I                  N+ A++ F    + K P           +P ++I                     LASKIVEAINLYKKITQKSESNELNQQNTDFQISPKLNCSPAQFIQPIHSALFPSHNRKIDAISSFISTDTSSDKYLNSFEEGYQFDFKDVSTDFFNWSSKYFTLPLLPFHKLAHLSIPGTNFHNENIKSINSMQYLNQSKSFDKVSYKKLPNLIISESKSKSSARRLMHVIDSAKYEDRNERLKKQKNIKLEGAQNWKASLNSSGTQLSQIFLQKIDSKPELLKFHPYLNYLAVVDRSGVSLWNWESGQRAQYMLSQSVSCKEETEIDSSSSETSGYITSLEFINAEEDRGGLILVGTMDGRIKIWRNYLRDMGQDPDIVTAWIALPDQICSNRPSGLITHWSQSLGQLTISGDVKYIRLWDSLQECKISDMNTNSESCVSSIDRSQDGRLIVAGFGDGHIKMFDIRAPVNECVINAGVGDMGWIHKVAYSDSTNQVYSIGIYGELTTWCVRQRNLPKPYITPSRRPNPLRNTQNVDIDPKATSREGLLKDPFTSDSKLTLAKSINHSLKLQPVHCADLRVSSESDKEHLAVIGYGKESRGILTAIAPTGSINSNFKYFEGFSRANIEAPTSVCVHPYQTLVGAGLEDSS
Sbjct:    1 MRNIKKLIDIVEEDKSYPFVAFKARHLNEEIEGIELYEEIYGKDKVRTLHVVLVLCLNLAVDPPDTLVKVSPCSKMEAWFDPKEKNLNRALEMIGKNLQIQYERWQPKARYRQSLDPTIEEIHRLCQSLRRSAREDRVLFHYNGHGVPRPTENGEIWVFNKAYTKYIPLSLYDLHSWMGGPTVYVFDCNNAGRIIRMMEQFSMKRFENNGTANSSSMDNIIILASCQENEDIPQNPEVPADLFTSCLTTPIKIALHWYLLRNQEIFPNYLNETMLELIGGSPSNRVSMFGEINWVFTAVTDTIAWSCLPPPLFQKLFRQDLLVASLFRNFLLAERIMHYYGLRPVSYPPLPKTYEHPMWDAWDHALDCYTSQLPEIYHKKQSMNNSNNTENLLIIRHPSFDPLIVNNMSNNDSSEEDDDDIDEDEDMSTKDKIMQSTLDQQKLIPRNVLLTDDFQELLNIKNENTKGFNQTEKFQQERSQKQDLIQTAWNDALKQHNNTNVFNTRKPQILPNPRVLRQNSQSGKVFPISKTNNLNPLNGPICDLFPFKHTDFFNDHMTAFELWLKTADEKKPVPIQLPILLQVLLSQVHRYRALRLLSEYMDLGPWAVIQCLTVGIFPYVVRLLQSPVYDVKPYLVFIWGKIISSAQTDFAKNDVVKDAGYKYFVSCLTENEPYEIIIKTISAFALAKMLNNNPVGQKLYIKQNFMTVLIEELENNPSDLANDNYIRLRIWFILSFAKLWSDNDDAKWYGVRQQIHEKLLLYLKDISPEVRAATVYALGTFLNNKASDGIRSKHAVQVEQNICQHLLNHSVNDSSPLVRAELVVAMKYMVNLFSNQVMSMAIYYDVWLSQNNHGSINDVNNGKFMGPPSPLANRNVMPSRGSIGGNLKNLGAELSFRPTFIKKVPA---------VSNFTTYNSGF--------PII------------------NIYAQMWFSLILLSKDP-----------YPKVSI---------------------LASKIVEAINLYKKITQKSESNELNQQNTDFQISPKLNCSPAQFIQPIHSALFPSHNRKIDAISSFISTDTSSDKYLNSFEEGYQFDFKDVSTDFFNWSSKYFTLPLLPFHKLAHLSIPGTNFHNENIKSINSMQYLNQSKSFDKVSYKKLPNLIISESKSKSSARRLMHVIDSAKYEDRNERLKKQKNIKLEGAQNWKASLNSSGTQLSQIFLQKIDSKPELLKFHPYLNYLAVVDRSGVSLWNWESGQRAQYMLSQSVSCKEETEIDSSSSETSGYITSLEFINAEEDRGGLILVGTMDGRIKIWRNYLRDMGQDPDIVTAWIALPDQICSNRPSGLITHWSQSLGQLTISGDVKYIRLWDSLQECKISDMNTNSESCVSSIDRSQDGRLIVAGFGDGHIKMFDIRAPVNECVINAGVGDMGWIHKVAYSDSTNQVYSIGIYGELTTWCVRQRNLPKPYITPSRRPNPLRNTQNVDIDPKATSREGLLKDPFTSDSKLTLAKSINHSLKLQPVHCADLRVSSESDKEHLAVIGYGKESRGILTAIAPTGSINSNFKYFEGFSRANIEAPTSVCVHPYQTLVGAGLEDSS 1534          
BLAST of Regulatory-associated protein of mTOR vs. Planmine SMEST
Match: SMESG000039024.1 (SMESG000039024.1)

HSP 1 Score: 1526.53 bits (3951), Expect = 0.000e+0
Identity = 796/797 (99.87%), Postives = 797/797 (100.00%), Query Frame = 2
Query:   71 MRNIKKLIDIVEEDKSYPFVAFKARHLNXXXXXXXXXXXXXXKDKVRTLHVVLVLCLNLAVDPPDTLVKVSPCSKMEAWFDPKEKNLNRALEMIGKNLQIQYERWQPKARYRQSLDPTIEEIHRLCQSLRRSAREDRVLFHYNGHGVPRPTENGEIWVFNKAYTKYIPLSLYDLHSWMGGPTVYVFDCNNAGRIIRMMEQFSMKRFENNGTANSSSMDNIIILASCQENEDIPQNPEVPADLFTSCLTTPIKIALHWYLLRNQEIFPNYLNETMLELIGGSPSNRVSMFGEINWVFTAVTDTIAWSCLPPPLFQKLFRQDLLVASLFRNFLLAERIMHYYGLRPVSYPPLPKTYEHPMWDAWDHALDCYTSQLPEIYHKKQSMNNSNNTENLLIIRHPSFDPLIVXXXXXXXXXXXXXXXXXXXXXXXTKDKIMQSTLDQQKLIPRNVLLTDDFQELLNIKNESTKGFNQTEKFQQERSQKQDLIQTAWNDALKQHNNTNVFNTRKPQILPNPRVLRQNSQSGKVFPISKTNNLNPLNGPICDLFPFKHTDFFNDHMTAFELWLKTADEKKXXXXXXXXXXXXXXXXXHRYRALRLLSEYMDLGPWAVIQCLTVGIFPYVVRLLQSPVYDVKPYLVFIWGKIISSAQTDFAKNDVVKDAGYKYFVSCLTENEPYEIIIKTISAFALAKMLNNNPVGQKLYIKQNFMTVLIEELENNPSDLANDNYIRLRIWFILSFAKLWSDNDDAKWYGVRQQIHEKLLLYLKDISPEVRAATVYALGTFLNNKASDGIRSKHAVQ 2461
            MRNIKKLIDIVEEDKSYPFVAFKARHLNEEIEGIELYEEIYGKDKVRTLHVVLVLCLNLAVDPPDTLVKVSPCSKMEAWFDPKEKNLNRALEMIGKNLQIQYERWQPKARYRQSLDPTIEEIHRLCQSLRRSAREDRVLFHYNGHGVPRPTENGEIWVFNKAYTKYIPLSLYDLHSWMGGPTVYVFDCNNAGRIIRMMEQFSMKRFENNGTANSSSMDNIIILASCQENEDIPQNPEVPADLFTSCLTTPIKIALHWYLLRNQEIFPNYLNETMLELIGGSPSNRVSMFGEINWVFTAVTDTIAWSCLPPPLFQKLFRQDLLVASLFRNFLLAERIMHYYGLRPVSYPPLPKTYEHPMWDAWDHALDCYTSQLPEIYHKKQSMNNSNNTENLLIIRHPSFDPLIVNNMSNNDSSEEDDDDIDEDEDMSTKDKIMQSTLDQQKLIPRNVLLTDDFQELLNIKNE+TKGFNQTEKFQQERSQKQDLIQTAWNDALKQHNNTNVFNTRKPQILPNPRVLRQNSQSGKVFPISKTNNLNPLNGPICDLFPFKHTDFFNDHMTAFELWLKTADEKKPVPIQLPILLQVLLSQVHRYRALRLLSEYMDLGPWAVIQCLTVGIFPYVVRLLQSPVYDVKPYLVFIWGKIISSAQTDFAKNDVVKDAGYKYFVSCLTENEPYEIIIKTISAFALAKMLNNNPVGQKLYIKQNFMTVLIEELENNPSDLANDNYIRLRIWFILSFAKLWSDNDDAKWYGVRQQIHEKLLLYLKDISPEVRAATVYALGTFLNNKASDGIRSKHAVQ
Sbjct:    1 MRNIKKLIDIVEEDKSYPFVAFKARHLNEEIEGIELYEEIYGKDKVRTLHVVLVLCLNLAVDPPDTLVKVSPCSKMEAWFDPKEKNLNRALEMIGKNLQIQYERWQPKARYRQSLDPTIEEIHRLCQSLRRSAREDRVLFHYNGHGVPRPTENGEIWVFNKAYTKYIPLSLYDLHSWMGGPTVYVFDCNNAGRIIRMMEQFSMKRFENNGTANSSSMDNIIILASCQENEDIPQNPEVPADLFTSCLTTPIKIALHWYLLRNQEIFPNYLNETMLELIGGSPSNRVSMFGEINWVFTAVTDTIAWSCLPPPLFQKLFRQDLLVASLFRNFLLAERIMHYYGLRPVSYPPLPKTYEHPMWDAWDHALDCYTSQLPEIYHKKQSMNNSNNTENLLIIRHPSFDPLIVNNMSNNDSSEEDDDDIDEDEDMSTKDKIMQSTLDQQKLIPRNVLLTDDFQELLNIKNENTKGFNQTEKFQQERSQKQDLIQTAWNDALKQHNNTNVFNTRKPQILPNPRVLRQNSQSGKVFPISKTNNLNPLNGPICDLFPFKHTDFFNDHMTAFELWLKTADEKKPVPIQLPILLQVLLSQVHRYRALRLLSEYMDLGPWAVIQCLTVGIFPYVVRLLQSPVYDVKPYLVFIWGKIISSAQTDFAKNDVVKDAGYKYFVSCLTENEPYEIIIKTISAFALAKMLNNNPVGQKLYIKQNFMTVLIEELENNPSDLANDNYIRLRIWFILSFAKLWSDNDDAKWYGVRQQIHEKLLLYLKDISPEVRAATVYALGTFLNNKASDGIRSKHAVQ 797          
BLAST of Regulatory-associated protein of mTOR vs. Planmine SMEST
Match: SMESG000039024.1 (SMESG000039024.1)

HSP 1 Score: 1274.61 bits (3297), Expect = 0.000e+0
Identity = 661/661 (100.00%), Postives = 661/661 (100.00%), Query Frame = 2
Query: 2885 MYLYGNINSTRGNLKNLGAELSFRPTFIKKVPAVSNFTTYNSGFPIINIYAQMWFSLILLSKDPYPKVSILASKIVEAINLYKKITQKSESNELNQQNTDFQISPKLNCSPAQFIQPIHSALFPSHNRKXXXXXXXXXXXXXXXKYLNSFEEGYQFDFKDVSTDFFNWSSKYFTLPLLPFHKLAHLSIPGTNFHNENIKSINSMQYLNQSKSFDKVSYKKLPNLIISESKSKSSARRLMHVIDSAKYEDRNERLKKQKNIKLEGAQNWKASLNSSGTQLSQIFLQKIDSKPELLKFHPYLNYLAVVDRSGVSLWNWESGQRAQYMLSQSVSCKXXXXXXXXXXXXXXXXXXLEFINAEEDRGGLILVGTMDGRIKIWRNYLRDMGQDPDIVTAWIALPDQICSNRPSGLITHWSQSLGQLTISGDVKYIRLWDSLQECKISDMNTNSESCVSSIDRSQDGRLIVAGFGDGHIKMFDIRAPVNECVINAGVGDMGWIHKVAYSDSTNQVYSIGIYGELTTWCVRQRNLPKPYITPSRRPNPLRNTQNVDIDPKATSREGLLKDPFTSDSKLTLAKSINHSLKLQPVHCADLRVSSESDKEHLAVIGYGKESRGILTAIAPTGSINSNFKYFEGFSRANIEAPTSVCVHPYQTLVGAGLEDSS 4867
            MYLYGNINSTRGNLKNLGAELSFRPTFIKKVPAVSNFTTYNSGFPIINIYAQMWFSLILLSKDPYPKVSILASKIVEAINLYKKITQKSESNELNQQNTDFQISPKLNCSPAQFIQPIHSALFPSHNRKIDAISSFISTDTSSDKYLNSFEEGYQFDFKDVSTDFFNWSSKYFTLPLLPFHKLAHLSIPGTNFHNENIKSINSMQYLNQSKSFDKVSYKKLPNLIISESKSKSSARRLMHVIDSAKYEDRNERLKKQKNIKLEGAQNWKASLNSSGTQLSQIFLQKIDSKPELLKFHPYLNYLAVVDRSGVSLWNWESGQRAQYMLSQSVSCKEETEIDSSSSETSGYITSLEFINAEEDRGGLILVGTMDGRIKIWRNYLRDMGQDPDIVTAWIALPDQICSNRPSGLITHWSQSLGQLTISGDVKYIRLWDSLQECKISDMNTNSESCVSSIDRSQDGRLIVAGFGDGHIKMFDIRAPVNECVINAGVGDMGWIHKVAYSDSTNQVYSIGIYGELTTWCVRQRNLPKPYITPSRRPNPLRNTQNVDIDPKATSREGLLKDPFTSDSKLTLAKSINHSLKLQPVHCADLRVSSESDKEHLAVIGYGKESRGILTAIAPTGSINSNFKYFEGFSRANIEAPTSVCVHPYQTLVGAGLEDSS
Sbjct:    1 MYLYGNINSTRGNLKNLGAELSFRPTFIKKVPAVSNFTTYNSGFPIINIYAQMWFSLILLSKDPYPKVSILASKIVEAINLYKKITQKSESNELNQQNTDFQISPKLNCSPAQFIQPIHSALFPSHNRKIDAISSFISTDTSSDKYLNSFEEGYQFDFKDVSTDFFNWSSKYFTLPLLPFHKLAHLSIPGTNFHNENIKSINSMQYLNQSKSFDKVSYKKLPNLIISESKSKSSARRLMHVIDSAKYEDRNERLKKQKNIKLEGAQNWKASLNSSGTQLSQIFLQKIDSKPELLKFHPYLNYLAVVDRSGVSLWNWESGQRAQYMLSQSVSCKEETEIDSSSSETSGYITSLEFINAEEDRGGLILVGTMDGRIKIWRNYLRDMGQDPDIVTAWIALPDQICSNRPSGLITHWSQSLGQLTISGDVKYIRLWDSLQECKISDMNTNSESCVSSIDRSQDGRLIVAGFGDGHIKMFDIRAPVNECVINAGVGDMGWIHKVAYSDSTNQVYSIGIYGELTTWCVRQRNLPKPYITPSRRPNPLRNTQNVDIDPKATSREGLLKDPFTSDSKLTLAKSINHSLKLQPVHCADLRVSSESDKEHLAVIGYGKESRGILTAIAPTGSINSNFKYFEGFSRANIEAPTSVCVHPYQTLVGAGLEDSS 661          
The following BLAST results are available for this feature:
BLAST of Regulatory-associated protein of mTOR vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
RPTOR6.001e-12853.10regulatory associated protein of MTOR complex 1 [S... [more]
RPTOR3.088e-12752.26regulatory associated protein of MTOR complex 1 [S... [more]
RPTOR1.192e-12652.26regulatory associated protein of MTOR complex 1 [S... [more]
RPTOR7.359e-1037.80regulatory associated protein of MTOR complex 1 [S... [more]
back to top
BLAST of Regulatory-associated protein of mTOR vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
daf-154.641e-8140.64DAF-15 [Source:UniProtKB/TrEMBL;Acc:Q68TI8][more]
daf-154.884e-8140.64DAF-15 [Source:UniProtKB/TrEMBL;Acc:Q68TI8][more]
daf-155.368e-8140.64DAF-15 [Source:UniProtKB/TrEMBL;Acc:Q68TI8][more]
daf-151.022e-8040.32DAF-15 [Source:UniProtKB/TrEMBL;Acc:Q68TI8][more]
daf-151.225e-8040.32DAF-15 [Source:UniProtKB/TrEMBL;Acc:Q68TI8][more]
back to top
BLAST of Regulatory-associated protein of mTOR vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
raptor1.384e-11450.55gene:FBgn0029840 transcript:FBtr0345895[more]
raptor1.384e-11450.55gene:FBgn0029840 transcript:FBtr0332964[more]
back to top
BLAST of Regulatory-associated protein of mTOR vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rptor1.250e-12754.03regulatory associated protein of MTOR, complex 1 [... [more]
rptor1.250e-12754.03regulatory associated protein of MTOR, complex 1 [... [more]
rptor1.252e-12754.03regulatory associated protein of MTOR, complex 1 [... [more]
rptor9.398e-10349.87regulatory associated protein of MTOR, complex 1 [... [more]
rptor4.855e-2832.62regulatory associated protein of MTOR, complex 1 [... [more]
back to top
BLAST of Regulatory-associated protein of mTOR vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rptor1.024e-12654.29regulatory associated protein of MTOR, complex 1 [... [more]
rptor1.343e-12654.29regulatory associated protein of MTOR, complex 1 [... [more]
rptor1.569e-12654.29regulatory associated protein of MTOR, complex 1 [... [more]
rptor1.429e-10149.60regulatory associated protein of MTOR, complex 1 [... [more]
rptor1.210e-9852.52regulatory associated protein of MTOR, complex 1 [... [more]
back to top
BLAST of Regulatory-associated protein of mTOR vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Rptor7.653e-12752.65regulatory associated protein of MTOR, complex 1 [... [more]
Rptor1.185e-12652.26regulatory associated protein of MTOR, complex 1 [... [more]
Rptor5.821e-3334.62regulatory associated protein of MTOR, complex 1 [... [more]
Rptor3.859e-2867.07regulatory associated protein of MTOR, complex 1 [... [more]
back to top
BLAST of Regulatory-associated protein of mTOR vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8N122|RPTOR_HUMAN5.723e-12652.26Regulatory-associated protein of mTOR OS=Homo sapi... [more]
sp|Q8K4Q0|RPTOR_MOUSE5.950e-12652.26Regulatory-associated protein of mTOR OS=Mus muscu... [more]
sp|Q0IQN5|RTOR2_ORYSJ1.809e-11454.49Regulatory-associated protein of TOR 2 OS=Oryza sa... [more]
sp|Q93YQ1|RTOR1_ARATH5.646e-11153.89Regulatory-associated protein of TOR 1 OS=Arabidop... [more]
sp|P87141|MIP1_SCHPO7.409e-10952.63Target of rapamycin complex 1 subunit mip1 OS=Schi... [more]
back to top
BLAST of Regulatory-associated protein of mTOR vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
H9XVZ51.359e-6191.84Raptor OS=Schmidtea mediterranea OX=79327 PE=2 SV=... [more]
A0A1B6EH729.298e-13755.09Raptor_N domain-containing protein (Fragment) OS=C... [more]
A0A1B6JPA96.494e-13554.15Raptor_N domain-containing protein (Fragment) OS=H... [more]
A0A1S3IXK13.929e-13454.55regulatory-associated protein of mTOR-like OS=Ling... [more]
A0A1A8H1Z22.530e-13355.06Regulatory associated protein of MTOR, complex 1 (... [more]
back to top
BLAST of Regulatory-associated protein of mTOR vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rptor1.001e-12253.77regulatory associated protein of MTOR, complex 1 [... [more]
back to top
BLAST of Regulatory-associated protein of mTOR vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Regulatory-associated protein of mTOR vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
KOG17.029e-10247.90Subunit of TORC1; TORC1 is a rapamycin-sensitive c... [more]
back to top
BLAST of Regulatory-associated protein of mTOR vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO479336.814e-12752.73Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO261309.887e-1353.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Regulatory-associated protein of mTOR vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rptor1.058e-12755.73regulatory associated protein of MTOR complex 1 [S... [more]
rptor1.222e-12755.73regulatory associated protein of MTOR complex 1 [S... [more]
rptor1.316e-12755.73regulatory associated protein of MTOR complex 1 [S... [more]
rptor9.228e-12455.73regulatory associated protein of MTOR complex 1 [S... [more]
rptor3.167e-9955.06regulatory associated protein of MTOR complex 1 [S... [more]
back to top
BLAST of Regulatory-associated protein of mTOR vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000039024.10.000e+093.07SMESG000039024.1[more]
SMESG000039024.10.000e+099.87SMESG000039024.1[more]
SMESG000039024.10.000e+0100.00SMESG000039024.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028047 ID=SMED30028047|Name=Regulatory-associated protein of mTOR|organism=Schmidtea mediterranea sexual|type=transcript|length=4947bp
GTGAAAGTATTTAAAATATTCGGTATTAATTAATTTAATTTAATTTTTTT
TCTATTTTGACAAACTAAATATGCGAAATATAAAAAAATTGATTGATATT
GTGGAAGAAGATAAATCTTACCCTTTTGTAGCGTTTAAGGCACGTCATTT
GAATGAAGAGATTGAAGGAATTGAATTATATGAAGAAATTTATGGAAAAG
ATAAAGTGCGCACTTTGCACGTTGTTTTGGTGCTGTGTCTCAATCTTGCA
GTCGATCCACCTGATACATTGGTTAAAGTTTCTCCTTGTTCTAAAATGGA
AGCATGGTTTGATCCAAAAGAAAAGAATCTTAATAGAGCTTTGGAGATGA
TCGGGAAAAATTTGCAAATTCAGTATGAGCGATGGCAACCTAAGGCTCGT
TATAGGCAAAGTTTAGATCCGACAATTGAAGAAATTCATCGACTTTGCCA
AAGTCTTCGTAGGAGTGCTAGAGAAGACAGGGTTCTTTTTCACTACAATG
GCCACGGTGTTCCAAGACCAACCGAAAACGGTGAAATATGGGTATTTAAT
AAGGCTTATACAAAATACATTCCTTTATCGCTTTATGATTTACATTCTTG
GATGGGTGGGCCAACTGTGTATGTTTTTGACTGCAACAATGCCGGTAGAA
TAATCAGAATGATGGAGCAATTTTCGATGAAACGATTCGAAAATAATGGA
ACAGCGAATTCTTCATCAATGGACAACATAATCATTCTTGCTTCATGCCA
GGAAAATGAAGATATTCCGCAAAATCCGGAAGTACCTGCTGATTTATTTA
CTTCTTGTTTAACAACCCCAATAAAAATAGCCCTTCATTGGTATTTACTT
CGAAATCAAGAAATATTTCCAAATTATCTCAATGAAACTATGTTGGAGTT
GATTGGAGGAAGTCCATCGAATAGAGTCTCAATGTTTGGAGAAATAAATT
GGGTTTTTACTGCAGTAACTGACACAATTGCTTGGTCGTGTCTTCCTCCG
CCACTTTTTCAGAAGTTGTTTCGGCAGGATTTATTAGTTGCCAGCTTGTT
TCGGAATTTTCTGCTTGCAGAAAGAATAATGCATTATTATGGTCTGCGGC
CGGTTTCCTATCCTCCATTGCCTAAAACATACGAACATCCAATGTGGGAT
GCATGGGATCATGCTCTTGATTGCTACACGAGTCAGCTCCCTGAAATATA
TCACAAAAAACAATCTATGAATAATAGCAACAATACAGAAAACCTATTGA
TCATTAGACATCCATCATTTGATCCTCTTATTGTAAATAATATGAGTAAT
AATGATTCATCGGAGGAAGATGATGATGACATAGATGAGGATGAAGATAT
GTCAACAAAAGATAAAATTATGCAGTCAACTCTTGATCAGCAAAAGTTAA
TTCCTCGAAATGTTCTATTAACTGACGATTTCCAAGAATTATTAAATATT
AAAAATGAGAGTACAAAAGGTTTCAATCAAACTGAGAAATTTCAACAAGA
AAGATCACAAAAACAAGATTTGATACAGACGGCCTGGAACGATGCTCTGA
AACAACATAATAACACTAATGTTTTCAACACACGCAAACCTCAAATCTTA
CCAAACCCCCGAGTTCTTAGACAAAATAGTCAGTCTGGGAAAGTTTTCCC
TATTTCCAAAACCAATAATCTCAATCCTCTAAACGGCCCAATTTGCGATT
TGTTCCCATTTAAGCATACTGATTTTTTCAACGATCATATGACAGCGTTC
GAATTATGGCTAAAAACAGCAGATGAAAAGAAACCTGTTCCTATTCAGCT
TCCTATTCTATTGCAGGTTCTTTTAAGTCAAGTTCATCGATATAGAGCAC
TTAGATTACTTAGTGAATATATGGATCTTGGTCCTTGGGCTGTGATACAG
TGCTTGACGGTCGGCATTTTCCCCTATGTCGTTAGACTTCTACAAAGTCC
AGTTTATGATGTTAAACCTTATTTGGTCTTCATATGGGGAAAAATAATTT
CTAGTGCTCAGACGGATTTTGCGAAAAACGATGTTGTCAAAGATGCTGGA
TATAAATATTTCGTGTCGTGCTTGACAGAAAATGAGCCATATGAGATAAT
TATTAAAACGATTTCTGCATTCGCTCTAGCGAAAATGCTCAATAACAATC
CAGTAGGCCAGAAATTGTATATCAAACAGAATTTCATGACAGTGCTCATT
GAAGAATTGGAAAACAATCCATCGGATTTAGCAAATGACAATTATATTCG
ATTGCGAATTTGGTTTATTTTGTCATTTGCTAAGTTGTGGTCTGACAATG
ATGACGCGAAGTGGTACGGAGTTCGTCAACAAATACATGAAAAACTTCTG
TTATATTTGAAGGATATCAGTCCCGAAGTCCGAGCAGCAACTGTCTATGC
ACTGGGAACATTTCTCAACAACAAAGCTAGTGATGGTATTCGATCTAAGC
ACGCAGTGCAGGTAGAGCAAAATATTTGTCAACATTTGTTAAATCATTCC
GTAAATGATTCTTCTCCGTTGGTGCGCGCAGAACTAGTTGTTGCCATGAA
GTATATGGTGAACCTTTTTTCTAATCAAGTAATGTCAATGGCGATTTATT
ACGATGTGTGGTTATCGCAAAATAATCACGGTTCGATTAACGATGTGAAT
AATGGGAAATTTATGGGTCCGCCAAGTCCTTTAGCAAACAGAAATGTTAT
GCCTAGTCGCGGATCAATTGAAAAAATATCTAAAAGACTATTTGTTCATT
CACCTCCTGCTTTAACTGATAAAATCTCTGTGAGACAAAAAGCAGTTTCA
AGCGGAGATCTTACTAACTTCGATGAAAATAACAATACATTTTGGTTGTT
TAAAGATTCACACATTCCGTTTATTTTACCGGATATGTATTTGTATGGAA
ATATTAATTCAACAAGAGGAAATTTGAAAAATCTCGGAGCCGAATTATCA
TTTAGACCAACTTTTATCAAGAAAGTGCCTGCCGTGTCAAATTTTACTAC
ATACAATTCTGGATTTCCAATCATTAATATATATGCTCAAATGTGGTTCT
CGTTGATTCTCCTATCCAAAGACCCGTATCCTAAAGTTAGTATTTTAGCC
AGCAAGATCGTGGAGGCAATTAATCTTTACAAAAAGATAACACAAAAATC
AGAATCGAATGAATTAAACCAACAAAATACTGATTTTCAAATTAGCCCGA
AATTAAATTGCAGCCCAGCGCAATTTATTCAGCCGATTCATTCTGCTCTA
TTTCCGTCTCACAATCGTAAAATTGATGCTATTTCTAGTTTTATAAGCAC
CGATACATCATCAGATAAATATTTAAATTCCTTCGAGGAAGGCTATCAAT
TTGACTTCAAAGATGTGTCTACTGATTTTTTCAACTGGTCCTCCAAATAT
TTTACTCTGCCTTTATTACCTTTTCATAAATTGGCACATTTATCAATACC
TGGTACAAATTTCCACAATGAAAATATTAAATCCATAAACTCAATGCAAT
ACCTCAATCAGTCAAAATCATTTGATAAAGTTTCATACAAAAAGCTACCG
AATTTGATTATTTCAGAATCAAAATCAAAAAGTTCAGCTCGCCGATTGAT
GCATGTTATTGACAGTGCCAAATATGAAGATCGAAATGAAAGATTGAAAA
AACAAAAGAATATTAAACTAGAGGGAGCACAAAACTGGAAAGCAAGTTTA
AATTCTAGTGGAACACAGTTGTCTCAGATTTTCCTTCAAAAAATTGACTC
TAAACCGGAGTTATTAAAATTTCATCCATACCTCAACTATTTAGCTGTCG
TTGACAGATCTGGAGTATCATTATGGAATTGGGAATCTGGACAGAGAGCT
CAATATATGCTTTCTCAATCAGTGTCGTGTAAAGAAGAAACCGAAATTGA
TTCCTCATCTTCAGAAACGAGTGGCTATATTACTAGTTTAGAATTTATAA
ATGCTGAGGAAGATAGAGGTGGATTGATTCTCGTCGGTACCATGGATGGT
CGGATCAAAATTTGGCGTAACTATTTGCGTGATATGGGTCAGGATCCAGA
TATTGTTACTGCATGGATTGCTCTACCAGATCAAATATGCTCAAATCGGC
CCTCGGGTCTCATAACTCATTGGTCCCAGTCTTTGGGACAACTCACTATA
TCAGGCGATGTAAAATATATTCGATTGTGGGACAGCTTACAGGAATGTAA
AATTTCTGATATGAATACTAATTCTGAATCGTGTGTTTCATCCATTGATC
GCAGTCAAGATGGCCGTTTAATTGTAGCCGGTTTTGGAGATGGGCATATT
AAAATGTTTGATATACGTGCACCTGTCAATGAATGTGTTATAAATGCCGG
CGTAGGAGACATGGGTTGGATTCACAAAGTTGCTTATTCTGATTCCACAA
ATCAGGTGTATTCCATCGGAATTTACGGAGAATTAACAACCTGGTGTGTC
AGGCAACGTAATCTTCCAAAACCCTATATAACTCCGAGTCGGCGTCCAAA
CCCACTGAGAAATACTCAAAATGTGGACATAGACCCTAAAGCTACAAGTC
GCGAAGGATTATTGAAAGATCCATTTACATCAGATTCTAAGTTGACCTTA
GCCAAGTCAATTAATCACTCACTAAAATTGCAACCAGTTCATTGTGCAGA
TTTACGAGTAAGTAGTGAATCTGATAAAGAGCACCTTGCGGTTATAGGAT
ATGGTAAAGAATCGCGTGGAATACTAACTGCTATAGCCCCTACTGGTAGC
ATCAACTCCAATTTTAAGTATTTTGAAGGTTTTTCCCGAGCAAATATTGA
AGCTCCTACTTCTGTGTGTGTTCATCCATATCAAACGCTTGTAGGTGCGG
GCTTAGAGGATTCCAGTCTATTGTTGTTGAAATTGCTGCCAAAATAATAA
TTTCATTTTGTCTATGTTTTGTTAATAGAAATCCTGATTGTTTTCTT
back to top

protein sequence of SMED30028047-orf-1

>SMED30028047-orf-1 ID=SMED30028047-orf-1|Name=SMED30028047-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1609bp
MRNIKKLIDIVEEDKSYPFVAFKARHLNEEIEGIELYEEIYGKDKVRTLH
VVLVLCLNLAVDPPDTLVKVSPCSKMEAWFDPKEKNLNRALEMIGKNLQI
QYERWQPKARYRQSLDPTIEEIHRLCQSLRRSAREDRVLFHYNGHGVPRP
TENGEIWVFNKAYTKYIPLSLYDLHSWMGGPTVYVFDCNNAGRIIRMMEQ
FSMKRFENNGTANSSSMDNIIILASCQENEDIPQNPEVPADLFTSCLTTP
IKIALHWYLLRNQEIFPNYLNETMLELIGGSPSNRVSMFGEINWVFTAVT
DTIAWSCLPPPLFQKLFRQDLLVASLFRNFLLAERIMHYYGLRPVSYPPL
PKTYEHPMWDAWDHALDCYTSQLPEIYHKKQSMNNSNNTENLLIIRHPSF
DPLIVNNMSNNDSSEEDDDDIDEDEDMSTKDKIMQSTLDQQKLIPRNVLL
TDDFQELLNIKNESTKGFNQTEKFQQERSQKQDLIQTAWNDALKQHNNTN
VFNTRKPQILPNPRVLRQNSQSGKVFPISKTNNLNPLNGPICDLFPFKHT
DFFNDHMTAFELWLKTADEKKPVPIQLPILLQVLLSQVHRYRALRLLSEY
MDLGPWAVIQCLTVGIFPYVVRLLQSPVYDVKPYLVFIWGKIISSAQTDF
AKNDVVKDAGYKYFVSCLTENEPYEIIIKTISAFALAKMLNNNPVGQKLY
IKQNFMTVLIEELENNPSDLANDNYIRLRIWFILSFAKLWSDNDDAKWYG
VRQQIHEKLLLYLKDISPEVRAATVYALGTFLNNKASDGIRSKHAVQVEQ
NICQHLLNHSVNDSSPLVRAELVVAMKYMVNLFSNQVMSMAIYYDVWLSQ
NNHGSINDVNNGKFMGPPSPLANRNVMPSRGSIEKISKRLFVHSPPALTD
KISVRQKAVSSGDLTNFDENNNTFWLFKDSHIPFILPDMYLYGNINSTRG
NLKNLGAELSFRPTFIKKVPAVSNFTTYNSGFPIINIYAQMWFSLILLSK
DPYPKVSILASKIVEAINLYKKITQKSESNELNQQNTDFQISPKLNCSPA
QFIQPIHSALFPSHNRKIDAISSFISTDTSSDKYLNSFEEGYQFDFKDVS
TDFFNWSSKYFTLPLLPFHKLAHLSIPGTNFHNENIKSINSMQYLNQSKS
FDKVSYKKLPNLIISESKSKSSARRLMHVIDSAKYEDRNERLKKQKNIKL
EGAQNWKASLNSSGTQLSQIFLQKIDSKPELLKFHPYLNYLAVVDRSGVS
LWNWESGQRAQYMLSQSVSCKEETEIDSSSSETSGYITSLEFINAEEDRG
GLILVGTMDGRIKIWRNYLRDMGQDPDIVTAWIALPDQICSNRPSGLITH
WSQSLGQLTISGDVKYIRLWDSLQECKISDMNTNSESCVSSIDRSQDGRL
IVAGFGDGHIKMFDIRAPVNECVINAGVGDMGWIHKVAYSDSTNQVYSIG
IYGELTTWCVRQRNLPKPYITPSRRPNPLRNTQNVDIDPKATSREGLLKD
PFTSDSKLTLAKSINHSLKLQPVHCADLRVSSESDKEHLAVIGYGKESRG
ILTAIAPTGSINSNFKYFEGFSRANIEAPTSVCVHPYQTLVGAGLEDSSL
LLLKLLPK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000136whole organism
PLANA:0000429neoblast
Vocabulary: INTERPRO
TermDefinition
IPR004083Raptor
IPR036322WD40_repeat_dom_sf
IPR029347Raptor_N
IPR001680WD40_repeat
IPR011989ARM-like
IPR015943WD40/YVTN_repeat-like_dom_sf
IPR016024ARM-type_fold
IPR017986WD40_repeat_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0005488binding
Vocabulary: biological process
TermDefinition
GO:0031929TOR signaling
Vocabulary: cellular component
TermDefinition
GO:0031931TORC1 complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePRINTSPR01547YEAST176DUFcoord: 136..161
score: 86.26
coord: 110..131
score: 48.05
coord: 278..305
score: 58.16
coord: 1398..1416
score: 42.11
coord: 238..258
score: 70.75
coord: 44..65
score: 53.25
coord: 313..337
score: 86.29
coord: 89..108
score: 61.43
coord: 163..187
score: 55.43
NoneNo IPR availableGENE3DG3DSA:3.40.50.1460coord: 96..271
e-value: 4.2E-7
score: 32.0
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 412..426
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 409..428
NoneNo IPR availablePANTHERPTHR12848:SF16REGULATORY-ASSOCIATED PROTEIN OF MTORcoord: 42..1598
IPR001680WD40 repeatSMARTSM00320WD40_4coord: 1273..1316
e-value: 10.0
score: 10.7
coord: 1215..1253
e-value: 330.0
score: 1.1
coord: 1374..1414
e-value: 0.47
score: 19.1
IPR029347Raptor, N-terminal CASPase-like domainSMARTSM01302Raptor_N_2coord: 45..199
e-value: 7.1E-83
score: 291.3
IPR029347Raptor, N-terminal CASPase-like domainPFAMPF14538Raptor_Ncoord: 47..196
e-value: 1.3E-64
score: 216.6
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 1138..1324
e-value: 1.6E-5
score: 26.3
coord: 1325..1483
e-value: 1.5E-10
score: 42.8
IPR011989Armadillo-like helicalGENE3DG3DSA:1.25.10.10coord: 586..842
e-value: 8.1E-16
score: 59.7
IPR004083Regulatory associated protein of TORPANTHERPTHR12848Regulatory-associated protein of mTORcoord: 42..1598
IPR036322WD40-repeat-containing domain superfamilySUPERFAMILYSSF50978WD40 repeat-likecoord: 1219..1604
IPR016024Armadillo-type foldSUPERFAMILYSSF48371ARM repeatcoord: 566..831