Atlastin-1-like

Overview
NameAtlastin-1-like
Smed IDSMED30028046
Length (bp)2236
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Atlastin-1-like (SMED30028046) t-SNE clustered cells

Violin plots show distribution of expression levels for Atlastin-1-like (SMED30028046) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Atlastin-1-like (SMED30028046) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Atlastin-1-like (SMED30028046) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028046

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
posterior sideSMED30028046h1SMcG0017622 dd_Smed_v4_4450_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30028046h1SMcG0017622 dd_Smed_v4_4450_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Atlastin-1-like vs. Ensembl Human
Match: ATL1 (atlastin GTPase 1 [Source:HGNC Symbol;Acc:HGNC:11231])

HSP 1 Score: 384.8 bits (987), Expect = 1.214e-124
Identity = 197/487 (40.45%), Postives = 308/487 (63.24%), Query Frame = 2
Query:   62 NFKLNEDALKEILENEKIRDKSVVVISIAGDMRRGKSFMLNFFLKYLEAEDKNNWLSDPDTPLTGFSWKNGRDCDTTGILIWSEPYLMELEDGEECAVLLMDTQGTFDKKSTMRKNAMIFALSTMISSMQIFNVNSQLREDNLEFLSVFINYGRLAMERNETIKPFQHLQFLIRDWNSPYLNPYGLEGGKKYLDEFLMYDENDNPQIIGVRKFLHRCFSRIDCCLMPFPGSKVMSSEVFNGKLSDIKKGFVENLRLYVPKMLSADYVVPKAINGCNITCQELLEYFKAYFRIFSSDDIVAPQGIFDGIAEASNMASLNICKRFYNEEMEKICAS--KFLKESKLQKEHERICGAAIDKFNNRKNFGNAEHSVQFRLQLEQEIEECFKIFVEKNSFKN--KLDREAWTLFVLVMWYIIGQILRYILTWIGFDTASSWIGWALFVIVLTAISWG-VAYCTD-SQIKEYIDEVINASWESCLRPAYRYVA 1504
            +F+L+E AL  IL +E +RDK VV +S+AG  R+GKSF+++F L+Y+  ++  +W+ D + PLTGFSW+ G + +TTGI IWSE +L+   DG++ AVLLMDTQGTFD +ST+R +A +FALSTMISS+Q++N++  ++ED+L+ L +F  YGRLAME    +KPFQ L FL+RDW+ PY   YG +GG K+L++ L    N + ++  VRK +H CF+ I C L+P PG KV ++  F+GKL +I   F++NL++ +P +LS + +  K ING  ITC+ L+EYFKAY +I+  +++  P+ +    AEA+N+A++   K  YN++ME+IC     FL  + LQ +H ++   ++  F   K  G  E S ++  QLE EI+E +  +++ N  KN     R   TLFV++    I  ++  +  +IG D  +S     + + ++T  +W  + Y  +  ++   ID+V  A W+  L   Y   A
Sbjct:   45 SFELDETALNRILLSEAVRDKEVVAVSVAGAFRKGKSFLMDFMLRYMYNQESVDWVGDYNEPLTGFSWRGGSERETTGIQIWSEIFLINKPDGKKVAVLLMDTQGTFDSQSTLRDSATVFALSTMISSIQVYNLSQNVQEDDLQHLQLFTEYGRLAMEET-FLKPFQSLIFLVRDWSFPYEFSYGADGGAKFLEKRLKVSGNQHEELQNVRKHIHSCFTNISCFLLPHPGLKVATNPNFDGKLKEIDDEFIKNLKILIPWLLSPESLDIKEINGNKITCRGLVEYFKAYIKIYQGEELPHPKSMLQATAEANNLAAVATAKDTYNKKMEEICGGDKPFLAPNDLQTKHLQLKEESVKLFRGVKKMGGEEFSRRYLQQLESEIDELYIQYIKHNDSKNIFHAARTPATLFVVIF---ITYVIAGVTGFIGLDIIASLCNMIMGLTLITLCTWAYIRYSGEYRELGAVIDQVAAALWDQALYKLYSAAA 527          
BLAST of Atlastin-1-like vs. Ensembl Human
Match: ATL1 (atlastin GTPase 1 [Source:HGNC Symbol;Acc:HGNC:11231])

HSP 1 Score: 381.333 bits (978), Expect = 3.535e-123
Identity = 194/476 (40.76%), Postives = 305/476 (64.08%), Query Frame = 2
Query:   62 NFKLNEDALKEILENEKIRDKSVVVISIAGDMRRGKSFMLNFFLKYLEAEDKNNWLSDPDTPLTGFSWKNGRDCDTTGILIWSEPYLMELEDGEECAVLLMDTQGTFDKKSTMRKNAMIFALSTMISSMQIFNVNSQLREDNLEFLSVFINYGRLAMERNETIKPFQHLQFLIRDWNSPYLNPYGLEGGKKYLDEFLMYDENDNPQIIGVRKFLHRCFSRIDCCLMPFPGSKVMSSEVFNGKLSDIKKGFVENLRLYVPKMLSADYVVPKAINGCNITCQELLEYFKAYFRIFSSDDIVAPQGIFDGIAEASNMASLNICKRFYNEEMEKICAS--KFLKESKLQKEHERICGAAIDKFNNRKNFGNAEHSVQFRLQLEQEIEECFKIFVEKNSFKN--KLDREAWTLFVLVMWYIIGQILRYILTWIGFDTASSWIGWALFVIVLTAISWG-VAYCTD-SQIKEYIDEVINASWE 1471
            +F+L+E AL  IL +E +RDK VV +S+AG  R+GKSF+++F L+Y+  ++  +W+ D + PLTGFSW+ G + +TTGI IWSE +L+   DG++ AVLLMDTQGTFD +ST+R +A +FALSTMISS+Q++N++  ++ED+L+ L +F  YGRLAME    +KPFQ L FL+RDW+ PY   YG +GG K+L++ L    N + ++  VRK +H CF+ I C L+P PG KV ++  F+GKL +I   F++NL++ +P +LS + +  K ING  ITC+ L+EYFKAY +I+  +++  P+ +    AEA+N+A++   K  YN++ME+IC     FL  + LQ +H ++   ++  F   K  G  E S ++  QLE EI+E +  +++ N  KN     R   TLFV++    I  ++  +  +IG D  +S     + + ++T  +W  + Y  +  ++   ID+V  A W+
Sbjct:   45 SFELDETALNRILLSEAVRDKEVVAVSVAGAFRKGKSFLMDFMLRYMYNQESVDWVGDYNEPLTGFSWRGGSERETTGIQIWSEIFLINKPDGKKVAVLLMDTQGTFDSQSTLRDSATVFALSTMISSIQVYNLSQNVQEDDLQHLQLFTEYGRLAMEET-FLKPFQSLIFLVRDWSFPYEFSYGADGGAKFLEKRLKVSGNQHEELQNVRKHIHSCFTNISCFLLPHPGLKVATNPNFDGKLKEIDDEFIKNLKILIPWLLSPESLDIKEINGNKITCRGLVEYFKAYIKIYQGEELPHPKSMLQATAEANNLAAVATAKDTYNKKMEEICGGDKPFLAPNDLQTKHLQLKEESVKLFRGVKKMGGEEFSRRYLQQLESEIDELYIQYIKHNDSKNIFHAARTPATLFVVIF---ITYVIAGVTGFIGLDIIASLCNMIMGLTLITLCTWAYIRYSGEYRELGAVIDQVAAALWD 516          
BLAST of Atlastin-1-like vs. Ensembl Human
Match: ATL2 (atlastin GTPase 2 [Source:HGNC Symbol;Acc:HGNC:24047])

HSP 1 Score: 377.096 bits (967), Expect = 1.724e-121
Identity = 194/502 (38.65%), Postives = 315/502 (62.75%), Query Frame = 2
Query:   62 NFKLNEDALKEILENEKIRDKSVVVISIAGDMRRGKSFMLNFFLKYLEAEDKNNWLSDPDTPLTGFSWKNGRDCDTTGILIWSEPYLMELEDGEECAVLLMDTQGTFDKKSTMRKNAMIFALSTMISSMQIFNVNSQLREDNLEFLSVFINYGRLAMERNETIKPFQHLQFLIRDWNSPYLNPYGLEGGKKYLDEFLMYDENDNPQIIGVRKFLHRCFSRIDCCLMPFPGSKVMSSEVFNGKLSDIKKGFVENLRLYVPKMLSADYVVPKAINGCNITCQELLEYFKAYFRIFSSDDIVAPQGIFDGIAEASNMASLNICKRFYNEEMEKICAS--KFLKESKLQKEHERICGAAIDKFNNRKNFGNAEHSVQFRLQLEQEIEECFKIFVEKNSFKNKL--DREAWTLF-VLVMWYIIGQILRYILTWIGFDTASSWIGWALFVIVLTAISWG-VAYCTD-SQIKEYIDEVINASWESCLRPAYRYVAQRLVSQLAQNSLRA 1546
            NF+L+E+AL++IL  E IRD ++VV+S+AG  R+GKSF+L+F L+Y+  +D  +W+   + PLTGF+W+ G + +TTGI +W+E ++++  +G + AVLLMDTQG FD +ST++  A +FALSTM SS+Q++N++  ++ED+L+ L +F  YGRLAME     KPFQ L FLIRDW+ PY + YGLEGGK++L++ L   +N + ++  VRK +H CFS + C L+P PG KV ++  F+G+L DI + F   LR  VP +L+ + +V K I+G  +TC++L+EYFKAY +I+  +++  P+ +    AEA+N+A++   +  Y + ME++C     ++  S L+++H  +   AI +F + K  G  E   +++ QLE EIEE +  F++ N  KN     R   TLF V+   YII  +  +    IG ++ +      + + ++   +W  V Y  +  +I   ID++    WE  L+P    + +  + Q   NS++A
Sbjct:   54 NFELDEEALEQILLQEHIRDLNIVVVSVAGAFRKGKSFLLDFMLRYMYNKDSQSWIGGNNEPLTGFTWRGGCERETTGIQVWNEVFVIDRPNGTKVAVLLMDTQGAFDSQSTIKDCATVFALSTMTSSVQVYNLSQNIQEDDLQHLQLFTEYGRLAMEEIYQ-KPFQTLMFLIRDWSYPYEHSYGLEGGKQFLEKRLQVKQNQHEELQNVRKHIHNCFSNLGCFLLPHPGLKVATNPSFDGRLKDIDEDFKRELRNLVPLLLAPENLVEKEISGSKVTCRDLVEYFKAYIKIYQGEELPHPKSMLQATAEANNLAAVAGARDTYCKSMEQVCGGDKPYIAPSDLERKHLDLKEVAIKQFRSVKKMGGDEFCRRYQDQLEAEIEETYANFIKHNDGKNIFYAARTPATLFAVMFAMYIISGLTGF----IGLNSIAVLCNLVMGLALIFLCTWAYVKYSGEFREIGTVIDQIAETLWEQVLKPLGDNLMEENIRQSVTNSIKA 550          
BLAST of Atlastin-1-like vs. Ensembl Human
Match: ATL2 (atlastin GTPase 2 [Source:HGNC Symbol;Acc:HGNC:24047])

HSP 1 Score: 377.481 bits (968), Expect = 1.861e-121
Identity = 194/502 (38.65%), Postives = 315/502 (62.75%), Query Frame = 2
Query:   62 NFKLNEDALKEILENEKIRDKSVVVISIAGDMRRGKSFMLNFFLKYLEAEDKNNWLSDPDTPLTGFSWKNGRDCDTTGILIWSEPYLMELEDGEECAVLLMDTQGTFDKKSTMRKNAMIFALSTMISSMQIFNVNSQLREDNLEFLSVFINYGRLAMERNETIKPFQHLQFLIRDWNSPYLNPYGLEGGKKYLDEFLMYDENDNPQIIGVRKFLHRCFSRIDCCLMPFPGSKVMSSEVFNGKLSDIKKGFVENLRLYVPKMLSADYVVPKAINGCNITCQELLEYFKAYFRIFSSDDIVAPQGIFDGIAEASNMASLNICKRFYNEEMEKICAS--KFLKESKLQKEHERICGAAIDKFNNRKNFGNAEHSVQFRLQLEQEIEECFKIFVEKNSFKNKL--DREAWTLF-VLVMWYIIGQILRYILTWIGFDTASSWIGWALFVIVLTAISWG-VAYCTD-SQIKEYIDEVINASWESCLRPAYRYVAQRLVSQLAQNSLRA 1546
            NF+L+E+AL++IL  E IRD ++VV+S+AG  R+GKSF+L+F L+Y+  +D  +W+   + PLTGF+W+ G + +TTGI +W+E ++++  +G + AVLLMDTQG FD +ST++  A +FALSTM SS+Q++N++  ++ED+L+ L +F  YGRLAME     KPFQ L FLIRDW+ PY + YGLEGGK++L++ L   +N + ++  VRK +H CFS + C L+P PG KV ++  F+G+L DI + F   LR  VP +L+ + +V K I+G  +TC++L+EYFKAY +I+  +++  P+ +    AEA+N+A++   +  Y + ME++C     ++  S L+++H  +   AI +F + K  G  E   +++ QLE EIEE +  F++ N  KN     R   TLF V+   YII  +  +    IG ++ +      + + ++   +W  V Y  +  +I   ID++    WE  L+P    + +  + Q   NS++A
Sbjct:   72 NFELDEEALEQILLQEHIRDLNIVVVSVAGAFRKGKSFLLDFMLRYMYNKDSQSWIGGNNEPLTGFTWRGGCERETTGIQVWNEVFVIDRPNGTKVAVLLMDTQGAFDSQSTIKDCATVFALSTMTSSVQVYNLSQNIQEDDLQHLQLFTEYGRLAMEEIYQ-KPFQTLMFLIRDWSYPYEHSYGLEGGKQFLEKRLQVKQNQHEELQNVRKHIHNCFSNLGCFLLPHPGLKVATNPSFDGRLKDIDEDFKRELRNLVPLLLAPENLVEKEISGSKVTCRDLVEYFKAYIKIYQGEELPHPKSMLQATAEANNLAAVAGARDTYCKSMEQVCGGDKPYIAPSDLERKHLDLKEVAIKQFRSVKKMGGDEFCRRYQDQLEAEIEETYANFIKHNDGKNIFYAARTPATLFAVMFAMYIISGLTGF----IGLNSIAVLCNLVMGLALIFLCTWAYVKYSGEFREIGTVIDQIAETLWEQVLKPLGDNLMEENIRQSVTNSIKA 568          
BLAST of Atlastin-1-like vs. Ensembl Human
Match: ATL2 (atlastin GTPase 2 [Source:HGNC Symbol;Acc:HGNC:24047])

HSP 1 Score: 372.474 bits (955), Expect = 1.357e-119
Identity = 191/501 (38.12%), Postives = 312/501 (62.28%), Query Frame = 2
Query:   62 NFKLNEDALKEILENEKIRDKSVVVISIAGDMRRGKSFMLNFFLKYLEAEDKNNWLSDPDTPLTGFSWKNGRDCDTTGILIWSEPYLMELEDGEECAVLLMDTQGTFDKKSTMRKNAMIFALSTMISSMQIFNVNSQLREDNLEFLSVFINYGRLAMERNETIKPFQHLQFLIRDWNSPYLNPYGLEGGKKYLDEFLMYDENDNPQIIGVRKFLHRCFSRIDCCLMPFPGSKVMSSEVFNGKLSDIKKGFVENLRLYVPKMLSADYVVPKAINGCNITCQELLEYFKAYFRIFSSDDIVAPQGIFDGIAEASNMASLNICKRFYNEEMEKICAS--KFLKESKLQKEHERICGAAIDKFNNRKNFGNAEHSVQFRLQLEQEIEECFKIFVEKNSFKNKL--DREAWTLF-VLVMWYIIGQILRYILTWIGFDTASSWIGWALFVIVLTAISWG-VAYCTD-SQIKEYIDEVINASWESCLRPAYRYVAQRLVSQLAQNSLR 1543
            NF+L+E+AL++IL  E IRD ++VV+S+AG  R+GKSF+L+F L+Y+  +D  +W+   + PLTGF+W+ G + +TTGI +W+E ++++  +G + AVLLMDTQG FD +ST++  A +FALSTM SS+Q++N++  ++ED+L+ L +F  YGRLAME     KPFQ L FLIRDW+ PY + YGLEGGK++L++ L   +N + ++  VRK +H CFS + C L+P PG KV ++  F+G+L DI + F   LR  VP +L+ + +V K I+G  +TC++L+EYFKAY +I+  +++  P+ +    AEA+N+A++   +  Y + ME++C     ++  S L+++H  +   AI +F + K  G  E   +++ QLE EIEE +  F++ N  KN     R   TLF V+   YII  +  +    IG ++ +      + + ++   +W  V Y  +  +I   ID++    WE      +    +R+V +   ++ R
Sbjct:   72 NFELDEEALEQILLQEHIRDLNIVVVSVAGAFRKGKSFLLDFMLRYMYNKDSQSWIGGNNEPLTGFTWRGGCERETTGIQVWNEVFVIDRPNGTKVAVLLMDTQGAFDSQSTIKDCATVFALSTMTSSVQVYNLSQNIQEDDLQHLQLFTEYGRLAMEEIYQ-KPFQTLMFLIRDWSYPYEHSYGLEGGKQFLEKRLQVKQNQHEELQNVRKHIHNCFSNLGCFLLPHPGLKVATNPSFDGRLKDIDEDFKRELRNLVPLLLAPENLVEKEISGSKVTCRDLVEYFKAYIKIYQGEELPHPKSMLQATAEANNLAAVAGARDTYCKSMEQVCGGDKPYIAPSDLERKHLDLKEVAIKQFRSVKKMGGDEFCRRYQDQLEAEIEETYANFIKHNDGKNIFYAARTPATLFAVMFAMYIISGLTGF----IGLNSIAVLCNLVMGLALIFLCTWAYVKYSGEFREIGTVIDQIAETLWEQVFSKLFEVTRRRMVHRALSSAQR 567          
BLAST of Atlastin-1-like vs. Ensembl Celegans
Match: atln-1 (ATLastiN (Endoplasmic reticulum GTPase) related [Source:UniProtKB/TrEMBL;Acc:U4PLG5])

HSP 1 Score: 377.096 bits (967), Expect = 7.587e-122
Identity = 197/505 (39.01%), Postives = 312/505 (61.78%), Query Frame = 2
Query:   41 IID*NKDNFKLNEDALKEILENEKIRDKSVVVISIAGDMRRGKSFMLNFFLKYL-----------EAE-DKNNWLSDPDTPLTGFSWKNGRDCDTTGILIWSEPYLMELEDGEECAVLLMDTQGTFDKKSTMRKNAMIFALSTMISSMQIFNVNSQLREDNLEFLSVFINYGRLAMERNETIKPFQHLQFLIRDWNSPYLNPYGLEGGKKYLDEFLMYDENDNPQIIGVRKFLHRCFSRIDCCLMPFPGSKVMSSEVFNGKLSDIKKGFVENLRLYVPKMLSADYVVPKAINGCNITCQELLEYFKAYFRIFSSDDIVAPQGIFDGIAEASNMASLNICKRFYNEEMEKICA--SKFLKESKLQKEHERICGAAIDKFNNRKNFGNAEHSVQFRLQLEQEIEECFKIFVEKNSFKNKLDREAWTLFVLVMWYIIGQILRYILTWIGFDTASSWIGWALFVIVLTAISWGVAYCTDSQIKE---YIDEVINASWESCLRPAYRYVA 1504
            +++    +F+LN + L++IL + K+ DK V VI +AG  R+GKSF+LNFFL+YL           E E D + W+S P++PL+GFSW+ G + DT GILIWSEP++M+ ++GEE AVLLMDTQG FD +ST++  A IFALSTMISS+QI+N++  ++ED+L+ L +F  YGRLA+E + + KPFQ L FL+RDW+ PY   +G +GG++ LD  L   E  + ++  +R+ +  CF  I C LMP PG KV ++  F+GKL DI+  F + L + +P++L +  +V K ING  +TC+ELLEYFKAY  IF   D+  P+ +    AEA+N+A++   +  Y  EME++C   + ++  ++L + H+R+   AI +F N +  G  + S+QF  +LE +++E ++ +++ N+ KN L +   T  VLV   II  I +     IG D  +      L +++     W  +  +   ++E   Y+D+ +   W + + P   ++ 
Sbjct:   38 VVEDTDHSFELNTELLEKILLDPKVADKKVAVIGVAGAYRKGKSFLLNFFLRYLTWRSKADKVMGEVELDNSQWMS-PNSPLSGFSWRGGSERDTNGILIWSEPFIMKDKNGEEIAVLLMDTQGAFDSQSTVKDCATIFALSTMISSVQIYNLSQNIQEDDLQHLQLFTEYGRLALEDSAS-KPFQSLLFLVRDWSFPYEAEFGFQGGQRVLDRRLEVSEKQHAELQQLRQHIRSCFEDIRCFLMPHPGLKVATNPNFDGKLVDIENEFQQQLGVMIPRLLDSHALVHKEINGQKMTCRELLEYFKAYMHIFRGQDLPEPKSMLMATAEANNLAAVASARAVYQREMEEVCGGDTPYMSTNELLEHHDRVKNIAIREFRNARKMGGVDFSMQFLERLESDLQESYENYLKVNNGKN-LFKSMRTPTVLVTLMIIDYIFQEFFQLIGLDFIAGLCSSVLCLVIGALGVWAYSRYS-GHLREAGGYVDDAVTYVWTNFISPNANHLG 538          
BLAST of Atlastin-1-like vs. Ensembl Celegans
Match: atln-1 (ATLastiN (Endoplasmic reticulum GTPase) related [Source:UniProtKB/TrEMBL;Acc:U4PLG5])

HSP 1 Score: 371.318 bits (952), Expect = 3.828e-120
Identity = 192/469 (40.94%), Postives = 296/469 (63.11%), Query Frame = 2
Query:   41 IID*NKDNFKLNEDALKEILENEKIRDKSVVVISIAGDMRRGKSFMLNFFLKYL-----------EAE-DKNNWLSDPDTPLTGFSWKNGRDCDTTGILIWSEPYLMELEDGEECAVLLMDTQGTFDKKSTMRKNAMIFALSTMISSMQIFNVNSQLREDNLEFLSVFINYGRLAMERNETIKPFQHLQFLIRDWNSPYLNPYGLEGGKKYLDEFLMYDENDNPQIIGVRKFLHRCFSRIDCCLMPFPGSKVMSSEVFNGKLSDIKKGFVENLRLYVPKMLSADYVVPKAINGCNITCQELLEYFKAYFRIFSSDDIVAPQGIFDGIAEASNMASLNICKRFYNEEMEKICA--SKFLKESKLQKEHERICGAAIDKFNNRKNFGNAEHSVQFRLQLEQEIEECFKIFVEKNSFKNKLDREAWTLFVLVMWYIIGQILRYILTWIGFDTASSWIGWALFVIVLTAISWG 1405
            +++    +F+LN + L++IL + K+ DK V VI +AG  R+GKSF+LNFFL+YL           E E D + W+S P++PL+GFSW+ G + DT GILIWSEP++M+ ++GEE AVLLMDTQG FD +ST++  A IFALSTMISS+QI+N++  ++ED+L+ L +F  YGRLA+E + + KPFQ L FL+RDW+ PY   +G +GG++ LD  L   E  + ++  +R+ +  CF  I C LMP PG KV ++  F+GKL DI+  F + L + +P++L +  +V K ING  +TC+ELLEYFKAY  IF   D+  P+ +    AEA+N+A++   +  Y  EME++C   + ++  ++L + H+R+   AI +F N +  G  + S+QF  +LE +++E ++ +++ N+ KN L +   T  VLV   II  I +     IG D  +      L +++     W 
Sbjct:   38 VVEDTDHSFELNTELLEKILLDPKVADKKVAVIGVAGAYRKGKSFLLNFFLRYLTWRSKADKVMGEVELDNSQWMS-PNSPLSGFSWRGGSERDTNGILIWSEPFIMKDKNGEEIAVLLMDTQGAFDSQSTVKDCATIFALSTMISSVQIYNLSQNIQEDDLQHLQLFTEYGRLALEDSAS-KPFQSLLFLVRDWSFPYEAEFGFQGGQRVLDRRLEVSEKQHAELQQLRQHIRSCFEDIRCFLMPHPGLKVATNPNFDGKLVDIENEFQQQLGVMIPRLLDSHALVHKEINGQKMTCRELLEYFKAYMHIFRGQDLPEPKSMLMATAEANNLAAVASARAVYQREMEEVCGGDTPYMSTNELLEHHDRVKNIAIREFRNARKMGGVDFSMQFLERLESDLQESYENYLKVNNGKN-LFKSMRTPTVLVTLMIIDYIFQEFFQLIGLDFIAGLCSSVLCLVIGALGVWA 503          
BLAST of Atlastin-1-like vs. Ensembl Celegans
Match: atln-2 (ATLastiN (Endoplasmic reticulum GTPase) related [Source:UniProtKB/TrEMBL;Acc:A0A061AKV6])

HSP 1 Score: 263.848 bits (673), Expect = 4.106e-80
Identity = 143/375 (38.13%), Postives = 216/375 (57.60%), Query Frame = 2
Query:   65 FKLNEDALKEILENEKIRDKSVVVISIAGDMRRGKSFMLNFFLKYLEAEDKNN-------WLSDPDTPLTGFSWKNGRDCDTTGILIWSEPYLMELEDGEECAVLLMDTQGTFDKKSTMRKNAMIFALSTMISSMQIFNVNSQLREDNLEFLSVFINYGRLAMERNETI-KPFQHLQFLIRDWNSPYLNPYGLEGGKKYLDEFLMYDENDNPQIIGVRKFLHRCFSRIDCCLMPFPGSKVMSSEVFNGKLSDIKKGFVENLRLYVPKMLSADYVVPKAINGCNITCQELLEYFKAYFRIFSSDDIVAPQGIFDGIAEASNMASLNICKRFYNEEMEKIC-ASKFLKESKLQKEHERICGAAIDKFNNRKNFGNAE 1162
            F+LNE AL  +L +    +K +V+IS+AG  R+GKSF+LNFFL+YL +  K+        WL+D D  L GF W+ G   DT GI +W EP ++E   GE  AV+LMDTQGTFD  ST ++   +FALST++SS+QI+NV   ++ED L+ LS+F+ YGR+AME+     KPFQ L F +RD+ +     +G  GG  +LD  L  +     +I  VR+ L   F  I C L+P PG KV   + F G + D++  F E L+  VP +L    + PK +NG  +TC+++++YFK Y   F  + +  PQ I +  A+   + + +  K  Y+  M++    ++ + E KL + H +    A++ F+     G  E
Sbjct:   43 FRLNESALNSVLGHSACANKKIVIISVAGAFRKGKSFLLNFFLEYLYSLHKSQQSDSSLEWLTD-DCQLHGFHWRAGVKRDTVGIWLWGEPIMIESVTGEMFAVVLMDTQGTFDNNSTYQQCMTVFALSTIVSSVQIYNVVDNIQEDALQHLSLFVEYGRIAMEQPHNFGKPFQQLVFCVRDFKNQEEYEFGENGGTDFLDNVLQTNPEQPEEIKQVRELLREYFEDIQCYLLPHPGYKVAERQSFRGHVKDLRPLFREELKKMVPNLLGPHILKPKIVNGKTVTCRKMIQYFKEYAASFDGETLPQPQSILNANAKLICIEAAHEAKVNYSRGMDRSTYGTRMMSEKKLLEAHIKHGITALNIFDKCPRIGAKE 416          
BLAST of Atlastin-1-like vs. Ensembl Celegans
Match: atln-2 (ATLastiN (Endoplasmic reticulum GTPase) related [Source:UniProtKB/TrEMBL;Acc:A0A061AKV6])

HSP 1 Score: 264.233 bits (674), Expect = 2.033e-79
Identity = 143/375 (38.13%), Postives = 216/375 (57.60%), Query Frame = 2
Query:   65 FKLNEDALKEILENEKIRDKSVVVISIAGDMRRGKSFMLNFFLKYLEAEDKNN-------WLSDPDTPLTGFSWKNGRDCDTTGILIWSEPYLMELEDGEECAVLLMDTQGTFDKKSTMRKNAMIFALSTMISSMQIFNVNSQLREDNLEFLSVFINYGRLAMERNETI-KPFQHLQFLIRDWNSPYLNPYGLEGGKKYLDEFLMYDENDNPQIIGVRKFLHRCFSRIDCCLMPFPGSKVMSSEVFNGKLSDIKKGFVENLRLYVPKMLSADYVVPKAINGCNITCQELLEYFKAYFRIFSSDDIVAPQGIFDGIAEASNMASLNICKRFYNEEMEKIC-ASKFLKESKLQKEHERICGAAIDKFNNRKNFGNAE 1162
            F+LNE AL  +L +    +K +V+IS+AG  R+GKSF+LNFFL+YL +  K+        WL+D D  L GF W+ G   DT GI +W EP ++E   GE  AV+LMDTQGTFD  ST ++   +FALST++SS+QI+NV   ++ED L+ LS+F+ YGR+AME+     KPFQ L F +RD+ +     +G  GG  +LD  L  +     +I  VR+ L   F  I C L+P PG KV   + F G + D++  F E L+  VP +L    + PK +NG  +TC+++++YFK Y   F  + +  PQ I +  A+   + + +  K  Y+  M++    ++ + E KL + H +    A++ F+     G  E
Sbjct:   43 FRLNESALNSVLGHSACANKKIVIISVAGAFRKGKSFLLNFFLEYLYSLHKSQQSDSSLEWLTD-DCQLHGFHWRAGVKRDTVGIWLWGEPIMIESVTGEMFAVVLMDTQGTFDNNSTYQQCMTVFALSTIVSSVQIYNVVDNIQEDALQHLSLFVEYGRIAMEQPHNFGKPFQQLVFCVRDFKNQEEYEFGENGGTDFLDNVLQTNPEQPEEIKQVRELLREYFEDIQCYLLPHPGYKVAERQSFRGHVKDLRPLFREELKKMVPNLLGPHILKPKIVNGKTVTCRKMIQYFKEYAASFDGETLPQPQSILNANAKLICIEAAHEAKVNYSRGMDRSTYGTRMMSEKKLLEAHIKHGITALNIFDKCPRIGAKE 416          
BLAST of Atlastin-1-like vs. Ensembl Celegans
Match: atln-2 (ATLastiN (Endoplasmic reticulum GTPase) related [Source:UniProtKB/TrEMBL;Acc:A0A061AKV6])

HSP 1 Score: 184.496 bits (467), Expect = 2.893e-52
Identity = 101/283 (35.69%), Postives = 159/283 (56.18%), Query Frame = 2
Query:  320 LMELEDGEECAVLLMDTQGTFDKKSTMRKNAMIFALSTMISSMQIFNVNSQLREDNLEFLSVFINYGRLAMERNETI-KPFQHLQFLIRDWNSPYLNPYGLEGGKKYLDEFLMYDENDNPQIIGVRKFLHRCFSRIDCCLMPFPGSKVMSSEVFNGKLSDIKKGFVENLRLYVPKMLSADYVVPKAINGCNITCQELLEYFKAYFRIFSSDDIVAPQGIFDGIAEASNMASLNICKRFYNEEMEKIC-ASKFLKESKLQKEHERICGAAIDKFNNRKNFGNAE 1162
            ++E   GE  AV+LMDTQGTFD  ST ++   +FALST++SS+QI+NV   ++ED L+ LS+F+ YGR+AME+     KPFQ L F +RD+ +     +G  GG  +LD  L  +     +I  VR+ L   F  I C L+P PG KV   + F G + D++  F E L+  VP +L    + PK +NG  +TC+++++YFK Y   F  + +  PQ I +  A+   + + +  K  Y+  M++    ++ + E KL + H +    A++ F+     G  E
Sbjct:    1 MIESVTGEMFAVVLMDTQGTFDNNSTYQQCMTVFALSTIVSSVQIYNVVDNIQEDALQHLSLFVEYGRIAMEQPHNFGKPFQQLVFCVRDFKNQEEYEFGENGGTDFLDNVLQTNPEQPEEIKQVRELLREYFEDIQCYLLPHPGYKVAERQSFRGHVKDLRPLFREELKKMVPNLLGPHILKPKIVNGKTVTCRKMIQYFKEYAASFDGETLPQPQSILNANAKLICIEAAHEAKVNYSRGMDRSTYGTRMMSEKKLLEAHIKHGITALNIFDKCPRIGAKE 283          
BLAST of Atlastin-1-like vs. Ensembl Fly
Match: atl (gene:FBgn0039213 transcript:FBtr0084656)

HSP 1 Score: 355.91 bits (912), Expect = 4.976e-114
Identity = 182/502 (36.25%), Postives = 299/502 (59.56%), Query Frame = 2
Query:   56 KDNFKLNEDALKEILENEKIRDKSVVVISIAGDMRRGKSFMLNFFLKYLEAE----DKNNWLSDPDTPLTGFSWKNGRDCDTTGILIWSEPYLMELEDGEECAVLLMDTQGTFDKKSTMRKNAMIFALSTMISSMQIFNVNSQLREDNLEFLSVFINYGRLAMERNETIKPFQHLQFLIRDWNSPYLNPYGLEGGKKYLDEFLMYDENDNPQIIGVRKFLHRCFSRIDCCLMPFPGSKVMSSEVFNGKLSDIKKGFVENLRLYVPKMLSADYVVPKAINGCNITCQELLEYFKAYFRIFSSDDIVAPQGIFDGIAEASNMASLNICKRFYNEEMEKICASK--FLKESKLQKEHERICGAAIDKFNNRKNFGNAEHSVQFRLQLEQEIEECFKIFVEKNSFKNKLDREAWTLFVLVMWYIIGQILRYILTWIGFDTASSWIGWALFVIVLTAISWG-VAYCTD-SQIKEYIDEVINASWESCLRPAYRYVAQRLVSQLAQNS 1537
            +  F LNEDAL E+L  ++++D+ V V+S+AG  R+GKSF+L+FFL+Y+ ++    D  +WL     PL GFSW+ G + DTTGIL+WS+ +L +  +G++ A++L+DTQG FD +ST+R  A +FALSTM+SS+QI+N++  ++ED+L+ L +F  YGRLA+  +   KPFQ LQFL+RDW+ PY   YG  GG K L   L   +  +P++  +R+ +  CF+ + C LMP PG  V ++  F+G+L DI   F  +LR  VP +L+ D +V K I+G  +  ++L++YF++Y  I+  +++  P+ +    AEA+++ ++   K  Y + ME++C     +L  + LQ EH R+   A+ +F  ++  G  E + +FR QLE ++EE F  +   N  KN + + A T  V     +I  IL  I   +G  T +++    + V +LT   W  + Y  + S     +D+     WE  +RP Y    ++ +  +A ++
Sbjct:   14 EHTFVLNEDALSEVLMRDEVKDRFVCVVSVAGAFRKGKSFLLDFFLRYMYSKYVHHDATDWLGGESDPLEGFSWRGGSERDTTGILMWSDIFLHDYPNGDKIAIILLDTQGAFDSQSTVRDCATVFALSTMLSSVQIYNLSQNIQEDDLQHLQLFTEYGRLALA-DTGKKPFQRLQFLVRDWSFPYEAEYGALGGDKILKRRLEVSDKQHPELQSLRRHISSCFTEVACFLMPHPGLNVATNPKFDGRLQDITPEFKSSLRSLVPMLLAPDNLVYKEISGQRVRARDLIQYFQSYMNIYKGNELPEPKSMLVATAEANHLTAVAAAKELYGQLMEEVCGGTRPYLSTAHLQTEHLRVKDKALFQFAAKRKMGGEEFTEKFRKQLEDDLEEVFTNYQAHNESKN-IFKAARTPAVYFACAVIMYILSGIFGLVGLYTFANFCNLVMGVALLTLALWAYIRYSGELSDFGGKLDDFATLLWEKFMRPIYHGCMEKGIHHVATHA 513          
BLAST of Atlastin-1-like vs. Ensembl Fly
Match: atl (gene:FBgn0039213 transcript:FBtr0084657)

HSP 1 Score: 355.91 bits (912), Expect = 4.976e-114
Identity = 182/502 (36.25%), Postives = 299/502 (59.56%), Query Frame = 2
Query:   56 KDNFKLNEDALKEILENEKIRDKSVVVISIAGDMRRGKSFMLNFFLKYLEAE----DKNNWLSDPDTPLTGFSWKNGRDCDTTGILIWSEPYLMELEDGEECAVLLMDTQGTFDKKSTMRKNAMIFALSTMISSMQIFNVNSQLREDNLEFLSVFINYGRLAMERNETIKPFQHLQFLIRDWNSPYLNPYGLEGGKKYLDEFLMYDENDNPQIIGVRKFLHRCFSRIDCCLMPFPGSKVMSSEVFNGKLSDIKKGFVENLRLYVPKMLSADYVVPKAINGCNITCQELLEYFKAYFRIFSSDDIVAPQGIFDGIAEASNMASLNICKRFYNEEMEKICASK--FLKESKLQKEHERICGAAIDKFNNRKNFGNAEHSVQFRLQLEQEIEECFKIFVEKNSFKNKLDREAWTLFVLVMWYIIGQILRYILTWIGFDTASSWIGWALFVIVLTAISWG-VAYCTD-SQIKEYIDEVINASWESCLRPAYRYVAQRLVSQLAQNS 1537
            +  F LNEDAL E+L  ++++D+ V V+S+AG  R+GKSF+L+FFL+Y+ ++    D  +WL     PL GFSW+ G + DTTGIL+WS+ +L +  +G++ A++L+DTQG FD +ST+R  A +FALSTM+SS+QI+N++  ++ED+L+ L +F  YGRLA+  +   KPFQ LQFL+RDW+ PY   YG  GG K L   L   +  +P++  +R+ +  CF+ + C LMP PG  V ++  F+G+L DI   F  +LR  VP +L+ D +V K I+G  +  ++L++YF++Y  I+  +++  P+ +    AEA+++ ++   K  Y + ME++C     +L  + LQ EH R+   A+ +F  ++  G  E + +FR QLE ++EE F  +   N  KN + + A T  V     +I  IL  I   +G  T +++    + V +LT   W  + Y  + S     +D+     WE  +RP Y    ++ +  +A ++
Sbjct:   14 EHTFVLNEDALSEVLMRDEVKDRFVCVVSVAGAFRKGKSFLLDFFLRYMYSKYVHHDATDWLGGESDPLEGFSWRGGSERDTTGILMWSDIFLHDYPNGDKIAIILLDTQGAFDSQSTVRDCATVFALSTMLSSVQIYNLSQNIQEDDLQHLQLFTEYGRLALA-DTGKKPFQRLQFLVRDWSFPYEAEYGALGGDKILKRRLEVSDKQHPELQSLRRHISSCFTEVACFLMPHPGLNVATNPKFDGRLQDITPEFKSSLRSLVPMLLAPDNLVYKEISGQRVRARDLIQYFQSYMNIYKGNELPEPKSMLVATAEANHLTAVAAAKELYGQLMEEVCGGTRPYLSTAHLQTEHLRVKDKALFQFAAKRKMGGEEFTEKFRKQLEDDLEEVFTNYQAHNESKN-IFKAARTPAVYFACAVIMYILSGIFGLVGLYTFANFCNLVMGVALLTLALWAYIRYSGELSDFGGKLDDFATLLWEKFMRPIYHGCMEKGIHHVATHA 513          
BLAST of Atlastin-1-like vs. Ensembl Fly
Match: atl (gene:FBgn0039213 transcript:FBtr0345218)

HSP 1 Score: 355.91 bits (912), Expect = 4.976e-114
Identity = 182/502 (36.25%), Postives = 299/502 (59.56%), Query Frame = 2
Query:   56 KDNFKLNEDALKEILENEKIRDKSVVVISIAGDMRRGKSFMLNFFLKYLEAE----DKNNWLSDPDTPLTGFSWKNGRDCDTTGILIWSEPYLMELEDGEECAVLLMDTQGTFDKKSTMRKNAMIFALSTMISSMQIFNVNSQLREDNLEFLSVFINYGRLAMERNETIKPFQHLQFLIRDWNSPYLNPYGLEGGKKYLDEFLMYDENDNPQIIGVRKFLHRCFSRIDCCLMPFPGSKVMSSEVFNGKLSDIKKGFVENLRLYVPKMLSADYVVPKAINGCNITCQELLEYFKAYFRIFSSDDIVAPQGIFDGIAEASNMASLNICKRFYNEEMEKICASK--FLKESKLQKEHERICGAAIDKFNNRKNFGNAEHSVQFRLQLEQEIEECFKIFVEKNSFKNKLDREAWTLFVLVMWYIIGQILRYILTWIGFDTASSWIGWALFVIVLTAISWG-VAYCTD-SQIKEYIDEVINASWESCLRPAYRYVAQRLVSQLAQNS 1537
            +  F LNEDAL E+L  ++++D+ V V+S+AG  R+GKSF+L+FFL+Y+ ++    D  +WL     PL GFSW+ G + DTTGIL+WS+ +L +  +G++ A++L+DTQG FD +ST+R  A +FALSTM+SS+QI+N++  ++ED+L+ L +F  YGRLA+  +   KPFQ LQFL+RDW+ PY   YG  GG K L   L   +  +P++  +R+ +  CF+ + C LMP PG  V ++  F+G+L DI   F  +LR  VP +L+ D +V K I+G  +  ++L++YF++Y  I+  +++  P+ +    AEA+++ ++   K  Y + ME++C     +L  + LQ EH R+   A+ +F  ++  G  E + +FR QLE ++EE F  +   N  KN + + A T  V     +I  IL  I   +G  T +++    + V +LT   W  + Y  + S     +D+     WE  +RP Y    ++ +  +A ++
Sbjct:   14 EHTFVLNEDALSEVLMRDEVKDRFVCVVSVAGAFRKGKSFLLDFFLRYMYSKYVHHDATDWLGGESDPLEGFSWRGGSERDTTGILMWSDIFLHDYPNGDKIAIILLDTQGAFDSQSTVRDCATVFALSTMLSSVQIYNLSQNIQEDDLQHLQLFTEYGRLALA-DTGKKPFQRLQFLVRDWSFPYEAEYGALGGDKILKRRLEVSDKQHPELQSLRRHISSCFTEVACFLMPHPGLNVATNPKFDGRLQDITPEFKSSLRSLVPMLLAPDNLVYKEISGQRVRARDLIQYFQSYMNIYKGNELPEPKSMLVATAEANHLTAVAAAKELYGQLMEEVCGGTRPYLSTAHLQTEHLRVKDKALFQFAAKRKMGGEEFTEKFRKQLEDDLEEVFTNYQAHNESKN-IFKAARTPAVYFACAVIMYILSGIFGLVGLYTFANFCNLVMGVALLTLALWAYIRYSGELSDFGGKLDDFATLLWEKFMRPIYHGCMEKGIHHVATHA 513          
BLAST of Atlastin-1-like vs. Ensembl Zebrafish
Match: atl1 (atlastin GTPase 1 [Source:ZFIN;Acc:ZDB-GENE-030131-8003])

HSP 1 Score: 396.741 bits (1018), Expect = 1.898e-129
Identity = 208/489 (42.54%), Postives = 305/489 (62.37%), Query Frame = 2
Query:   62 NFKLNEDALKEILENEKIRDKSVVVISIAGDMRRGKSFMLNFFLKYLEAEDKNNWLSDPDTPLTGFSWKNGRDCDTTGILIWSEPYLMELEDGEECAVLLMDTQGTFDKKSTMRKNAMIFALSTMISSMQIFNVNSQLREDNLEFLSVFINYGRLAMERNETIKPFQHLQFLIRDWNSPYLNPYGLEGGKKYLDEFLMYDENDNPQIIGVRKFLHRCFSRIDCCLMPFPGSKVMSSEVFNGKLSDIKKGFVENLRLYVPKMLSADYVVPKAINGCNITCQELLEYFKAYFRIFSSDDIVAPQGIFDGIAEASNMASLNICKRFYNEEMEKICAS--KFLKESKLQKEHERICGAAIDKFNNRKNFGNAEHSVQFRLQLEQEIEECFKIFVEKNSFKN--KLDREAWTLFVL--VMWYIIGQILRYILTWIGFDTASSWIGWALFVIVLTAISWG-VAYCTD-SQIKEYIDEVINASWESCLRPAYRYVA 1504
             F+L+E AL +IL +E++RD+ VV IS+AG  R+GKSF+++F L+Y+ ++    WL D + PLTGFSW+ G + +TTGI IWSE +L++  DG + AVLLMDTQGTFD +ST+R +A +FALSTMISSMQ++N++  ++ED+L+ L +F  YGRLAME    +KPFQ L FL+RDW+ PY  PYG EGG K+L++ L   EN + ++  VRK +H CF+ I C LMP PG KV ++  F+G+L +I + F+ NL++ VP +L    +  K ING  ITC+ L+EYFKAY +I+  +++  P+ +    AEA+N+A++   K  YN +ME +      FL  S+LQ  H  I   A+  F + K  G  E S ++ LQLE EI+E F  +++ N  KN     R   TLFV+  VM+   G     I  ++G D  +S     L   ++T  +W  + Y  +  ++   ID+V  A W+  L   Y   A
Sbjct:   46 TFELDEAALSKILLSEEVRDREVVAISVAGAFRKGKSFLMDFMLRYMYSQASEKWLGDAEEPLTGFSWRGGSERETTGIQIWSEVFLVDKPDGSKVAVLLMDTQGTFDSQSTLRDSATVFALSTMISSMQVYNISQNVQEDDLQHLQLFTEYGRLAMEET-FLKPFQSLIFLVRDWSFPYEFPYGQEGGMKFLEKRLKISENQHEELQNVRKHIHSCFTNISCFLMPHPGLKVATNPHFDGRLREIDQEFINNLQVLVPCLLRPKNLDVKEINGSKITCRGLVEYFKAYIKIYQGEELPHPKSMLQATAEANNLAAVAGAKDLYNRKMEVVSGGDRPFLAPSELQARHLEIREEALALFRSVKKMGGEEFSRRYLLQLETEIDELFVQYIKHNDSKNIFHAARTPATLFVVIFVMYVAAG-----ITGFVGVDVIASVCNMVLGFALITLCTWAYIRYSGEYRELGAVIDQVAGALWDQALYKLYSVAA 528          
BLAST of Atlastin-1-like vs. Ensembl Zebrafish
Match: atl1 (atlastin GTPase 1 [Source:ZFIN;Acc:ZDB-GENE-030131-8003])

HSP 1 Score: 392.889 bits (1008), Expect = 5.935e-128
Identity = 205/478 (42.89%), Postives = 302/478 (63.18%), Query Frame = 2
Query:   62 NFKLNEDALKEILENEKIRDKSVVVISIAGDMRRGKSFMLNFFLKYLEAEDKNNWLSDPDTPLTGFSWKNGRDCDTTGILIWSEPYLMELEDGEECAVLLMDTQGTFDKKSTMRKNAMIFALSTMISSMQIFNVNSQLREDNLEFLSVFINYGRLAMERNETIKPFQHLQFLIRDWNSPYLNPYGLEGGKKYLDEFLMYDENDNPQIIGVRKFLHRCFSRIDCCLMPFPGSKVMSSEVFNGKLSDIKKGFVENLRLYVPKMLSADYVVPKAINGCNITCQELLEYFKAYFRIFSSDDIVAPQGIFDGIAEASNMASLNICKRFYNEEMEKICAS--KFLKESKLQKEHERICGAAIDKFNNRKNFGNAEHSVQFRLQLEQEIEECFKIFVEKNSFKN--KLDREAWTLFVL--VMWYIIGQILRYILTWIGFDTASSWIGWALFVIVLTAISWG-VAYCTD-SQIKEYIDEVINASWE 1471
             F+L+E AL +IL +E++RD+ VV IS+AG  R+GKSF+++F L+Y+ ++    WL D + PLTGFSW+ G + +TTGI IWSE +L++  DG + AVLLMDTQGTFD +ST+R +A +FALSTMISSMQ++N++  ++ED+L+ L +F  YGRLAME    +KPFQ L FL+RDW+ PY  PYG EGG K+L++ L   EN + ++  VRK +H CF+ I C LMP PG KV ++  F+G+L +I + F+ NL++ VP +L    +  K ING  ITC+ L+EYFKAY +I+  +++  P+ +    AEA+N+A++   K  YN +ME +      FL  S+LQ  H  I   A+  F + K  G  E S ++ LQLE EI+E F  +++ N  KN     R   TLFV+  VM+   G     I  ++G D  +S     L   ++T  +W  + Y  +  ++   ID+V  A W+
Sbjct:   46 TFELDEAALSKILLSEEVRDREVVAISVAGAFRKGKSFLMDFMLRYMYSQASEKWLGDAEEPLTGFSWRGGSERETTGIQIWSEVFLVDKPDGSKVAVLLMDTQGTFDSQSTLRDSATVFALSTMISSMQVYNISQNVQEDDLQHLQLFTEYGRLAMEET-FLKPFQSLIFLVRDWSFPYEFPYGQEGGMKFLEKRLKISENQHEELQNVRKHIHSCFTNISCFLMPHPGLKVATNPHFDGRLREIDQEFINNLQVLVPCLLRPKNLDVKEINGSKITCRGLVEYFKAYIKIYQGEELPHPKSMLQATAEANNLAAVAGAKDLYNRKMEVVSGGDRPFLAPSELQARHLEIREEALALFRSVKKMGGEEFSRRYLLQLETEIDELFVQYIKHNDSKNIFHAARTPATLFVVIFVMYVAAG-----ITGFVGVDVIASVCNMVLGFALITLCTWAYIRYSGEYRELGAVIDQVAGALWD 517          
BLAST of Atlastin-1-like vs. Ensembl Zebrafish
Match: atl2 (atlastin GTPase 2 [Source:ZFIN;Acc:ZDB-GENE-030131-6505])

HSP 1 Score: 369.007 bits (946), Expect = 8.180e-118
Identity = 194/516 (37.60%), Postives = 306/516 (59.30%), Query Frame = 2
Query:   20 GKRISYSIID*NKDNFKLNEDALKEILENEKIRDKSVVVISIAGDMRRGKSFMLNFFLKYLEAEDKNNWLSDPDTPLTGFSWKNGRDCDTTGILIWSEPYLMELEDGEECAVLLMDTQGTFDKKSTMRKNAMIFALSTMISSMQIFNVNSQLREDNLEFLSVFINYGRLAMERNETIKPFQHLQFLIRDWNSPYLNPYGLEGGKKYLDEFLMYDENDNPQIIGVRKFLHRCFSRIDCCLMPFPGSKVMSSEVFNGKLSDIKKGFVENLRLYVPKMLSADYVVPKAINGCNITCQELLEYFKAYFRIFSSDDIVAPQGIFDGIAEASNMASLNICKRFYNEEMEKICAS--KFLKESKLQKEHERICGAAIDKFNNRKNFGNAEHSVQFRLQLEQEIEECFKIFVEKNSFKNKL--DREAWTLF-VLVMWYIIGQILRYILTWIGFDTASSWIGWALFVIVLTAISWG-VAYCTD-SQIKEYIDEVINASWESCLRPAYRYVAQRLVSQLAQNSLRA 1546
             + I   I + N   F+L+  AL++IL  E ++D +VVV+S+AG  R+GKSF+L+F L+Y+  +   +W+   D PLTGFSW+ G + +TTGI  WSE +++E +DG + AVLL+DTQG FD +ST++  A +FALSTM SS+Q++N++  ++ED+L+ L +F  YGRLAME     KPFQ L FLIRDW  PY + YGL+GG  +L+  L   +N + ++  VRK +H CFS I C L+P PG KV ++  F+G+L +I   F   L+  VP +L+ + +V K I G  +TC++L+EYFKAY +I+  +++  P+ +    AEA+N+ ++   K  YN  ME++C     ++    LQ+ H+     ++D+F   K  G  E   +++ QLE E++E +  FV+ N  KN     R   TLF V+ + Y++  +  +    IG    ++     + V +L+  +W  V Y  +  ++   ID +  A W   L+P      +  V Q   NS+RA
Sbjct:   99 ARPIQIVITNENDHKFELDAAALEKILLQEHVKDLNVVVVSVAGAFRKGKSFLLDFMLRYMHDQSAESWIGGDDEPLTGFSWRGGCERETTGIQAWSEVFVVEKKDGTKVAVLLVDTQGAFDSQSTIKDCATVFALSTMTSSVQVYNLSQNIQEDDLQHLQLFTEYGRLAMEEIYE-KPFQKLLFLIRDWCYPYEHDYGLKGGNSFLERRLQVKQNQHEELQNVRKHIHSCFSSIGCFLLPHPGLKVATNPHFDGRLREIDDEFKRELQNLVPLLLAPENLVEKEIGGAKVTCRDLVEYFKAYIKIYQGEELPHPKSMLQATAEANNLTAVAGAKDTYNRTMEQVCGGNKPYIAPVDLQRYHDEFKKTSVDQFRGVKKMGGVEFCHRYQEQLETELDEVYTNFVKHNESKNIFYAARTPATLFAVMFVTYMVSTVTGF----IGLSFIAALASVVMGVTLLSLCAWSYVRYSGEYREVGVTIDLIAEALWVQVLKPLTEQYMEENVRQTVVNSIRA 609          
BLAST of Atlastin-1-like vs. Ensembl Zebrafish
Match: atl2 (atlastin GTPase 2 [Source:ZFIN;Acc:ZDB-GENE-030131-6505])

HSP 1 Score: 369.007 bits (946), Expect = 8.180e-118
Identity = 194/516 (37.60%), Postives = 306/516 (59.30%), Query Frame = 2
Query:   20 GKRISYSIID*NKDNFKLNEDALKEILENEKIRDKSVVVISIAGDMRRGKSFMLNFFLKYLEAEDKNNWLSDPDTPLTGFSWKNGRDCDTTGILIWSEPYLMELEDGEECAVLLMDTQGTFDKKSTMRKNAMIFALSTMISSMQIFNVNSQLREDNLEFLSVFINYGRLAMERNETIKPFQHLQFLIRDWNSPYLNPYGLEGGKKYLDEFLMYDENDNPQIIGVRKFLHRCFSRIDCCLMPFPGSKVMSSEVFNGKLSDIKKGFVENLRLYVPKMLSADYVVPKAINGCNITCQELLEYFKAYFRIFSSDDIVAPQGIFDGIAEASNMASLNICKRFYNEEMEKICAS--KFLKESKLQKEHERICGAAIDKFNNRKNFGNAEHSVQFRLQLEQEIEECFKIFVEKNSFKNKL--DREAWTLF-VLVMWYIIGQILRYILTWIGFDTASSWIGWALFVIVLTAISWG-VAYCTD-SQIKEYIDEVINASWESCLRPAYRYVAQRLVSQLAQNSLRA 1546
             + I   I + N   F+L+  AL++IL  E ++D +VVV+S+AG  R+GKSF+L+F L+Y+  +   +W+   D PLTGFSW+ G + +TTGI  WSE +++E +DG + AVLL+DTQG FD +ST++  A +FALSTM SS+Q++N++  ++ED+L+ L +F  YGRLAME     KPFQ L FLIRDW  PY + YGL+GG  +L+  L   +N + ++  VRK +H CFS I C L+P PG KV ++  F+G+L +I   F   L+  VP +L+ + +V K I G  +TC++L+EYFKAY +I+  +++  P+ +    AEA+N+ ++   K  YN  ME++C     ++    LQ+ H+     ++D+F   K  G  E   +++ QLE E++E +  FV+ N  KN     R   TLF V+ + Y++  +  +    IG    ++     + V +L+  +W  V Y  +  ++   ID +  A W   L+P      +  V Q   NS+RA
Sbjct:   99 ARPIQIVITNENDHKFELDAAALEKILLQEHVKDLNVVVVSVAGAFRKGKSFLLDFMLRYMHDQSAESWIGGDDEPLTGFSWRGGCERETTGIQAWSEVFVVEKKDGTKVAVLLVDTQGAFDSQSTIKDCATVFALSTMTSSVQVYNLSQNIQEDDLQHLQLFTEYGRLAMEEIYE-KPFQKLLFLIRDWCYPYEHDYGLKGGNSFLERRLQVKQNQHEELQNVRKHIHSCFSSIGCFLLPHPGLKVATNPHFDGRLREIDDEFKRELQNLVPLLLAPENLVEKEIGGAKVTCRDLVEYFKAYIKIYQGEELPHPKSMLQATAEANNLTAVAGAKDTYNRTMEQVCGGNKPYIAPVDLQRYHDEFKKTSVDQFRGVKKMGGVEFCHRYQEQLETELDEVYTNFVKHNESKNIFYAARTPATLFAVMFVTYMVSTVTGF----IGLSFIAALASVVMGVTLLSLCAWSYVRYSGEYREVGVTIDLIAEALWVQVLKPLTEQYMEENVRQTVVNSIRA 609          
BLAST of Atlastin-1-like vs. Ensembl Zebrafish
Match: atl2 (atlastin GTPase 2 [Source:ZFIN;Acc:ZDB-GENE-030131-6505])

HSP 1 Score: 369.007 bits (946), Expect = 8.180e-118
Identity = 194/516 (37.60%), Postives = 306/516 (59.30%), Query Frame = 2
Query:   20 GKRISYSIID*NKDNFKLNEDALKEILENEKIRDKSVVVISIAGDMRRGKSFMLNFFLKYLEAEDKNNWLSDPDTPLTGFSWKNGRDCDTTGILIWSEPYLMELEDGEECAVLLMDTQGTFDKKSTMRKNAMIFALSTMISSMQIFNVNSQLREDNLEFLSVFINYGRLAMERNETIKPFQHLQFLIRDWNSPYLNPYGLEGGKKYLDEFLMYDENDNPQIIGVRKFLHRCFSRIDCCLMPFPGSKVMSSEVFNGKLSDIKKGFVENLRLYVPKMLSADYVVPKAINGCNITCQELLEYFKAYFRIFSSDDIVAPQGIFDGIAEASNMASLNICKRFYNEEMEKICAS--KFLKESKLQKEHERICGAAIDKFNNRKNFGNAEHSVQFRLQLEQEIEECFKIFVEKNSFKNKL--DREAWTLF-VLVMWYIIGQILRYILTWIGFDTASSWIGWALFVIVLTAISWG-VAYCTD-SQIKEYIDEVINASWESCLRPAYRYVAQRLVSQLAQNSLRA 1546
             + I   I + N   F+L+  AL++IL  E ++D +VVV+S+AG  R+GKSF+L+F L+Y+  +   +W+   D PLTGFSW+ G + +TTGI  WSE +++E +DG + AVLL+DTQG FD +ST++  A +FALSTM SS+Q++N++  ++ED+L+ L +F  YGRLAME     KPFQ L FLIRDW  PY + YGL+GG  +L+  L   +N + ++  VRK +H CFS I C L+P PG KV ++  F+G+L +I   F   L+  VP +L+ + +V K I G  +TC++L+EYFKAY +I+  +++  P+ +    AEA+N+ ++   K  YN  ME++C     ++    LQ+ H+     ++D+F   K  G  E   +++ QLE E++E +  FV+ N  KN     R   TLF V+ + Y++  +  +    IG    ++     + V +L+  +W  V Y  +  ++   ID +  A W   L+P      +  V Q   NS+RA
Sbjct:   99 ARPIQIVITNENDHKFELDAAALEKILLQEHVKDLNVVVVSVAGAFRKGKSFLLDFMLRYMHDQSAESWIGGDDEPLTGFSWRGGCERETTGIQAWSEVFVVEKKDGTKVAVLLVDTQGAFDSQSTIKDCATVFALSTMTSSVQVYNLSQNIQEDDLQHLQLFTEYGRLAMEEIYE-KPFQKLLFLIRDWCYPYEHDYGLKGGNSFLERRLQVKQNQHEELQNVRKHIHSCFSSIGCFLLPHPGLKVATNPHFDGRLREIDDEFKRELQNLVPLLLAPENLVEKEIGGAKVTCRDLVEYFKAYIKIYQGEELPHPKSMLQATAEANNLTAVAGAKDTYNRTMEQVCGGNKPYIAPVDLQRYHDEFKKTSVDQFRGVKKMGGVEFCHRYQEQLETELDEVYTNFVKHNESKNIFYAARTPATLFAVMFVTYMVSTVTGF----IGLSFIAALASVVMGVTLLSLCAWSYVRYSGEYREVGVTIDLIAEALWVQVLKPLTEQYMEENVRQTVVNSIRA 609          
BLAST of Atlastin-1-like vs. Ensembl Xenopus
Match: atl1 (atlastin GTPase 1 [Source:NCBI gene;Acc:779669])

HSP 1 Score: 395.201 bits (1014), Expect = 1.014e-128
Identity = 201/487 (41.27%), Postives = 309/487 (63.45%), Query Frame = 2
Query:   62 NFKLNEDALKEILENEKIRDKSVVVISIAGDMRRGKSFMLNFFLKYLEAEDKNNWLSDPDTPLTGFSWKNGRDCDTTGILIWSEPYLMELEDGEECAVLLMDTQGTFDKKSTMRKNAMIFALSTMISSMQIFNVNSQLREDNLEFLSVFINYGRLAMERNETIKPFQHLQFLIRDWNSPYLNPYGLEGGKKYLDEFLMYDENDNPQIIGVRKFLHRCFSRIDCCLMPFPGSKVMSSEVFNGKLSDIKKGFVENLRLYVPKMLSADYVVPKAINGCNITCQELLEYFKAYFRIFSSDDIVAPQGIFDGIAEASNMASLNICKRFYNEEMEKICAS--KFLKESKLQKEHERICGAAIDKFNNRKNFGNAEHSVQFRLQLEQEIEECFKIFVEKNSFKN--KLDREAWTLFVLVMWYIIGQILRYILTWIGFDTASSWIGWALFVIVLTAISWG-VAYCTD-SQIKEYIDEVINASWESCLRPAYRYVA 1504
            +F+L+E AL  IL +E +RDK VV +S+AG  R+GKSF+++F L+Y+   D  +WL D + PL+GFSW+ G + +TTGI IWSE +L+E  DG + AVLLMDTQGTFD +ST+R +A +FALSTMISS+Q++N++  ++ED+L+ L +F  YGRLAME    +KPFQ L FL+RDW+ PY  PYG +GG K+L++ L   EN + ++  VRK +H CF+ I C LMP PG  V ++  F+GKL +I + F++NL++++P +LS + +  K I+G  ITC+ L+EYFKAY +I+  +++  P+ +    AEA+N+A++   K  YN+ ME++C     FL  + LQ+ H+ +   A+  F   K  G  E S ++  QLE EI+E +  +++ N  KN     R   TLFV++    I  +L  +  +IG D  +S     + + ++T  +W  + Y  +  ++   ID+V  A W+  L   Y   A
Sbjct:   44 SFELDEAALNCILLSEAVRDKEVVAVSVAGAFRKGKSFLMDFMLRYMYKTDTVDWLGDYNEPLSGFSWRGGSERETTGIQIWSEIFLVENPDGNKVAVLLMDTQGTFDSQSTLRDSATVFALSTMISSIQVYNLSQNVQEDDLQHLQLFTEYGRLAMEET-FLKPFQSLIFLVRDWSFPYEFPYGSDGGNKFLEKRLKVSENQHEELQNVRKHIHSCFTNISCFLMPHPGLTVATNPNFDGKLKEIDEEFIKNLKVFIPWLLSPENLDVKEISGNRITCRGLVEYFKAYIKIYQGEELPHPKSMLQATAEANNLAAVATAKDLYNKNMEEVCGGDRPFLAPTDLQQRHQHLKEEAVKLFRGVKKMGGEEFSRRYLQQLENEIDELYVQYIKHNDSKNIFHAARTPATLFVVIF---ITYVLAAVTGFIGLDIIASLCNMIMGLTLITLCTWAYIRYSGEYRELGAVIDQVAAALWDQALYKLYSAAA 526          
BLAST of Atlastin-1-like vs. Ensembl Xenopus
Match: atl1 (atlastin GTPase 1 [Source:NCBI gene;Acc:779669])

HSP 1 Score: 390.963 bits (1003), Expect = 2.842e-127
Identity = 198/476 (41.60%), Postives = 306/476 (64.29%), Query Frame = 2
Query:   62 NFKLNEDALKEILENEKIRDKSVVVISIAGDMRRGKSFMLNFFLKYLEAEDKNNWLSDPDTPLTGFSWKNGRDCDTTGILIWSEPYLMELEDGEECAVLLMDTQGTFDKKSTMRKNAMIFALSTMISSMQIFNVNSQLREDNLEFLSVFINYGRLAMERNETIKPFQHLQFLIRDWNSPYLNPYGLEGGKKYLDEFLMYDENDNPQIIGVRKFLHRCFSRIDCCLMPFPGSKVMSSEVFNGKLSDIKKGFVENLRLYVPKMLSADYVVPKAINGCNITCQELLEYFKAYFRIFSSDDIVAPQGIFDGIAEASNMASLNICKRFYNEEMEKICAS--KFLKESKLQKEHERICGAAIDKFNNRKNFGNAEHSVQFRLQLEQEIEECFKIFVEKNSFKN--KLDREAWTLFVLVMWYIIGQILRYILTWIGFDTASSWIGWALFVIVLTAISWG-VAYCTD-SQIKEYIDEVINASWE 1471
            +F+L+E AL  IL +E +RDK VV +S+AG  R+GKSF+++F L+Y+   D  +WL D + PL+GFSW+ G + +TTGI IWSE +L+E  DG + AVLLMDTQGTFD +ST+R +A +FALSTMISS+Q++N++  ++ED+L+ L +F  YGRLAME    +KPFQ L FL+RDW+ PY  PYG +GG K+L++ L   EN + ++  VRK +H CF+ I C LMP PG  V ++  F+GKL +I + F++NL++++P +LS + +  K I+G  ITC+ L+EYFKAY +I+  +++  P+ +    AEA+N+A++   K  YN+ ME++C     FL  + LQ+ H+ +   A+  F   K  G  E S ++  QLE EI+E +  +++ N  KN     R   TLFV++    I  +L  +  +IG D  +S     + + ++T  +W  + Y  +  ++   ID+V  A W+
Sbjct:   47 SFELDEAALNCILLSEAVRDKEVVAVSVAGAFRKGKSFLMDFMLRYMYKTDTVDWLGDYNEPLSGFSWRGGSERETTGIQIWSEIFLVENPDGNKVAVLLMDTQGTFDSQSTLRDSATVFALSTMISSIQVYNLSQNVQEDDLQHLQLFTEYGRLAMEET-FLKPFQSLIFLVRDWSFPYEFPYGSDGGNKFLEKRLKVSENQHEELQNVRKHIHSCFTNISCFLMPHPGLTVATNPNFDGKLKEIDEEFIKNLKVFIPWLLSPENLDVKEISGNRITCRGLVEYFKAYIKIYQGEELPHPKSMLQATAEANNLAAVATAKDLYNKNMEEVCGGDRPFLAPTDLQQRHQHLKEEAVKLFRGVKKMGGEEFSRRYLQQLENEIDELYVQYIKHNDSKNIFHAARTPATLFVVIF---ITYVLAAVTGFIGLDIIASLCNMIMGLTLITLCTWAYIRYSGEYRELGAVIDQVAAALWD 518          
BLAST of Atlastin-1-like vs. Ensembl Xenopus
Match: atl1 (atlastin GTPase 1 [Source:NCBI gene;Acc:779669])

HSP 1 Score: 391.349 bits (1004), Expect = 2.979e-127
Identity = 198/478 (41.42%), Postives = 306/478 (64.02%), Query Frame = 2
Query:   62 NFKLNEDALKEILENEKIRDKSVVVISIAGDMRRGKSFMLNFFLKYLEAEDKNNWLSDPDTPLTGFSWKNGRDCDTTGILIWSEPYLMELEDGEECAVLLMDTQGTFDKKSTMRKNAMIFALSTMISSMQIFNVNSQLREDNLEFLSVFINYGRLAMERNETIKPFQHLQFLIRDWNSPYLNPYGLEGGKKYLDEFLMYDENDNPQIIGVRKFLHRCFSRIDCCLMPFPGSKVMSSEVFNGKLSDIKKGFVENLRLYVPKMLSADYVVPKAINGCNITCQELLEYFKAYFRIFSSDDIVAPQGIFDGIAEASNMASLNICKRFYNEEMEKICAS--KFLKESKLQKEHERICGAAIDKFNNRKNFGNAEHSVQFRLQLEQEIEECFKIFVEKNSFKN--KLDREAWTLFVLVMWYIIGQILRYILTWIGFDTASSWIGWALFVIVLTAISWG-VAYCTD-SQIKEYIDEVINASWESC 1477
            +F+L+E AL  IL +E +RDK VV +S+AG  R+GKSF+++F L+Y+   D  +WL D + PL+GFSW+ G + +TTGI IWSE +L+E  DG + AVLLMDTQGTFD +ST+R +A +FALSTMISS+Q++N++  ++ED+L+ L +F  YGRLAME    +KPFQ L FL+RDW+ PY  PYG +GG K+L++ L   EN + ++  VRK +H CF+ I C LMP PG  V ++  F+GKL +I + F++NL++++P +LS + +  K I+G  ITC+ L+EYFKAY +I+  +++  P+ +    AEA+N+A++   K  YN+ ME++C     FL  + LQ+ H+ +   A+  F   K  G  E S ++  QLE EI+E +  +++ N  KN     R   TLFV++    I  +L  +  +IG D  +S     + + ++T  +W  + Y  +  ++   ID+V  A W+  
Sbjct:   43 SFELDEAALNCILLSEAVRDKEVVAVSVAGAFRKGKSFLMDFMLRYMYKTDTVDWLGDYNEPLSGFSWRGGSERETTGIQIWSEIFLVENPDGNKVAVLLMDTQGTFDSQSTLRDSATVFALSTMISSIQVYNLSQNVQEDDLQHLQLFTEYGRLAMEET-FLKPFQSLIFLVRDWSFPYEFPYGSDGGNKFLEKRLKVSENQHEELQNVRKHIHSCFTNISCFLMPHPGLTVATNPNFDGKLKEIDEEFIKNLKVFIPWLLSPENLDVKEISGNRITCRGLVEYFKAYIKIYQGEELPHPKSMLQATAEANNLAAVATAKDLYNKNMEEVCGGDRPFLAPTDLQQRHQHLKEEAVKLFRGVKKMGGEEFSRRYLQQLENEIDELYVQYIKHNDSKNIFHAARTPATLFVVIF---ITYVLAAVTGFIGLDIIASLCNMIMGLTLITLCTWAYIRYSGEYRELGAVIDQVAAALWDQV 516          
BLAST of Atlastin-1-like vs. Ensembl Xenopus
Match: atl1 (atlastin GTPase 1 [Source:NCBI gene;Acc:779669])

HSP 1 Score: 390.963 bits (1003), Expect = 3.111e-127
Identity = 198/476 (41.60%), Postives = 306/476 (64.29%), Query Frame = 2
Query:   62 NFKLNEDALKEILENEKIRDKSVVVISIAGDMRRGKSFMLNFFLKYLEAEDKNNWLSDPDTPLTGFSWKNGRDCDTTGILIWSEPYLMELEDGEECAVLLMDTQGTFDKKSTMRKNAMIFALSTMISSMQIFNVNSQLREDNLEFLSVFINYGRLAMERNETIKPFQHLQFLIRDWNSPYLNPYGLEGGKKYLDEFLMYDENDNPQIIGVRKFLHRCFSRIDCCLMPFPGSKVMSSEVFNGKLSDIKKGFVENLRLYVPKMLSADYVVPKAINGCNITCQELLEYFKAYFRIFSSDDIVAPQGIFDGIAEASNMASLNICKRFYNEEMEKICAS--KFLKESKLQKEHERICGAAIDKFNNRKNFGNAEHSVQFRLQLEQEIEECFKIFVEKNSFKN--KLDREAWTLFVLVMWYIIGQILRYILTWIGFDTASSWIGWALFVIVLTAISWG-VAYCTD-SQIKEYIDEVINASWE 1471
            +F+L+E AL  IL +E +RDK VV +S+AG  R+GKSF+++F L+Y+   D  +WL D + PL+GFSW+ G + +TTGI IWSE +L+E  DG + AVLLMDTQGTFD +ST+R +A +FALSTMISS+Q++N++  ++ED+L+ L +F  YGRLAME    +KPFQ L FL+RDW+ PY  PYG +GG K+L++ L   EN + ++  VRK +H CF+ I C LMP PG  V ++  F+GKL +I + F++NL++++P +LS + +  K I+G  ITC+ L+EYFKAY +I+  +++  P+ +    AEA+N+A++   K  YN+ ME++C     FL  + LQ+ H+ +   A+  F   K  G  E S ++  QLE EI+E +  +++ N  KN     R   TLFV++    I  +L  +  +IG D  +S     + + ++T  +W  + Y  +  ++   ID+V  A W+
Sbjct:   43 SFELDEAALNCILLSEAVRDKEVVAVSVAGAFRKGKSFLMDFMLRYMYKTDTVDWLGDYNEPLSGFSWRGGSERETTGIQIWSEIFLVENPDGNKVAVLLMDTQGTFDSQSTLRDSATVFALSTMISSIQVYNLSQNVQEDDLQHLQLFTEYGRLAMEET-FLKPFQSLIFLVRDWSFPYEFPYGSDGGNKFLEKRLKVSENQHEELQNVRKHIHSCFTNISCFLMPHPGLTVATNPNFDGKLKEIDEEFIKNLKVFIPWLLSPENLDVKEISGNRITCRGLVEYFKAYIKIYQGEELPHPKSMLQATAEANNLAAVATAKDLYNKNMEEVCGGDRPFLAPTDLQQRHQHLKEEAVKLFRGVKKMGGEEFSRRYLQQLENEIDELYVQYIKHNDSKNIFHAARTPATLFVVIF---ITYVLAAVTGFIGLDIIASLCNMIMGLTLITLCTWAYIRYSGEYRELGAVIDQVAAALWD 514          
BLAST of Atlastin-1-like vs. Ensembl Xenopus
Match: atl1 (atlastin GTPase 1 [Source:NCBI gene;Acc:779669])

HSP 1 Score: 390.578 bits (1002), Expect = 3.610e-127
Identity = 198/478 (41.42%), Postives = 306/478 (64.02%), Query Frame = 2
Query:   62 NFKLNEDALKEILENEKIRDKSVVVISIAGDMRRGKSFMLNFFLKYLEAEDKNNWLSDPDTPLTGFSWKNGRDCDTTGILIWSEPYLMELEDGEECAVLLMDTQGTFDKKSTMRKNAMIFALSTMISSMQIFNVNSQLREDNLEFLSVFINYGRLAMERNETIKPFQHLQFLIRDWNSPYLNPYGLEGGKKYLDEFLMYDENDNPQIIGVRKFLHRCFSRIDCCLMPFPGSKVMSSEVFNGKLSDIKKGFVENLRLYVPKMLSADYVVPKAINGCNITCQELLEYFKAYFRIFSSDDIVAPQGIFDGIAEASNMASLNICKRFYNEEMEKICAS--KFLKESKLQKEHERICGAAIDKFNNRKNFGNAEHSVQFRLQLEQEIEECFKIFVEKNSFKN--KLDREAWTLFVLVMWYIIGQILRYILTWIGFDTASSWIGWALFVIVLTAISWG-VAYCTD-SQIKEYIDEVINASWESC 1477
            +F+L+E AL  IL +E +RDK VV +S+AG  R+GKSF+++F L+Y+   D  +WL D + PL+GFSW+ G + +TTGI IWSE +L+E  DG + AVLLMDTQGTFD +ST+R +A +FALSTMISS+Q++N++  ++ED+L+ L +F  YGRLAME    +KPFQ L FL+RDW+ PY  PYG +GG K+L++ L   EN + ++  VRK +H CF+ I C LMP PG  V ++  F+GKL +I + F++NL++++P +LS + +  K I+G  ITC+ L+EYFKAY +I+  +++  P+ +    AEA+N+A++   K  YN+ ME++C     FL  + LQ+ H+ +   A+  F   K  G  E S ++  QLE EI+E +  +++ N  KN     R   TLFV++    I  +L  +  +IG D  +S     + + ++T  +W  + Y  +  ++   ID+V  A W+  
Sbjct:   45 SFELDEAALNCILLSEAVRDKEVVAVSVAGAFRKGKSFLMDFMLRYMYKTDTVDWLGDYNEPLSGFSWRGGSERETTGIQIWSEIFLVENPDGNKVAVLLMDTQGTFDSQSTLRDSATVFALSTMISSIQVYNLSQNVQEDDLQHLQLFTEYGRLAMEET-FLKPFQSLIFLVRDWSFPYEFPYGSDGGNKFLEKRLKVSENQHEELQNVRKHIHSCFTNISCFLMPHPGLTVATNPNFDGKLKEIDEEFIKNLKVFIPWLLSPENLDVKEISGNRITCRGLVEYFKAYIKIYQGEELPHPKSMLQATAEANNLAAVATAKDLYNKNMEEVCGGDRPFLAPTDLQQRHQHLKEEAVKLFRGVKKMGGEEFSRRYLQQLENEIDELYVQYIKHNDSKNIFHAARTPATLFVVIF---ITYVLAAVTGFIGLDIIASLCNMIMGLTLITLCTWAYIRYSGEYRELGAVIDQVAAALWDQV 518          
BLAST of Atlastin-1-like vs. Ensembl Mouse
Match: Atl1 (atlastin GTPase 1 [Source:MGI Symbol;Acc:MGI:1921241])

HSP 1 Score: 379.793 bits (974), Expect = 7.619e-123
Identity = 193/476 (40.55%), Postives = 305/476 (64.08%), Query Frame = 2
Query:   62 NFKLNEDALKEILENEKIRDKSVVVISIAGDMRRGKSFMLNFFLKYLEAEDKNNWLSDPDTPLTGFSWKNGRDCDTTGILIWSEPYLMELEDGEECAVLLMDTQGTFDKKSTMRKNAMIFALSTMISSMQIFNVNSQLREDNLEFLSVFINYGRLAMERNETIKPFQHLQFLIRDWNSPYLNPYGLEGGKKYLDEFLMYDENDNPQIIGVRKFLHRCFSRIDCCLMPFPGSKVMSSEVFNGKLSDIKKGFVENLRLYVPKMLSADYVVPKAINGCNITCQELLEYFKAYFRIFSSDDIVAPQGIFDGIAEASNMASLNICKRFYNEEMEKICAS--KFLKESKLQKEHERICGAAIDKFNNRKNFGNAEHSVQFRLQLEQEIEECFKIFVEKNSFKN--KLDREAWTLFVLVMWYIIGQILRYILTWIGFDTASSWIGWALFVIVLTAISWG-VAYCTD-SQIKEYIDEVINASWE 1471
            +F+L+E AL  IL ++ +RDK VV +S+AG  R+GKSF+++F L+Y+  ++  +W+ D + PLTGFSW+ G + +TTGI IWSE +L+   DG++ AVLLMDTQGTFD +ST+R +A +FALSTMISS+Q++N++  ++ED+L+ L +F  YGRLAME    +KPFQ L FL+RDW+ PY   YG +GG K+L++ L    N + ++  VRK +H CF+ I C L+P PG KV ++  F+GKL +I   F++NL++ +P +LS + +  K ING  ITC+ LLEYFKAY +I+  +++  P+ +    AEA+N+A++   K  YN++ME++C     FL  + LQ +H ++   ++  F   K  G  E S ++  QLE EI+E +  +++ N  KN     R   TLFV++    I  ++  +  +IG D  +S     + + ++T  +W  + Y  +  ++   ID+V  A W+
Sbjct:   45 SFELDEAALNRILLSQAVRDKEVVAVSVAGAFRKGKSFLMDFMLRYMYNQESVDWVGDYNEPLTGFSWRGGSERETTGIQIWSEVFLINKLDGKKVAVLLMDTQGTFDSQSTLRDSATVFALSTMISSIQVYNLSQNVQEDDLQHLQLFTEYGRLAMEET-FLKPFQSLIFLVRDWSFPYEFSYGADGGAKFLEKRLKVSGNQHEELQNVRKHIHSCFTNISCFLLPHPGLKVATNPNFDGKLKEIDDEFIKNLKILIPWLLSPERLDIKEINGNKITCRGLLEYFKAYIKIYQGEELPHPKSMLQATAEANNLAAVATAKDTYNKKMEEVCGGDKPFLAPNDLQSKHLQLKEESVKLFRGVKKMGGEEFSRRYLQQLESEIDELYIQYIKHNDSKNIFHAARTPATLFVVIF---ITYVIAGVTGFIGLDIIASLCNMIMGLTLITLCTWAYIRYSGEYRELGAVIDQVAAALWD 516          
BLAST of Atlastin-1-like vs. Ensembl Mouse
Match: Atl2 (atlastin GTPase 2 [Source:MGI Symbol;Acc:MGI:1929492])

HSP 1 Score: 378.252 bits (970), Expect = 6.519e-122
Identity = 193/502 (38.45%), Postives = 315/502 (62.75%), Query Frame = 2
Query:   62 NFKLNEDALKEILENEKIRDKSVVVISIAGDMRRGKSFMLNFFLKYLEAEDKNNWLSDPDTPLTGFSWKNGRDCDTTGILIWSEPYLMELEDGEECAVLLMDTQGTFDKKSTMRKNAMIFALSTMISSMQIFNVNSQLREDNLEFLSVFINYGRLAMERNETIKPFQHLQFLIRDWNSPYLNPYGLEGGKKYLDEFLMYDENDNPQIIGVRKFLHRCFSRIDCCLMPFPGSKVMSSEVFNGKLSDIKKGFVENLRLYVPKMLSADYVVPKAINGCNITCQELLEYFKAYFRIFSSDDIVAPQGIFDGIAEASNMASLNICKRFYNEEMEKICAS--KFLKESKLQKEHERICGAAIDKFNNRKNFGNAEHSVQFRLQLEQEIEECFKIFVEKNSFKNKL--DREAWTLF-VLVMWYIIGQILRYILTWIGFDTASSWIGWALFVIVLTAISWG-VAYCTD-SQIKEYIDEVINASWESCLRPAYRYVAQRLVSQLAQNSLRA 1546
            NF+L+E+AL++IL  E IRD ++VV+S+AG  R+GKSF+L+F L+Y+  +D  +W+   + PLTGF+W+ G + +TTGI +W+E ++++  +G + AVLLMDTQG FD +ST++  A +FALSTM SS+Q++N++  ++ED+L+ L +F  YGRLAME     KPFQ L FLIRDW+ PY + YGLEGGK++L++ L   +N + ++  VRK +H CFS + C L+P PG KV ++  F+G+L DI + F   LR  VP +L+ + +V K I+G  +TC++L+EYFKAY +I+  +++  P+ +    AEA+N+A++   +  Y + ME++C     ++  S L+++H  +   A+ +F + K  G  E   +++ QLE EIEE +  F++ N  KN     R   TLF V+   YII  +  +    IG ++ +      + + + +  +W  V Y  +  +I   ID++    WE  L+P    + +  + Q   NS++A
Sbjct:   72 NFELDEEALEQILLQEHIRDLNIVVVSVAGAFRKGKSFLLDFMLRYMYNKDSQSWIGGNNEPLTGFTWRGGCERETTGIQVWNEVFVIDRPNGTKVAVLLMDTQGAFDSQSTIKDCATVFALSTMTSSVQVYNLSQNIQEDDLQHLQLFTEYGRLAMEEIYQ-KPFQTLMFLIRDWSYPYEHSYGLEGGKQFLEKRLQVKQNQHEELQNVRKHIHNCFSNLGCFLLPHPGLKVATNPSFDGRLKDIDEDFKRELRNLVPLLLAPENLVEKEISGSKVTCRDLVEYFKAYIKIYQGEELPHPKSMLQATAEANNLAAVAGARDVYCKSMEQVCGGDKPYIAPSDLERKHLDLKEVALKQFRSVKKMGGDEFCRRYQDQLEAEIEETYANFIKHNDGKNIFYAARTPATLFAVMFAMYIISGLTGF----IGLNSIAVLCNLVMGLALTSLCTWAYVKYSGEFREIGTMIDQIAETLWEQVLKPLGDNLMEENIRQSVTNSIKA 568          
BLAST of Atlastin-1-like vs. Ensembl Mouse
Match: Atl3 (atlastin GTPase 3 [Source:MGI Symbol;Acc:MGI:1924270])

HSP 1 Score: 339.732 bits (870), Expect = 1.387e-107
Identity = 184/457 (40.26%), Postives = 280/457 (61.27%), Query Frame = 2
Query:   56 KDNFKLNEDALKEILENEKIRDKSVVVISIAGDMRRGKSFMLNFFLKYLEAEDK---NNWLSDPDTPLTGFSWKNGRDCDTTGILIWSEPYLMELEDGEECAVLLMDTQGTFDKKSTMRKNAMIFALSTMISSMQIFNVNSQLREDNLEFLSVFINYGRLAMERNETIKPFQHLQFLIRDWNSPYLNPYGLEGGKKYLDEFLMYDENDNPQIIGVRKFLHRCFSRIDCCLMPFPGSKVMSSEVFNGKLSDIKKGFVENLRLYVPKMLSADYVVPKAINGCNITCQELLEYFKAYFRIFSSDDIVAPQGIFDGIAEASNMASLNICKRFYNEEMEKICASK--FLKESKLQKEHERICGAAIDKFNNRKNFGNAEHSVQFRLQLEQEIEECFKIFVEKNSFKNKLD--REAWTLFVLVMWYIIGQILRYILTWIGFDTASSWIGWALFVIVLTAISWG 1405
            + +F+L E AL  +L  + IRD  VVV+S+AG  R+GKSF+L+F L+YL ++ +   ++WL DP+ PLTGFSW+ G D +TTGI IWSE + ++   G++ AV+LMDTQG FD +ST++  A IFALSTM SS+QI+N++  ++ED+L+ L +F  YGRLAM+     KPFQ L FLIRDW+ PY   YGL+GG  +LD+ L   E+ + +I  VR  +H CFS + C L+P PG +V +S  F+GKL DI   F E L+  +P +L+   ++ K ING  +TC+ LLEYFKAY +I+  +D+  P+ +    AEA+N+A+    K  Y   ME+IC  +  +L    L+++H      A+D F   K  G  + S +++ +LE+EI+E ++ F + N  KN     R    LF  +    I         +IG +  +      + ++++  ++WG
Sbjct:   36 QHSFELEERALASVLLQDHIRDLDVVVVSVAGAFRKGKSFILDFMLRYLYSQKEGGHSDWLGDPEEPLTGFSWRGGSDPETTGIQIWSEVFTVKKPCGKKVAVVLMDTQGAFDSQSTVKDCATIFALSTMTSSVQIYNLSQNIQEDDLQQLQLFTEYGRLAMDEIFQ-KPFQTLMFLIRDWSFPYEYNYGLQGGMAFLDKRLHVKEHQHEEIQNVRNHIHSCFSDVTCFLLPHPGLQVATSPNFDGKLKDIASEFKEQLQALIPYVLNPSKLMEKEINGSKVTCRGLLEYFKAYIKIYQGEDLPHPKSMLQATAEANNLAAAASAKDIYYNNMEEICGGEKPYLSPDILEEKHLEFKQLALDHFKKIKKMGGKDFSFRYQQELEEEIKELYENFCKHNGSKNVFSTFRTPAVLFTGIAALYIASGFT---GFIGLEVVAQLFNCMVGLLLIALLTWG 488          
BLAST of Atlastin-1-like vs. Ensembl Mouse
Match: Atl3 (atlastin GTPase 3 [Source:MGI Symbol;Acc:MGI:1924270])

HSP 1 Score: 339.347 bits (869), Expect = 1.685e-107
Identity = 184/457 (40.26%), Postives = 280/457 (61.27%), Query Frame = 2
Query:   56 KDNFKLNEDALKEILENEKIRDKSVVVISIAGDMRRGKSFMLNFFLKYLEAEDK---NNWLSDPDTPLTGFSWKNGRDCDTTGILIWSEPYLMELEDGEECAVLLMDTQGTFDKKSTMRKNAMIFALSTMISSMQIFNVNSQLREDNLEFLSVFINYGRLAMERNETIKPFQHLQFLIRDWNSPYLNPYGLEGGKKYLDEFLMYDENDNPQIIGVRKFLHRCFSRIDCCLMPFPGSKVMSSEVFNGKLSDIKKGFVENLRLYVPKMLSADYVVPKAINGCNITCQELLEYFKAYFRIFSSDDIVAPQGIFDGIAEASNMASLNICKRFYNEEMEKICASK--FLKESKLQKEHERICGAAIDKFNNRKNFGNAEHSVQFRLQLEQEIEECFKIFVEKNSFKNKLD--REAWTLFVLVMWYIIGQILRYILTWIGFDTASSWIGWALFVIVLTAISWG 1405
            + +F+L E AL  +L  + IRD  VVV+S+AG  R+GKSF+L+F L+YL ++ +   ++WL DP+ PLTGFSW+ G D +TTGI IWSE + ++   G++ AV+LMDTQG FD +ST++  A IFALSTM SS+QI+N++  ++ED+L+ L +F  YGRLAM+     KPFQ L FLIRDW+ PY   YGL+GG  +LD+ L   E+ + +I  VR  +H CFS + C L+P PG +V +S  F+GKL DI   F E L+  +P +L+   ++ K ING  +TC+ LLEYFKAY +I+  +D+  P+ +    AEA+N+A+    K  Y   ME+IC  +  +L    L+++H      A+D F   K  G  + S +++ +LE+EI+E ++ F + N  KN     R    LF  +    I         +IG +  +      + ++++  ++WG
Sbjct:   31 QHSFELEERALASVLLQDHIRDLDVVVVSVAGAFRKGKSFILDFMLRYLYSQKEGGHSDWLGDPEEPLTGFSWRGGSDPETTGIQIWSEVFTVKKPCGKKVAVVLMDTQGAFDSQSTVKDCATIFALSTMTSSVQIYNLSQNIQEDDLQQLQLFTEYGRLAMDEIFQ-KPFQTLMFLIRDWSFPYEYNYGLQGGMAFLDKRLHVKEHQHEEIQNVRNHIHSCFSDVTCFLLPHPGLQVATSPNFDGKLKDIASEFKEQLQALIPYVLNPSKLMEKEINGSKVTCRGLLEYFKAYIKIYQGEDLPHPKSMLQATAEANNLAAAASAKDIYYNNMEEICGGEKPYLSPDILEEKHLEFKQLALDHFKKIKKMGGKDFSFRYQQELEEEIKELYENFCKHNGSKNVFSTFRTPAVLFTGIAALYIASGFT---GFIGLEVVAQLFNCMVGLLLIALLTWG 483          
BLAST of Atlastin-1-like vs. Ensembl Mouse
Match: Atl2 (atlastin GTPase 2 [Source:MGI Symbol;Acc:MGI:1929492])

HSP 1 Score: 275.789 bits (704), Expect = 7.735e-85
Identity = 147/402 (36.57%), Postives = 239/402 (59.45%), Query Frame = 2
Query:  362 MDTQGTFDKKSTMRKNAMIFALSTMISSMQIFNVNSQLREDNLEFLSVFINYGRLAMERNETIKPFQHLQFLIRDWNSPYLNPYGLEGGKKYLDEFLMYDENDNPQIIGVRKFLHRCFSRIDCCLMPFPGSKVMSSEVFNGKLSDIKKGFVENLRLYVPKMLSADYVVPKAINGCNITCQELLEYFKAYFRIFSSDDIVAPQGIFDGIAEASNMASLNICKRFYNEEMEKICAS--KFLKESKLQKEHERICGAAIDKFNNRKNFGNAEHSVQFRLQLEQEIEECFKIFVEKNSFKNKL--DREAWTLF-VLVMWYIIGQILRYILTWIGFDTASSWIGWALFVIVLTAISWG-VAYCTD-SQIKEYIDEVINASWESCLRPAYRYVAQRLVSQLAQNSLRA 1546
            MDTQG FD +ST++  A +FALSTM SS+Q++N++  ++ED+L+ L +F  YGRLAME     KPFQ L FLIRDW+ PY + YGLEGGK++L++ L   +N + ++  VRK +H CFS + C L+P PG KV ++  F+G+L DI + F   LR  VP +L+ + +V K I+G  +TC++L+EYFKAY +I+  +++  P+ +    AEA+N+A++   +  Y + ME++C     ++  S L+++H  +   A+ +F + K  G  E   +++ QLE EIEE +  F++ N  KN     R   TLF V+   YII  +  +    IG ++ +      + + + +  +W  V Y  +  +I   ID++    WE  L+P    + +  + Q   NS++A
Sbjct:    1 MDTQGAFDSQSTIKDCATVFALSTMTSSVQVYNLSQNIQEDDLQHLQLFTEYGRLAMEEIYQ-KPFQTLMFLIRDWSYPYEHSYGLEGGKQFLEKRLQVKQNQHEELQNVRKHIHNCFSNLGCFLLPHPGLKVATNPSFDGRLKDIDEDFKRELRNLVPLLLAPENLVEKEISGSKVTCRDLVEYFKAYIKIYQGEELPHPKSMLQATAEANNLAAVAGARDVYCKSMEQVCGGDKPYIAPSDLERKHLDLKEVALKQFRSVKKMGGDEFCRRYQDQLEAEIEETYANFIKHNDGKNIFYAARTPATLFAVMFAMYIISGLTGF----IGLNSIAVLCNLVMGLALTSLCTWAYVKYSGEFREIGTMIDQIAETLWEQVLKPLGDNLMEENIRQSVTNSIKA 397          
BLAST of Atlastin-1-like vs. UniProt/SwissProt
Match: sp|Q58D72|ATLA1_BOVIN (Atlastin-1 OS=Bos taurus OX=9913 GN=ATL1 PE=2 SV=2)

HSP 1 Score: 382.104 bits (980), Expect = 6.841e-123
Identity = 194/476 (40.76%), Postives = 305/476 (64.08%), Query Frame = 2
Query:   62 NFKLNEDALKEILENEKIRDKSVVVISIAGDMRRGKSFMLNFFLKYLEAEDKNNWLSDPDTPLTGFSWKNGRDCDTTGILIWSEPYLMELEDGEECAVLLMDTQGTFDKKSTMRKNAMIFALSTMISSMQIFNVNSQLREDNLEFLSVFINYGRLAMERNETIKPFQHLQFLIRDWNSPYLNPYGLEGGKKYLDEFLMYDENDNPQIIGVRKFLHRCFSRIDCCLMPFPGSKVMSSEVFNGKLSDIKKGFVENLRLYVPKMLSADYVVPKAINGCNITCQELLEYFKAYFRIFSSDDIVAPQGIFDGIAEASNMASLNICKRFYNEEMEKICAS--KFLKESKLQKEHERICGAAIDKFNNRKNFGNAEHSVQFRLQLEQEIEECFKIFVEKNSFKN--KLDREAWTLFVLVMWYIIGQILRYILTWIGFDTASSWIGWALFVIVLTAISWG-VAYCTD-SQIKEYIDEVINASWE 1471
            +F+L+E AL  IL +E +RDK VV +S+AG  R+GKSF+++F L+Y+  ++  +W+ D + PLTGFSW+ G + +TTGI IWSE +L+   DG++ AVLLMDTQGTFD +ST+R +A +FALSTMISS+Q++N++  ++ED+L+ L +F  YGRLAME    +KPFQ L FL+RDW+ PY   YG +GG K+L++ L    N + ++  VRK +H CF++I C L+P PG KV ++  F+GKL +I   F++NL++ +P +LS + +  K ING  ITC+ L+EYFKAY +I+  +++  P+ +    AEA+N+A++   K  YN++ME+IC     FL  + LQ +H  +   ++  F   K  G  E S ++  QLE EI+E +  +++ N  KN     R   TLFV++    I  ++  +  +IG D  +S     + + ++T  +W  + Y  +  ++   ID+V  A W+
Sbjct:   45 SFELDETALNRILLSEAVRDKEVVAVSVAGAFRKGKSFLMDFMLRYMYNQESVDWVGDHNEPLTGFSWRGGSERETTGIQIWSEIFLINKPDGKKVAVLLMDTQGTFDSQSTLRDSATVFALSTMISSIQVYNLSQNVQEDDLQHLQLFTEYGRLAMEET-FLKPFQSLIFLVRDWSFPYEFSYGSDGGSKFLEKRLKVSGNQHEELQNVRKHIHSCFTKISCFLLPHPGLKVATNPNFDGKLKEIDDEFIKNLKILIPWLLSPESLDIKEINGNKITCRGLVEYFKAYIKIYQGEELPHPKSMLQATAEANNLAAVATAKDTYNKKMEEICGGDKPFLAPNDLQTKHLELKEESVKLFRGVKKMGGEEFSRRYLQQLETEIDELYIQYIKHNDSKNIFHAARTPATLFVVIF---ITYVIAGVTGFIGLDIIASLCNMIMGLTLITLCTWAYIRYSGEYRELGAVIDQVAAALWD 516          
BLAST of Atlastin-1-like vs. UniProt/SwissProt
Match: sp|Q60HD2|ATLA1_MACFA (Atlastin-1 OS=Macaca fascicularis OX=9541 GN=ATL1 PE=2 SV=1)

HSP 1 Score: 381.333 bits (978), Expect = 1.416e-122
Identity = 194/476 (40.76%), Postives = 305/476 (64.08%), Query Frame = 2
Query:   62 NFKLNEDALKEILENEKIRDKSVVVISIAGDMRRGKSFMLNFFLKYLEAEDKNNWLSDPDTPLTGFSWKNGRDCDTTGILIWSEPYLMELEDGEECAVLLMDTQGTFDKKSTMRKNAMIFALSTMISSMQIFNVNSQLREDNLEFLSVFINYGRLAMERNETIKPFQHLQFLIRDWNSPYLNPYGLEGGKKYLDEFLMYDENDNPQIIGVRKFLHRCFSRIDCCLMPFPGSKVMSSEVFNGKLSDIKKGFVENLRLYVPKMLSADYVVPKAINGCNITCQELLEYFKAYFRIFSSDDIVAPQGIFDGIAEASNMASLNICKRFYNEEMEKICAS--KFLKESKLQKEHERICGAAIDKFNNRKNFGNAEHSVQFRLQLEQEIEECFKIFVEKNSFKN--KLDREAWTLFVLVMWYIIGQILRYILTWIGFDTASSWIGWALFVIVLTAISWG-VAYCTD-SQIKEYIDEVINASWE 1471
            +F+L+E AL  IL +E +RDK VV +S+AG  R+GKSF+++F L+Y+  ++  +W+ D + PLTGFSW+ G + +TTGI IWSE +L+   DG++ AVLLMDTQGTFD +ST+R +A +FALSTMISS+Q++N++  ++ED+L+ L +F  YGRLAME    +KPFQ L FL+RDW+ PY   YG +GG K+L++ L    N + ++  VRK +H CF+ I C L+P PG KV ++  F+GKL +I   F++NL++ +P +LS + +  K ING  ITC+ L+EYFKAY +I+  +++  P+ +    AEA+N+A++   K  YN++ME+IC     FL  + LQ +H ++   ++  F   K  G  E S ++  QLE EI+E +  +++ N  KN     R   TLFV++    I  ++  +  +IG D  +S     + + ++T  +W  + Y  +  ++   ID+V  A W+
Sbjct:   45 SFELDETALNRILLSEAVRDKEVVAVSVAGAFRKGKSFLMDFMLRYMYNQESVDWVGDYNEPLTGFSWRGGSERETTGIQIWSEVFLINKPDGKKVAVLLMDTQGTFDSQSTLRDSATVFALSTMISSIQVYNLSQNVQEDDLQHLQLFTEYGRLAMEET-FLKPFQSLIFLVRDWSFPYEFSYGADGGAKFLEKRLKVSGNQHEELQNVRKHIHSCFTNISCFLLPHPGLKVATNPNFDGKLKEIDDEFIKNLKILIPWLLSPESLDIKEINGNKITCRGLVEYFKAYIKIYQGEELPHPKSMLQATAEANNLAAVATAKDTYNKKMEEICGGDKPFLAPNDLQSKHLQLKEESVKLFRGVKKMGGEEFSRRYLQQLESEIDELYIQYIKHNDSKNIFHAARTPATLFVVIF---ITYVIAGVTGFIGLDIIASLCNMIMGLTLITLCTWAYIRYSGEYRELGAVIDQVAAALWD 516          
BLAST of Atlastin-1-like vs. UniProt/SwissProt
Match: sp|Q5R4P1|ATLA1_PONAB (Atlastin-1 OS=Pongo abelii OX=9601 GN=ATL1 PE=2 SV=2)

HSP 1 Score: 381.333 bits (978), Expect = 1.698e-122
Identity = 194/476 (40.76%), Postives = 305/476 (64.08%), Query Frame = 2
Query:   62 NFKLNEDALKEILENEKIRDKSVVVISIAGDMRRGKSFMLNFFLKYLEAEDKNNWLSDPDTPLTGFSWKNGRDCDTTGILIWSEPYLMELEDGEECAVLLMDTQGTFDKKSTMRKNAMIFALSTMISSMQIFNVNSQLREDNLEFLSVFINYGRLAMERNETIKPFQHLQFLIRDWNSPYLNPYGLEGGKKYLDEFLMYDENDNPQIIGVRKFLHRCFSRIDCCLMPFPGSKVMSSEVFNGKLSDIKKGFVENLRLYVPKMLSADYVVPKAINGCNITCQELLEYFKAYFRIFSSDDIVAPQGIFDGIAEASNMASLNICKRFYNEEMEKICAS--KFLKESKLQKEHERICGAAIDKFNNRKNFGNAEHSVQFRLQLEQEIEECFKIFVEKNSFKN--KLDREAWTLFVLVMWYIIGQILRYILTWIGFDTASSWIGWALFVIVLTAISWG-VAYCTD-SQIKEYIDEVINASWE 1471
            +F+L+E AL  IL +E +RDK VV +S+AG  R+GKSF+++F L+Y+  ++  +W+ D + PLTGFSW+ G + +TTGI IWSE +L+   DG++ AVLLMDTQGTFD +ST+R +A +FALSTMISS+Q++N++  ++ED+L+ L +F  YGRLAME    +KPFQ L FL+RDW+ PY   YG +GG K+L++ L    N + ++  VRK +H CF+ I C L+P PG KV ++  F+GKL +I   F++NL++ +P +LS + +  K ING  ITC+ L+EYFKAY +I+  +++  P+ +    AEA+N+A++   K  YN++ME+IC     FL  + LQ +H ++   ++  F   K  G  E S ++  QLE EI+E +  +++ N  KN     R   TLFV++    I  ++  +  +IG D  +S     + + ++T  +W  + Y  +  ++   ID+V  A W+
Sbjct:   45 SFELDETALNRILLSEAVRDKEVVAVSVAGAFRKGKSFLMDFMLRYMYNQESVDWVGDYNEPLTGFSWRGGSERETTGIQIWSEIFLINKPDGKKVAVLLMDTQGTFDSQSTLRDSATVFALSTMISSIQVYNLSQNVQEDDLQHLQLFTEYGRLAMEET-FLKPFQSLIFLVRDWSFPYEFSYGADGGAKFLEKRLKVSGNQHEELQNVRKHIHSCFTNISCFLLPHPGLKVATNPNFDGKLKEIDDEFIKNLKILIPWLLSPESLDIKEINGNKITCRGLVEYFKAYIKIYQGEELPHPKSMLQATAEANNLAAVATAKDTYNKKMEEICGGDKPFLAPNDLQTKHLQLKEESVKLFRGVKKMGGEEFSRRYLQQLESEIDELYIQYIKHNDSKNIFHAARTPATLFVVIF---ITYVIAGVTGFIGLDIIASLCNMIMGLTLITLCTWAYIRYSGEYRELGAVIDQVAAALWD 516          
BLAST of Atlastin-1-like vs. UniProt/SwissProt
Match: sp|Q8WXF7|ATLA1_HUMAN (Atlastin-1 OS=Homo sapiens OX=9606 GN=ATL1 PE=1 SV=1)

HSP 1 Score: 381.333 bits (978), Expect = 1.698e-122
Identity = 194/476 (40.76%), Postives = 305/476 (64.08%), Query Frame = 2
Query:   62 NFKLNEDALKEILENEKIRDKSVVVISIAGDMRRGKSFMLNFFLKYLEAEDKNNWLSDPDTPLTGFSWKNGRDCDTTGILIWSEPYLMELEDGEECAVLLMDTQGTFDKKSTMRKNAMIFALSTMISSMQIFNVNSQLREDNLEFLSVFINYGRLAMERNETIKPFQHLQFLIRDWNSPYLNPYGLEGGKKYLDEFLMYDENDNPQIIGVRKFLHRCFSRIDCCLMPFPGSKVMSSEVFNGKLSDIKKGFVENLRLYVPKMLSADYVVPKAINGCNITCQELLEYFKAYFRIFSSDDIVAPQGIFDGIAEASNMASLNICKRFYNEEMEKICAS--KFLKESKLQKEHERICGAAIDKFNNRKNFGNAEHSVQFRLQLEQEIEECFKIFVEKNSFKN--KLDREAWTLFVLVMWYIIGQILRYILTWIGFDTASSWIGWALFVIVLTAISWG-VAYCTD-SQIKEYIDEVINASWE 1471
            +F+L+E AL  IL +E +RDK VV +S+AG  R+GKSF+++F L+Y+  ++  +W+ D + PLTGFSW+ G + +TTGI IWSE +L+   DG++ AVLLMDTQGTFD +ST+R +A +FALSTMISS+Q++N++  ++ED+L+ L +F  YGRLAME    +KPFQ L FL+RDW+ PY   YG +GG K+L++ L    N + ++  VRK +H CF+ I C L+P PG KV ++  F+GKL +I   F++NL++ +P +LS + +  K ING  ITC+ L+EYFKAY +I+  +++  P+ +    AEA+N+A++   K  YN++ME+IC     FL  + LQ +H ++   ++  F   K  G  E S ++  QLE EI+E +  +++ N  KN     R   TLFV++    I  ++  +  +IG D  +S     + + ++T  +W  + Y  +  ++   ID+V  A W+
Sbjct:   45 SFELDETALNRILLSEAVRDKEVVAVSVAGAFRKGKSFLMDFMLRYMYNQESVDWVGDYNEPLTGFSWRGGSERETTGIQIWSEIFLINKPDGKKVAVLLMDTQGTFDSQSTLRDSATVFALSTMISSIQVYNLSQNVQEDDLQHLQLFTEYGRLAMEET-FLKPFQSLIFLVRDWSFPYEFSYGADGGAKFLEKRLKVSGNQHEELQNVRKHIHSCFTNISCFLLPHPGLKVATNPNFDGKLKEIDDEFIKNLKILIPWLLSPESLDIKEINGNKITCRGLVEYFKAYIKIYQGEELPHPKSMLQATAEANNLAAVATAKDTYNKKMEEICGGDKPFLAPNDLQTKHLQLKEESVKLFRGVKKMGGEEFSRRYLQQLESEIDELYIQYIKHNDSKNIFHAARTPATLFVVIF---ITYVIAGVTGFIGLDIIASLCNMIMGLTLITLCTWAYIRYSGEYRELGAVIDQVAAALWD 516          
BLAST of Atlastin-1-like vs. UniProt/SwissProt
Match: sp|Q6PST4|ATLA1_RAT (Atlastin-1 OS=Rattus norvegicus OX=10116 GN=Atl1 PE=1 SV=1)

HSP 1 Score: 380.948 bits (977), Expect = 2.290e-122
Identity = 195/476 (40.97%), Postives = 305/476 (64.08%), Query Frame = 2
Query:   62 NFKLNEDALKEILENEKIRDKSVVVISIAGDMRRGKSFMLNFFLKYLEAEDKNNWLSDPDTPLTGFSWKNGRDCDTTGILIWSEPYLMELEDGEECAVLLMDTQGTFDKKSTMRKNAMIFALSTMISSMQIFNVNSQLREDNLEFLSVFINYGRLAMERNETIKPFQHLQFLIRDWNSPYLNPYGLEGGKKYLDEFLMYDENDNPQIIGVRKFLHRCFSRIDCCLMPFPGSKVMSSEVFNGKLSDIKKGFVENLRLYVPKMLSADYVVPKAINGCNITCQELLEYFKAYFRIFSSDDIVAPQGIFDGIAEASNMASLNICKRFYNEEMEKICAS--KFLKESKLQKEHERICGAAIDKFNNRKNFGNAEHSVQFRLQLEQEIEECFKIFVEKNSFKN--KLDREAWTLFVLVMWYIIGQILRYILTWIGFDTASSWIGWALFVIVLTAISWG-VAYCTD-SQIKEYIDEVINASWE 1471
            +F+L+E AL  IL +E +RDK VV +S+AG  R+GKSF+++F L+Y+  ++  +W+ D + PLTGFSW+ G + +TTGI IWSE +L+   DG++ AVLLMDTQGTFD +ST+R +A +FALSTMISS+Q++N++  ++ED+L+ L +F  YGRLAME    +KPFQ L FL+RDW+ PY   YG +GG K+L++ L    N + ++  VRK +H CF+ I C L+P PG KV ++  F+GKL +I   F++NL++ +P +LS + +  K ING  ITC+ LLEYFKAY +I+  +++  P+ +    AEA+N+A++   K  YN++ME+IC     FL  + LQ +H ++   ++  F   K  G  E S ++  QLE EI+E +  +++ N  KN     R   TLFV++    I  ++  +  +IG D  +S     + + ++T  +W  + Y  +  ++   ID+V  A W+
Sbjct:   45 SFELDEAALNRILLSEAVRDKEVVAVSVAGAFRKGKSFLMDFMLRYMYNQESVDWVGDYNEPLTGFSWRGGSERETTGIQIWSEVFLINKLDGKKVAVLLMDTQGTFDSQSTLRDSATVFALSTMISSIQVYNLSQNVQEDDLQHLQLFTEYGRLAMEET-FLKPFQSLIFLVRDWSFPYEFSYGADGGAKFLEKRLKVSGNQHEELQNVRKHIHSCFTNISCFLLPHPGLKVATNPNFDGKLKEIDDEFIKNLKILIPWLLSPESLDIKEINGNKITCRGLLEYFKAYIKIYQGEELPHPKSMLQATAEANNLAAVATAKDTYNKKMEEICGGDKPFLAPNDLQTKHLQLKEDSVKLFRGVKKMGGEEFSRRYLQQLESEIDELYIQYIKHNDSKNIFHAARTPATLFVVIF---ITYVIAGVTGFIGLDIIASLCNMIMGLTLITLCTWAYIRYSGEYRELGAVIDQVAAALWD 516          
BLAST of Atlastin-1-like vs. TrEMBL
Match: A0A210PFC7 (Atlastin-2 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT09646 PE=4 SV=1)

HSP 1 Score: 403.29 bits (1035), Expect = 8.628e-129
Identity = 208/509 (40.86%), Postives = 314/509 (61.69%), Query Frame = 2
Query:   41 IID*NKDNFKLNEDALKEILENEKIRDKSVVVISIAGDMRRGKSFMLNFFLKYLEAEDKNNWLSDPDTPLTGFSWKNGRDCDTTGILIWSEPYLMELEDGEECAVLLMDTQGTFDKKSTMRKNAMIFALSTMISSMQIFNVNSQLREDNLEFLSVFINYGRLAMERNETI-KPFQHLQFLIRDWNSPYLNPYGLEGGKKYLDEFLMYDENDNPQIIGVRKFLHRCFSRIDCCLMPFPGSKVMSSEVFNGKLSDIKKGFVENLRLYVPKMLSADYVVPKAINGCNITCQELLEYFKAYFRIFSSDDIVAPQGIFDGIAEASNMASLNICKRFYNEEMEKICAS--KFLKESKLQKEHERICGAAIDKFNNRKNFGNAEHSVQFRLQLEQEIEECFKIFVEKNSFKNKLDREAWTLFVLVMWYIIGQILRYILTWIGFDTASSWIGWALFVIVLTAISWGVAYCTDSQ--IKEYIDEVINASWESCLRPAYRYVAQRLVSQLAQNSLRAIQ 1552
            +I      F+L+E  L+EIL +  I+DK VVVIS+AG  R+GKSF+L+FFL+Y+ A+   +WL   + PLTGFSW+ G + +TTGIL+WSEP++ ++  GEE AVLLMDTQG FD +ST+R  A +FALSTM+SS+Q+FN+   ++ED+L+ L +F  YGRLA+E N+ + KPFQ+L+FL+RDW+ PY  PYG  GG+K L+  L   +  +P++  +R  +  CF+ I   LMP PG  V ++ +F+GKL DI+K F E L++ VP +L  + +V K INGC ITC+EL+EYFKAY +I+  +++  P+ +    AEA+N+A+++  K  Y +EME IC     FL    LQ++H+R    A+  FN+ +  G  E S  +  Q+E+E+ E +  + + N  KN +   A T  VL     +  +   +   +G D  +S +   LFV ++   +W     +  Q  I E+ID +    W+  L   Y  V ++ V Q  Q + R  Q
Sbjct:   38 VITGEDHQFELDETKLEEILLSPLIQDKKVVVISVAGAFRKGKSFLLDFFLRYMNAKGHPDWLGGDEAPLTGFSWRGGSERETTGILMWSEPFICKIPSGEEVAVLLMDTQGAFDSESTVRDCATVFALSTMLSSVQVFNLTQNIQEDDLQHLQLFTEYGRLALEANDNVSKPFQNLEFLVRDWSFPYEAPYGAAGGRKILERRLQVSDRQHPELQQLRLHIKSCFTSIGSFLMPHPGLGVATNPMFDGKLKDIEKDFKEQLKILVPLLLDDENLVVKEINGCKITCRELVEYFKAYIKIYQGEELPEPKSMLQATAEANNLAAVSSSKSLYQKEMEIICGGDKPFLHPDTLQRDHQRCLEKAMSTFNSTRKMGGPEFSKVYGEQMEKELLEMYDNYKKHNDGKN-IFSSARTPAVLFTVMAMAYVFSGVFALVGLDYFASLMNLVLFVFLMLLCTWMYVRYSGEQRMIGEHIDFIAEVIWDKALAQVYTKVLEQGVKQAVQQTTRPKQ 545          
BLAST of Atlastin-1-like vs. TrEMBL
Match: B8A6H1 (Atlastin GTPase 1 OS=Danio rerio OX=7955 GN=atl1 PE=1 SV=1)

HSP 1 Score: 396.741 bits (1018), Expect = 4.248e-126
Identity = 208/489 (42.54%), Postives = 305/489 (62.37%), Query Frame = 2
Query:   62 NFKLNEDALKEILENEKIRDKSVVVISIAGDMRRGKSFMLNFFLKYLEAEDKNNWLSDPDTPLTGFSWKNGRDCDTTGILIWSEPYLMELEDGEECAVLLMDTQGTFDKKSTMRKNAMIFALSTMISSMQIFNVNSQLREDNLEFLSVFINYGRLAMERNETIKPFQHLQFLIRDWNSPYLNPYGLEGGKKYLDEFLMYDENDNPQIIGVRKFLHRCFSRIDCCLMPFPGSKVMSSEVFNGKLSDIKKGFVENLRLYVPKMLSADYVVPKAINGCNITCQELLEYFKAYFRIFSSDDIVAPQGIFDGIAEASNMASLNICKRFYNEEMEKICAS--KFLKESKLQKEHERICGAAIDKFNNRKNFGNAEHSVQFRLQLEQEIEECFKIFVEKNSFKN--KLDREAWTLFVL--VMWYIIGQILRYILTWIGFDTASSWIGWALFVIVLTAISWG-VAYCTD-SQIKEYIDEVINASWESCLRPAYRYVA 1504
             F+L+E AL +IL +E++RD+ VV IS+AG  R+GKSF+++F L+Y+ ++    WL D + PLTGFSW+ G + +TTGI IWSE +L++  DG + AVLLMDTQGTFD +ST+R +A +FALSTMISSMQ++N++  ++ED+L+ L +F  YGRLAME    +KPFQ L FL+RDW+ PY  PYG EGG K+L++ L   EN + ++  VRK +H CF+ I C LMP PG KV ++  F+G+L +I + F+ NL++ VP +L    +  K ING  ITC+ L+EYFKAY +I+  +++  P+ +    AEA+N+A++   K  YN +ME +      FL  S+LQ  H  I   A+  F + K  G  E S ++ LQLE EI+E F  +++ N  KN     R   TLFV+  VM+   G     I  ++G D  +S     L   ++T  +W  + Y  +  ++   ID+V  A W+  L   Y   A
Sbjct:   46 TFELDEAALSKILLSEEVRDREVVAISVAGAFRKGKSFLMDFMLRYMYSQASEKWLGDAEEPLTGFSWRGGSERETTGIQIWSEVFLVDKPDGSKVAVLLMDTQGTFDSQSTLRDSATVFALSTMISSMQVYNISQNVQEDDLQHLQLFTEYGRLAMEET-FLKPFQSLIFLVRDWSFPYEFPYGQEGGMKFLEKRLKISENQHEELQNVRKHIHSCFTNISCFLMPHPGLKVATNPHFDGRLREIDQEFINNLQVLVPCLLRPKNLDVKEINGSKITCRGLVEYFKAYIKIYQGEELPHPKSMLQATAEANNLAAVAGAKDLYNRKMEVVSGGDRPFLAPSELQARHLEIREEALALFRSVKKMGGEEFSRRYLLQLETEIDELFVQYIKHNDSKNIFHAARTPATLFVVIFVMYVAAG-----ITGFVGVDVIASVCNMVLGFALITLCTWAYIRYSGEYRELGAVIDQVAGALWDQALYKLYSVAA 528          
BLAST of Atlastin-1-like vs. TrEMBL
Match: A0A5G3HBW9 (GB1/RHD3-type G domain-containing protein OS=Xenopus tropicalis OX=8364 GN=atl1 PE=4 SV=1)

HSP 1 Score: 395.201 bits (1014), Expect = 1.591e-125
Identity = 201/487 (41.27%), Postives = 309/487 (63.45%), Query Frame = 2
Query:   62 NFKLNEDALKEILENEKIRDKSVVVISIAGDMRRGKSFMLNFFLKYLEAEDKNNWLSDPDTPLTGFSWKNGRDCDTTGILIWSEPYLMELEDGEECAVLLMDTQGTFDKKSTMRKNAMIFALSTMISSMQIFNVNSQLREDNLEFLSVFINYGRLAMERNETIKPFQHLQFLIRDWNSPYLNPYGLEGGKKYLDEFLMYDENDNPQIIGVRKFLHRCFSRIDCCLMPFPGSKVMSSEVFNGKLSDIKKGFVENLRLYVPKMLSADYVVPKAINGCNITCQELLEYFKAYFRIFSSDDIVAPQGIFDGIAEASNMASLNICKRFYNEEMEKICAS--KFLKESKLQKEHERICGAAIDKFNNRKNFGNAEHSVQFRLQLEQEIEECFKIFVEKNSFKN--KLDREAWTLFVLVMWYIIGQILRYILTWIGFDTASSWIGWALFVIVLTAISWG-VAYCTD-SQIKEYIDEVINASWESCLRPAYRYVA 1504
            +F+L+E AL  IL +E +RDK VV +S+AG  R+GKSF+++F L+Y+   D  +WL D + PL+GFSW+ G + +TTGI IWSE +L+E  DG + AVLLMDTQGTFD +ST+R +A +FALSTMISS+Q++N++  ++ED+L+ L +F  YGRLAME    +KPFQ L FL+RDW+ PY  PYG +GG K+L++ L   EN + ++  VRK +H CF+ I C LMP PG  V ++  F+GKL +I + F++NL++++P +LS + +  K I+G  ITC+ L+EYFKAY +I+  +++  P+ +    AEA+N+A++   K  YN+ ME++C     FL  + LQ+ H+ +   A+  F   K  G  E S ++  QLE EI+E +  +++ N  KN     R   TLFV++    I  +L  +  +IG D  +S     + + ++T  +W  + Y  +  ++   ID+V  A W+  L   Y   A
Sbjct:   44 SFELDEAALNCILLSEAVRDKEVVAVSVAGAFRKGKSFLMDFMLRYMYKTDTVDWLGDYNEPLSGFSWRGGSERETTGIQIWSEIFLVENPDGNKVAVLLMDTQGTFDSQSTLRDSATVFALSTMISSIQVYNLSQNVQEDDLQHLQLFTEYGRLAMEET-FLKPFQSLIFLVRDWSFPYEFPYGSDGGNKFLEKRLKVSENQHEELQNVRKHIHSCFTNISCFLMPHPGLTVATNPNFDGKLKEIDEEFIKNLKVFIPWLLSPENLDVKEISGNRITCRGLVEYFKAYIKIYQGEELPHPKSMLQATAEANNLAAVATAKDLYNKNMEEVCGGDRPFLAPTDLQQRHQHLKEEAVKLFRGVKKMGGEEFSRRYLQQLENEIDELYVQYIKHNDSKNIFHAARTPATLFVVIF---ITYVLAAVTGFIGLDIIASLCNMIMGLTLITLCTWAYIRYSGEYRELGAVIDQVAAALWDQALYKLYSAAA 526          
BLAST of Atlastin-1-like vs. TrEMBL
Match: A0A3B3SMX3 (Atlastin GTPase 1 OS=Paramormyrops kingsleyae OX=1676925 PE=4 SV=1)

HSP 1 Score: 394.045 bits (1011), Expect = 1.988e-125
Identity = 213/492 (43.29%), Postives = 312/492 (63.41%), Query Frame = 2
Query:   53 NKDNFKLNEDALKEILENEKIRDKSVVVISIAGDMRRGKSFMLNFFLKYLEAEDKNNWLSDPDTPLTGFSWKNGRDCDTTGILIWSEPYLMELEDGEECAVLLMDTQGTFDKKSTMRKNAMIFALSTMISSMQIFNVNSQLREDNLEFLSVFINYGRLAMERNETIKPFQHLQFLIRDWNSPYLNPYGLEGGKKYLDEFLMYDENDNPQIIGVRKFLHRCFSRIDCCLMPFPGSKVMSSEVFNGKLSDIKKGFVENLRLYVPKMLSADYVVPKAINGCNITCQELLEYFKAYFRIFSSDDIVAPQGIFDGIAEASNMASLNICKRFYNEEMEKICAS--KFLKESKLQKEHERICGAAIDKFNNRKNFGNAEHSVQFRLQLEQEIEECFKIFVEKNSFKN--KLDREAWTLFVL--VMWYIIGQILRYILTWIGFDTASSWIGWALFVIVLTAISWG-VAYCTD-SQIKEYIDEVINASWESCLRPAYRYVA 1504
            +  +F+L+E AL  IL +E+ R++ VV IS+AG  R+GKSF+L+F L+Y+  +D ++WL DP+ PLTGFSW+ G + +TTGI IWSE +L++  DG++ AVLLMDTQGTFD +ST+R +A +FALSTMISSMQ++N++  ++ED+L+ L +F  YGRLAME    +KPFQ L FL+RDW+ PY  PYG EGG K+L++ L   EN + ++  VRK +H CF+ I C LMP PG KV ++  F+G+L +I K F+ NL++ VP +LS   +  K ING NITC+ LLEYFKAY +I+  +++  P+ +    AEA+N+A++   K  YN +ME IC     FL  ++LQ  H  I   A+  F   K  G  E S ++  QLE E++E F  +++ N  KN     R   TLFV+  VM+ I G     +  ++G D  +S     L + ++T  +W  + Y  +  ++   ID+V  A W+  L   Y   A
Sbjct:   15 DDHSFELDEAALSRILLSEETREREVVAISVAGAFRKGKSFLLDFMLRYMYNQDFDDWLGDPEEPLTGFSWRGGSERETTGIQIWSEVFLVDKADGQKVAVLLMDTQGTFDSQSTLRDSATVFALSTMISSMQVYNISQNVQEDDLQHLQLFTEYGRLAMEET-FLKPFQSLIFLVRDWSFPYEFPYGHEGGMKFLEKRLKISENQHEELQNVRKHIHSCFTNISCFLMPHPGLKVATNPHFDGRLKEIDKEFINNLKILVPWLLSPQNLDVKEINGNNITCRGLLEYFKAYIKIYQGEELPHPKSMLQATAEANNLAAVAAAKDLYNRKMEGICGGDRPFLAPNELQARHGEIREEALQLFKGVKKMGGEEFSRRYLQQLEAEVDEVFIQYIKHNDSKNIFHAARTPATLFVVIFVMYVIAG-----VTGFVGVDIIASVCNMILGLALITLCTWAYIRYSGEYRELGAVIDQVAGALWDQALFKLYSAAA 500          
BLAST of Atlastin-1-like vs. TrEMBL
Match: A0A2C9K976 (GB1/RHD3-type G domain-containing protein OS=Biomphalaria glabrata OX=6526 GN=106067016 PE=4 SV=1)

HSP 1 Score: 393.66 bits (1010), Expect = 3.882e-125
Identity = 196/515 (38.06%), Postives = 315/515 (61.17%), Query Frame = 2
Query:   62 NFKLNEDALKEILENEKIRDKSVVVISIAGDMRRGKSFMLNFFLKYLEAEDKNNWLSDPDTPLTGFSWKNGRDCDTTGILIWSEPYLMELEDGEECAVLLMDTQGTFDKKSTMRKNAMIFALSTMISSMQIFNVNSQLREDNLEFLSVFINYGRLAMERNETI-KPFQHLQFLIRDWNSPYLNPYGLEGGKKYLDEFLMYDENDNPQIIGVRKFLHRCFSRIDCCLMPFPGSKVMSSEVFNGKLSDIKKGFVENLRLYVPKMLSADYVVPKAINGCNITCQELLEYFKAYFRIFSSDDIVAPQGIFDGIAEASNMASLNICKRFYNEEMEKICAS--KFLKESKLQKEHERICGAAIDKFNNRKNFGNAEHSVQFRLQLEQEIEECFKIFVEKNSFKN--KLDREAWTLFVLVMWYIIGQILRYILTWIGFDTASSWIGWALFVIVLTAISWGVAYCTDSQ--IKEYIDEVINASWESCLRPAYRYVAQRLVSQLAQNSLRAIQ*PDRSLP*SKP 1585
             F L+E AL++IL  + ++DK V ++S+AG  R+GKSF+L+FFL+YL A  + +WL D + PL GFSW+ G D DTTGIL+WSEP+ M  ++GEE  +LLMDTQG FD +ST++  A IFALSTMISS+Q+FN+   ++ED+L+ L +F  YGRLA+E N+ + KPFQ LQFL+RDW+ PY  PYG  GG++ L++ L   +  +P++  +RK +  CF +I C L+P PG KV ++  F+G+L +I+  F+  L++  P +L+ + +V K ING  + C+E+LEYFKAY +I+  +++  P+ +    AEA+N+A++   K FY ++ME +C     +L    L+ +H R+   +ID F+  +  G  E S+ +  +L++++ E F+ F   N  KN     R    LF ++   ++  IL   +   G +  ++ I   + + ++  ++W     +     +   ID++ +  WE+ L  AY  V +R +    Q  LR      + LP +KP
Sbjct:   31 TFDLDEPALEKILLRKDVQDKMVAIVSVAGAFRKGKSFLLDFFLRYLSAGGEEDWLGDDNAPLEGFSWRGGSDRDTTGILMWSEPFFMTNKNGEEVVILLMDTQGAFDSESTVKDCATIFALSTMISSVQVFNLTQNIQEDDLQHLQLFTEYGRLALEANDNVSKPFQTLQFLVRDWSFPYEAPYGAAGGRQILEKRLKISDKQHPELQQIRKHISSCFDKISCFLLPHPGLKVATNPYFDGRLKEIEPEFLGQLQILTPLLLAKENIVVKEINGQKVRCKEMLEYFKAYMKIYQGEELPEPKSMLQATAEANNLAAVANVKSFYMKQMEDLCGGDKPYLSPEALRTQHNRLAEQSIDMFHATRKMGGPEFSLAYEEKLKEDLTEAFENFSRHNDSKNFFSATRTPSVLFTVI---VVTYILSGFMGMCGLEMLANLINLVMIIFLVLLVAWLYTRYSGEHRSLSIAIDQLADLLWENILSQAYTKVTERGI----QEVLR-----QQGLPSTKP 533          
BLAST of Atlastin-1-like vs. Ensembl Cavefish
Match: atl1 (atlastin GTPase 1 [Source:NCBI gene;Acc:103024846])

HSP 1 Score: 382.489 bits (981), Expect = 5.622e-124
Identity = 204/478 (42.68%), Postives = 305/478 (63.81%), Query Frame = 2
Query:   62 NFKLNEDALKEILENEKIRDKSVVVISIAGDMRRGKSFMLNFFLKYLEAEDKNNWLSDPDTPLTGFSWKNGRDCDTTGILIWSEPYLMELEDGEECAVLLMDTQGTFDKKSTMRKNAMIFALSTMISSMQIFNVNSQLREDNLEFLSVFINYGRLAMERNETIKPFQHLQFLIRDWNSPYLNPYGLEGGKKYLDEFLMYDENDNPQIIGVRKFLHRCFSRIDCCLMPFPGSKVMSSEVFNGKLSDIKKGFVENLRLYVPKMLSADYVVPKAINGCNITCQELLEYFKAYFRIFSSDDIVAPQGIFDGIAEASNMASLNICKRFYNEEMEKICAS--KFLKESKLQKEHERICGAAIDKFNNRKNFGNAEHSVQFRLQLEQEIEECFKIFVEKNSFKN--KLDREAWTLFVL--VMWYIIGQILRYILTWIGFDTASSWIGWALFVIVLTAISWG-VAYCTD-SQIKEYIDEVINASWE 1471
            +F+L+E AL  IL  E++RD+ VV +S+AG  R+GKSF+++F L+Y+  + +++WL DP+ PLTGFSW+ G + +TTGI IWSE +L++  DG + AVLLMDTQGTFD +ST+R +A +FALSTMISSMQ++N++  ++ED+L+ L +F  YGRLAME    +KPFQ + FL+RDW+ PY  PYG EGG K+L++ L   EN + ++  VRK +H CF+ I C LMP PG KV ++  F+G+L +I + F+ NL++ VP +L    +  K ING  ITC+ LLEYFKAY +I+  +++  P+ +    AEA+N+A++   K  YN++ME++      FL  ++LQ  H  I   A+  F   K  G  E S ++ LQLE EI+E F  +++ N  KN     R   TLFV+  VM+   G     I  ++G D  +S     L   ++T  +W  + Y  +  ++   ID+V  A W+
Sbjct:   46 SFELDEAALSRILLAEELRDREVVAVSVAGAFRKGKSFLMDFMLRYMYNQARDDWLGDPEEPLTGFSWRGGSERETTGIQIWSEVFLVDKPDGTKVAVLLMDTQGTFDSQSTLRDSATVFALSTMISSMQVYNISQNVQEDDLQHLQLFTEYGRLAMEET-FLKPFQSMIFLVRDWSFPYEFPYGQEGGMKFLEKRLKISENQHEELQNVRKHIHSCFTNISCFLMPHPGLKVATNPHFDGRLKEIDREFIGNLQVLVPWLLGPKNLDVKEINGSKITCRGLLEYFKAYIKIYQGEELPHPKSMLQATAEANNLAAVAAAKDLYNKKMEEVSGGDRPFLAPTELQSRHASIREEALTVFRGVKKMGGEEFSRRYLLQLEAEIDELFVQYIKHNDSKNIFHAARTPATLFVVIFVMYVSAG-----ITGFVGVDVIASVCNMVLGFALITLCTWAYIRYSGEYRELGAVIDQVAGALWD 517          
BLAST of Atlastin-1-like vs. Ensembl Cavefish
Match: atl2 (atlastin GTPase 2 [Source:NCBI gene;Acc:103030630])

HSP 1 Score: 369.392 bits (947), Expect = 2.320e-118
Identity = 196/508 (38.58%), Postives = 305/508 (60.04%), Query Frame = 2
Query:   53 NKDN--FKLNEDALKEILENEKIRDKSVVVISIAGDMRRGKSFMLNFFLKYLE-AEDKNNWLSDPDTPLTGFSWKNGRDCDTTGILIWSEPYLMELEDGEECAVLLMDTQGTFDKKSTMRKNAMIFALSTMISSMQIFNVNSQLREDNLEFLSVFINYGRLAMERNETIKPFQHLQFLIRDWNSPYLNPYGLEGGKKYLDEFLMYDENDNPQIIGVRKFLHRCFSRIDCCLMPFPGSKVMSSEVFNGKLSDIKKGFVENLRLYVPKMLSADYVVPKAINGCNITCQELLEYFKAYFRIFSSDDIVAPQGIFDGIAEASNMASLNICKRFYNEEMEKICAS--KFLKESKLQKEHERICGAAIDKFNNRKNFGNAEHSVQFRLQLEQEIEECFKIFVEKNSFKNKL--DREAWTLF-VLVMWYIIGQILRYILTWIGFDTASSWIGWALFVIVLTAISWG-VAYCTD-SQIKEYIDEVINASWESCLRPAYRYVAQRLVSQLAQNSLRA 1546
            N+D+  F+L+  AL++IL  E +RD +VVV+S+AG  R+GKSF+L+F L+Y+   +   +W+   D PLTGFSW+ G + +TTGI  WSE +++E  DG + AVLL+DTQG FD +ST++  A +FALSTM SS+Q++N++  ++ED+L+ L +F  YGRLAME+    KPFQ L FLIRDW  PY + YGL GG ++L+  L   +N + ++  VRK +H CFS I C L+P PG KV ++  F+G+L DI   F + L+  VP +L+ + +V K ING  +TC++LLEYFKAY +I+  +++  P+ +    AEA+N+ ++   K  Y+  ME++C     ++    LQ+ HE +   ++ +F   K  G  E S +++ QLE E++E F  F + N  KN     R   TLF ++   YI+  I  +    IG    ++     + + +++   W  V Y  +  ++   ID    A WE  L+P      +  + Q   NS+RA
Sbjct:   84 NQDDHMFELDASALEKILMQEHVRDLNVVVVSVAGAFRKGKSFLLDFMLRYMHNHQSSESWMGGEDEPLTGFSWRGGCERETTGIQAWSEVFVVEKGDGSKVAVLLVDTQGAFDSQSTIKDCATVFALSTMTSSVQVYNLSQNIQEDDLQHLQLFTEYGRLAMEQIYE-KPFQRLLFLIRDWCYPYEHNYGLAGGNRFLERRLQVKQNQHEELQNVRKHIHACFSNIGCFLLPHPGLKVATNPYFDGRLRDIDDEFTKELQNLVPLLLAPENLVEKEINGAKVTCRDLLEYFKAYIKIYQGEELPHPKSMLQATAEANNLTAVAGAKDTYSRGMEQVCGGDKPYIAPIDLQRYHEDLKQTSVQQFRAVKKMGGLEFSQRYQEQLETELDEVFANFTKHNESKNIFYAARTPATLFAIMFATYIVSTITGF----IGLSVIAALANLVMGISLMSLCIWAYVRYSGEYREVGVAIDLTAEALWEQVLKPMTEQYMEENIRQTVVNSIRA 586          
BLAST of Atlastin-1-like vs. Ensembl Cavefish
Match: atl1 (atlastin GTPase 1 [Source:NCBI gene;Acc:103024846])

HSP 1 Score: 360.533 bits (924), Expect = 7.464e-116
Identity = 201/483 (41.61%), Postives = 298/483 (61.70%), Query Frame = 2
Query:   53 NKDNFKLNEDALKEILENEKIRDKSVVVISIAGDMRRGKSFMLNFFLKYLEAEDKNNWLSDPDTPLTGFSWKNGRDCDTTGILIWSEPYLMELEDGEECAVLLMDTQGTFDKKSTMRKNAMIFALSTMISSMQIFNVNSQLREDNLEF-----LSVFINYGRLAMERNETIKPFQHLQFLIRDWNSPYLNPYGLEGGKKYLDEFLMYDENDNPQIIGVRKFLHRCFSRIDCCLMPFPGSKVMSSEVFNGKLSDIKKGFVENLRLYVPKMLSADYVVPKAINGCNITCQELLEYFKAYFRIFSSDDIVAPQGIFDGIAEASNMASLNICKRFYNEEMEKICAS--KFLKESKLQKEHERICGAAIDKFNNRKNFGNAEHSVQFRLQLEQEIEECFKIFVEKNSFKN--KLDREAWTLFVL--VMWYIIGQILRYILTWIGFDTASSWIGWALFVIVLTAISWG-VAYCTD-SQIKEYIDEVINA 1462
            +  +F+L+E AL  IL  E++RD+ VV +S+AG  R+GKSF+++F L+Y+  + +++WL DP+ PLTGFSW+ G + +TTGI IWSE +L++  DG + AVLLMDTQGTFD +ST+R +A +FALSTMISSMQ+    S    +N  +     L++F  YGRLAME    +KPFQ + FL+RDW+ PY  PYG EGG K+L++ L   EN + ++  VRK +H CF+ I C LMP PG KV ++  F+G+L +I + F+ NL++ VP +L    +  K ING  ITC+ LLEYFKAY +I+  +++  P+ +    AEA+N+A++   K  YN++ME++      FL  ++LQ  H  I   A+  F   K  G  E S ++ LQLE EI+E F  +++ N  KN     R   TLFV+  VM+   G     I  ++G D  +S     L   ++T  +W  + Y  +  ++   ID+V  A
Sbjct:   44 DDHSFELDEAALSRILLAEELRDREVVAVSVAGAFRKGKSFLMDFMLRYMYNQARDDWLGDPEEPLTGFSWRGGSERETTGIQIWSEVFLVDKPDGTKVAVLLMDTQGTFDSQSTLRDSATVFALSTMISSMQVIVQLSSHTTNNTYYHVTQALTLFTEYGRLAMEET-FLKPFQSMIFLVRDWSFPYEFPYGQEGGMKFLEKRLKVRENQHEELQNVRKHIHSCFTNISCFLMPHPGLKVATNPHFDGRLKEIDREFIGNLQVLVPWLLGPKNLDVKEINGSKITCRGLLEYFKAYIKIYQGEELPHPKSMLQATAEANNLAAVAAAKDLYNKKMEEVSGGDRPFLAPTELQSRHASIREEALTVFRGVKKMGGEEFSRRYLLQLEAEIDELFVQYIKHNDSKNIFHAARTPATLFVVIFVMYVSAG-----ITGFVGVDVIASVCNMVLGFALITLCTWAYIRYSGEYRELGAVIDQVAGA 520          
BLAST of Atlastin-1-like vs. Ensembl Cavefish
Match: atl3 (atlastin-3-like [Source:NCBI gene;Acc:103047852])

HSP 1 Score: 344.739 bits (883), Expect = 5.106e-110
Identity = 183/461 (39.70%), Postives = 287/461 (62.26%), Query Frame = 2
Query:   41 IID*NKD--NFKLNEDALKEILENEKIRDKSVVVISIAGDMRRGKSFMLNFFLKYLEAEDKNNWLSDPDTPLTGFSWKNGRDCDTTGILIWSEPYLMELEDGEECAVLLMDTQGTFDKKSTMRKNAMIFALSTMISSMQIFNVNSQLREDNLEFLSVFINYGRLAMERNETIKPFQHLQFLIRDWNSPYLNPYGLEGGKKYLDEFLMYDENDNPQIIGVRKFLHRCFSRIDCCLMPFPGSKVMSSEVFNGKLSDIKKGFVENLRLYVPKMLSADYVVPKAINGCNITCQELLEYFKAYFRIFSSDDIVAPQGIFDGIAEASNMASLNICKRFYNEEMEKICASK--FLKESKLQKEHERICGAAIDKFNNRKNFGNAEHSVQFRLQLEQEIEECFKIFVEKNSFKNKLD--REAWTLFVLVMWYIIGQILRYILTWIGFDTASSWIGWALFVIVLTAISWG 1405
            I+  NK+  +F L+ +AL+ IL   KIRD +VVV+S+AG  R+GKSF+L+F L+Y+  +  ++WL   D PLTGFSW+ G + +TTGI +WSE +++   +G++ AVLLMDTQG FD +ST++  A IFALSTM SS+QI+N++  ++ED+L+ L +F  YGRLAM+    +KPFQ L FLIRDW+ PY   YGL+GG ++LD+ L   ++ + ++  VR+ +H CF+ I C L+P PG KV ++  F G+L D+   F + LR  +P +L  D +  K ING  +TC+ LLEYFK+Y +I+  +D+  P+ +    AEA+N+A++   K  Y + MEK+C  +  ++    L+++H      ++  F + K  G  +   +++ QLE E+ E +  F + N  KN     R    LFVLV    +  +L  +L +IG D+ S      L + ++  ++W 
Sbjct:   10 IVTVNKEEHSFDLDTEALERILLVPKIRDMNVVVLSVAGAFRKGKSFLLDFMLRYMYRKSSDDWLGRDDEPLTGFSWRGGSEPETTGIQLWSEVFVVRKSNGKQVAVLLMDTQGAFDNQSTVKDCATIFALSTMTSSIQIYNLSQNIQEDDLQQLQLFTEYGRLAMDEI-FLKPFQSLMFLIRDWSFPYEYDYGLKGGSQFLDKRLQVKDSQHEELQTVRQHIHSCFTSISCFLLPHPGLKVATNPAFQGQLCDVAPEFKKELRDLIPALLDPDKLAVKEINGNTVTCRGLLEYFKSYIKIYQGEDLPHPKSMLLATAEANNLAAVASSKDQYYKNMEKVCGGELPYVAPDSLEEKHNFYLRESLHHFTSIKKMGGQDFCNRYQAQLESELNELWVSFSKHNESKNVFSAFRTPAVLFVLV---CLLYVLSGLLLFIGLDSVSFVCDCMLGLAMIAMLTWA 466          
BLAST of Atlastin-1-like vs. Ensembl Cavefish
Match: atl3 (atlastin-3-like [Source:NCBI gene;Acc:103047852])

HSP 1 Score: 344.354 bits (882), Expect = 8.658e-110
Identity = 183/461 (39.70%), Postives = 287/461 (62.26%), Query Frame = 2
Query:   41 IID*NKD--NFKLNEDALKEILENEKIRDKSVVVISIAGDMRRGKSFMLNFFLKYLEAEDKNNWLSDPDTPLTGFSWKNGRDCDTTGILIWSEPYLMELEDGEECAVLLMDTQGTFDKKSTMRKNAMIFALSTMISSMQIFNVNSQLREDNLEFLSVFINYGRLAMERNETIKPFQHLQFLIRDWNSPYLNPYGLEGGKKYLDEFLMYDENDNPQIIGVRKFLHRCFSRIDCCLMPFPGSKVMSSEVFNGKLSDIKKGFVENLRLYVPKMLSADYVVPKAINGCNITCQELLEYFKAYFRIFSSDDIVAPQGIFDGIAEASNMASLNICKRFYNEEMEKICASK--FLKESKLQKEHERICGAAIDKFNNRKNFGNAEHSVQFRLQLEQEIEECFKIFVEKNSFKNKLD--REAWTLFVLVMWYIIGQILRYILTWIGFDTASSWIGWALFVIVLTAISWG 1405
            I+  NK+  +F L+ +AL+ IL   KIRD +VVV+S+AG  R+GKSF+L+F L+Y+  +  ++WL   D PLTGFSW+ G + +TTGI +WSE +++   +G++ AVLLMDTQG FD +ST++  A IFALSTM SS+QI+N++  ++ED+L+ L +F  YGRLAM+    +KPFQ L FLIRDW+ PY   YGL+GG ++LD+ L   ++ + ++  VR+ +H CF+ I C L+P PG KV ++  F G+L D+   F + LR  +P +L  D +  K ING  +TC+ LLEYFK+Y +I+  +D+  P+ +    AEA+N+A++   K  Y + MEK+C  +  ++    L+++H      ++  F + K  G  +   +++ QLE E+ E +  F + N  KN     R    LFVLV    +  +L  +L +IG D+ S      L + ++  ++W 
Sbjct:   37 IVTVNKEEHSFDLDTEALERILLVPKIRDMNVVVLSVAGAFRKGKSFLLDFMLRYMYRKSSDDWLGRDDEPLTGFSWRGGSEPETTGIQLWSEVFVVRKSNGKQVAVLLMDTQGAFDNQSTVKDCATIFALSTMTSSIQIYNLSQNIQEDDLQQLQLFTEYGRLAMDEI-FLKPFQSLMFLIRDWSFPYEYDYGLKGGSQFLDKRLQVKDSQHEELQTVRQHIHSCFTSISCFLLPHPGLKVATNPAFQGQLCDVAPEFKKELRDLIPALLDPDKLAVKEINGNTVTCRGLLEYFKSYIKIYQGEDLPHPKSMLLATAEANNLAAVASSKDQYYKNMEKVCGGELPYVAPDSLEEKHNFYLRESLHHFTSIKKMGGQDFCNRYQAQLESELNELWVSFSKHNESKNVFSAFRTPAVLFVLV---CLLYVLSGLLLFIGLDSVSFVCDCMLGLAMIAMLTWA 493          
BLAST of Atlastin-1-like vs. Ensembl Sea Lamprey
Match: atl2 (atlastin GTPase 2 [Source:ZFIN;Acc:ZDB-GENE-030131-6505])

HSP 1 Score: 373.244 bits (957), Expect = 1.437e-121
Identity = 203/502 (40.44%), Postives = 312/502 (62.15%), Query Frame = 2
Query:   62 NFKLNEDALKEILENEKIRDKSVVVISIAGDMRRGKSFMLNFFLKYLEAEDKNNWLSDPDTPLTGFSWKNGRDCDTTGILIWSEPYLMELEDGEECAVLLMDTQGTFDKKSTMRKNAMIFALSTMISSMQIFNVNSQLREDNLEFLSVFINYGRLAMERNETIKPFQHLQFLIRDWNSPYLNPYGLEGGKKYLDEFLMYDENDNPQIIGVRKFLHRCFSRIDCCLMPFPGSKVMSSEVFNGKLSDIKKGFVENLRLYVPKMLSADYVVPKAINGCNITCQELLEYFKAYFRIFSSDDIVAPQGIFDGIAEASNMASLNICKRFYNEEMEKICASK--FLKESKLQKEHERICGAAIDKFNNRKNFGNAEHSVQFRLQLEQEIEECFKIFVEKNSFKN--KLDREAWTLF-VLVMWYIIGQILRYILTWIGFDTASSWIGWALFVIVLTAISWG-VAYCTDSQ-IKEYIDEVINASWESCLRPAYRYVAQRLVSQLAQNSLRA 1546
            +F+L+E+AL  +L +E++RDK VVV+S+AG  R+GKSF+L+F L+Y+  ++ ++WL   D PLTGF+W+ G + +TTGI +WS+ +L++  DG + AVLLMDTQG FD +ST++  A +FALSTM SS+Q++N+   ++ED+L+ L +F  YGRLAM++    KPFQ L FL+RDW+ PY  PYG EGG K+L++ L   EN + ++  VRK +H CFS++ C LMP PG KV ++  F+G+L DI   F +NL+  VP +L++  +  K ING  ITC+ L++YFK Y +I+  +++  P+ +    AEA+N+ ++   K  YN EMEK+C     FL  S L++ H  +    I +F + K  G  E+S ++  QLE EI+E F  F + N  KN  K  R   T F V+V  Y+    L +    +G    +S     L + +L   +W  V Y  + + +   IDE+ N  WE  ++P    + +  + Q  +NS+RA
Sbjct:   22 SFELDEEALGRVLLDERVRDKDVVVVSVAGAFRKGKSFLLDFMLRYMYNKNTSSWLGGNDEPLTGFTWRGGCERETTGIQMWSDVFLVDKPDGSQVAVLLMDTQGAFDSQSTIKDCATVFALSTMTSSVQVYNLTQNIQEDDLQHLQLFTEYGRLAMDQ-VINKPFQSLMFLVRDWSFPYEYPYGHEGGNKFLEKRLKLSENQHEEVQNVRKHIHSCFSKVSCFLMPHPGLKVATNPNFDGRLKDIDSEFKQNLQNLVPLLLASQNLAVKEINGSRITCRALVQYFKTYMKIYQGEELPHPKSMLQATAEANNLTAVATAKDMYNREMEKVCGGNQPFLAPSDLEQRHHNLLEGCIKQFRSTKKMGGEEYSRKYEEQLECEIQETFGNFSKHNDSKNIFKAARTPATFFSVVVAMYVASGALGF----VGLSALASLCNLVLTMSLLLLCTWSYVRYSGEYRDVGAVIDELANVLWEQVIKPLSESLLEDTMRQTVKNSIRA 518          
BLAST of Atlastin-1-like vs. Ensembl Sea Lamprey
Match: atl2 (atlastin GTPase 2 [Source:ZFIN;Acc:ZDB-GENE-030131-6505])

HSP 1 Score: 373.244 bits (957), Expect = 1.576e-121
Identity = 196/482 (40.66%), Postives = 305/482 (63.28%), Query Frame = 2
Query:   65 FKLNEDALKEILENEKIRDKSVVVISIAGDMRRGKSFMLNFFLKYLEAEDKNNWLSDPDTPLTGFSWKNGRDCDTTGILIWSEPYLMELEDGEECAVLLMDTQGTFDKKSTMRKNAMIFALSTMISSMQIFNVNSQLREDNLEFLSVFINYGRLAMERNETI-KPFQHLQFLIRDWNSPYLNPYGLEGGKKYLDEFLMYDENDNPQIIGVRKFLHRCFSRIDCCLMPFPGSKVMSSEVFNGKLSDIKKGFVENLRLYVPKMLSADYVVPKAINGCNITCQELLEYFKAYFRIFSSDDIVAPQGIFDGIAEASNMASLNICKRFYNEEMEKICAS--KFLKESKLQKEHERIC-GAAIDKFNNRKNFGNAEHSVQFRLQLEQEIEECFKIFVEKNSFKNKLD--REAWTLFVLVMWYIIGQILRYILTWIGFDTASSWIGWALFVIVLTAISWG-VAYCTDS-QIKEYIDEVINASWESCLRP 1486
            F L+E AL++ L  + +RDK VVVIS+AG  R+GKSF+L+F L+Y+ ++    WL   + PLTGFSW+ G + DTTGIL+WS+ +L +  DG + AVLLMDTQG FD +ST+R  A +FALSTM SS+Q++NV+  ++ED+L+ L +F  YGRLAME  E + KPFQ L FL+RDW+ PY   YG +GG+ +L++ L+ ++  + ++  VR  ++ CFS + C LMP PG  V +   F+G+L+D+   F + L+  VP +L+ + +V K ING  ITC+ L+EYFK+Y +I+  +++  P+ +    AEA+N++++   K  Y  EMEK+C     FL  S+L++ H R+  G A+  F + K  G  E   +++ QLE E+E+ +  FV+ N  KN     R   +LFV+++      +L  +L ++G D  +S    A+ V++L   +WG V Y  +  ++   IDE+ N  WE+ + P
Sbjct:   19 FSLDEQALEDTLLKKNLRDKPVVVISVAGAFRKGKSFLLDFMLRYMYSKGSPAWLGGDNEPLTGFSWRGGSERDTTGILLWSDVFL-DRPDGSQVAVLLMDTQGAFDSQSTIRDCATVFALSTMTSSLQVYNVSHNIQEDDLQHLQLFTEYGRLAME--EIVNKPFQSLTFLVRDWSFPYEFVYGADGGRHFLEKRLLVNDQQHEELQTVRMHINSCFSSVSCFLMPHPGLMVATDPHFDGRLADVDTAFKQCLQELVPMLLAPENLVVKEINGTPITCRSLVEYFKSYMKIYQGEELPHPKSMLLATAEANNLSAVAAAKEIYTTEMEKVCGGDRAFLAPSELERHHRRVATGGAL--FRSVKKMGGDEFICRYQEQLENEVEQLYGNFVKYNESKNIFHTFRTPASLFVVML---AAYVLSGVLGFVGLDIVASLCNLAVTVLLLLLCTWGYVRYSGEYLEMGVLIDELANFIWETMISP 492          
BLAST of Atlastin-1-like vs. Ensembl Sea Lamprey
Match: GBP6 (guanylate binding protein family member 6 [Source:HGNC Symbol;Acc:HGNC:25395])

HSP 1 Score: 61.2326 bits (147), Expect = 4.270e-10
Identity = 74/365 (20.27%), Postives = 142/365 (38.90%), Query Frame = 2
Query:  122 KSVVVISIAGDMRRGKSFMLNFFLKYLEAEDKNNWLSDPDTPLTGFSWKNGRDCDTTGILIWSEPYLMELEDGEECAVLLMDTQGTFD-KKSTMRKNAMIFALSTMISSMQIFNVNSQLRE---DNLEFLSVFINYGRLAMERNET------IKPFQHLQFLIRDWNSPYLNPYGLEGGKKYLDEFLMYDENDNPQIIGVRK---------------FLHRCFSRIDCCLMPFPGSKVMSSEVFNGKLSDIKKGFVENLRLYVPKMLSADYVVPKAINGCNITCQELLEYFKAYFRIFSSDDIVAPQGIFDGIAEASNMASLNICKRFYNEEMEKICASKFLKESKLQKEHERICGAAIDKFNNR 1141
            + VVV++IAG  R GKS+++N           NN          GFS  N     T GI IW   + +     ++C +LL+DT+G  D +K+    +  +F ++ ++S+  ++N    L +   D L F++    + R  + + E        + F      +RD+         +EG     D++L +        +G+RK                L   F +  C + P P       ++       +   F++    +   +L   ++  K ++   +T    L+  + Y     S D+   +     +   +NM +       Y + ME +     L  +KL + H+     A++ F+ R
Sbjct:   39 QPVVVVAIAGRYRTGKSYLMNRL------AGSNN----------GFSLGNTVQSHTKGIWIWPRAHPLH---KDKC-LLLIDTEGLGDVEKAGDNHDTWLFVMAVLLSTTLVWNTTGVLSKDGFDQLHFVANMTEHVRTKIHQREDEVGQDFKRYFPSFVVCVRDFTL----KLEIEGKACDADQYLEH-------CLGIRKKGMTANCRSFNEQRELLSSFFKKRKCFVFPMPTHPEDLHKLETISEQQLNPEFLQTAEDFTTHILQTAHI--KHVDNAVLTGPLFLKLTEQYVNSQRSGDVPCIESALTQVVTLANMQAREDAMSLYEKRMEAVNQQLPLPIAKLNEFHQHALEQAVEAFHQR 370          
BLAST of Atlastin-1-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010770.1 (pep scaffold:Pmarinus_7.0:GL476415:1116328:1128394:1 gene:ENSPMAG00000009749.1 transcript:ENSPMAT00000010770.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 56.225 bits (134), Expect = 1.704e-8
Identity = 42/151 (27.81%), Postives = 70/151 (46.36%), Query Frame = 2
Query:   65 FKLNEDALKEILENEKIRDKSVVVISIAGDMRRGKSFMLNFFLKYLEAEDKNNWLSDPDTPLTGFSWKNGRDCDTTGILIWSEPYLMELEDGEECAVLLMDTQGTFD-KKSTMRKNAMIFALSTMISSMQIFNVNSQLREDNLEFLSVFIN 514
            F++N +   E+       DK +VV++IAG  R GKS++LN      +               +GF+  +     T GI +W  P+     D  +C +LL+DT+G  D  K +   +  +F +S ++SS  + N    L +D+ E L    N
Sbjct:   22 FRVNRETAAEL----SAIDKPLVVVAIAGRYRTGKSYLLNRLAGGGD---------------SGFALGHTVRAHTRGIWVWPLPH---PRDDSKC-LLLLDTEGLGDINKGSCDHDTWLFVMSILLSSTLVLNAMRTLDKDSFELLHFVSN 149          
BLAST of Atlastin-1-like vs. Ensembl Nematostella
Match: EDO43003 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZT7])

HSP 1 Score: 346.665 bits (888), Expect = 3.000e-111
Identity = 188/449 (41.87%), Postives = 281/449 (62.58%), Query Frame = 2
Query:   65 FKLNEDALKEILENEKIRDKSVVVISIAGDMRRGKSFMLNFFLKYLEAEDK-NNWLSDPDTPLTGFSWKNGRDCDTTGILIWSEPYLMELEDGEECAVLLMDTQGTFDKKSTMRKNAMIFALSTMISSMQIFNVNSQLREDNLEFLSVFINYGRLAMERNETIKPFQHLQFLIRDWNSPYLNPYGLEGGKKYLDEFLMYDENDNPQIIGVRKFLHRCFSRIDCCLMPFPGSKVMSSEVFNGKLSDIKKGFVENLRLYVPKMLSADYVVPKAINGCNITCQELLEYFKAYFRIFSSDDIVAPQGIFDGIAEASNMASLNICKRFYNEEMEKICAS--KFLKESKLQKEHERICGAAIDKFNNRKNFGNAEHSVQFRLQLEQEIEECFKIFVEKNSFKNKLDREAWTLFVLVMWYIIGQILRYILTWIGFDTASSWIGWALFVIVLTAISW 1402
            F+L+E AL +IL ++ IRDK V V+S+AG  R+GKSF+L+FFL+YL+ +D  ++WL      L GFSW+ G + DTTGIL+W++PY+ +  DGEE  VLLMDTQG FD  ST++  A IFALSTM SS Q++NV+  ++ED+L+ L +F  YG+LAME NE IKPFQ L FL+RDW+ PY   YG  GG + L+  L   E  + +++ VRK +  CF +I C LMP PG +V ++  F+G+L DI   F ENLR  +P +L+ + +  K ING  +TC+ LLEYFKAY +IF  D++  P+ +    AEA+N+A+L   K  Y++ ME +      +L  ++L+++H     +A+  F+  +  G  E S ++  QL +EI+E F+ FV+ N  KN  +  A T  V     ++  IL  +   IG  + +      +++ +L  + W
Sbjct:   18 FELDEKALSKILLDDSIRDKKVAVVSVAGAFRKGKSFLLDFFLRYLDRKDSCDDWLGGETEALEGFSWRGGSERDTTGILMWNKPYICKRPDGEEVVVLLMDTQGAFDSSSTVKDCATIFALSTMTSSTQVYNVSQNIQEDDLQHLQLFTEYGKLAMENNE-IKPFQRLLFLVRDWSFPYEANYGEAGGSQILERRLKTTERQHSELLQVRKHIKECFEKIGCFLMPHPGLRVATNPTFDGRLVDIDDEFKENLRKLIPSLLAPENLELKGINGEEVTCRGLLEYFKAYMKIFQGDELPQPKSMLLATAEANNLAALATAKDTYSKAMESVVGGDMPYLSPNELERKHLETRDSALSHFHGTRKMGGKEFSEKYVEQLLKEIDETFENFVKLNDSKNIFN-AARTPAVFFTIVVLSYILSSVFNSIGILSFTRMCNLTIWMGLLGILVW 464          
BLAST of Atlastin-1-like vs. Ensembl Nematostella
Match: EDO34670 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNS4])

HSP 1 Score: 61.6178 bits (148), Expect = 7.790e-10
Identity = 68/335 (20.30%), Postives = 135/335 (40.30%), Query Frame = 2
Query:   95 ILENEKIR-----DKSVVVISIAGDMRRGKSFMLNFFLKYLEAEDKNNWLSDPDTPLTGFSWKNGRDCDTTGILIWSEPYLMELEDGEECAVLLMDTQGTFDKKSTMRKNAMIFALSTMISSMQIFNVNSQLREDNLEFLSVFINYGRL-----AMER-------NETIKPFQHLQFLIRDWNSPYLNPYGLEGGKKYLDEFLMYDENDNPQIIGVRKFLHRCFSRIDCCLMPFPGS-KVMSSEVFNGKLSDIKKGFVENLRLYVPKMLSADYVVPKAINGCNITCQELLEYFKAYFRIFSSDDIVAPQGIFDGIAEASNMASLNICKRFYNEEM 1045
            +L  E +R      + +  +++ G    GKSF+LN  +                    GF        +T GI +W +P  ++L+DG+E A++ +DT+G      +   +A +FA++T++SS  I+N    + + ++++L +     +L      M +       N  +  F  L ++++D+     N    E    +L   L     D+ +     K +   F  ++C  + FP + K +  ++   +  D+ + + E     + KM  +  +  K  NG  IT  EL    +      +   +      ++   E     +   C  FY  EM
Sbjct:  102 VLHKENLRLLQLIQEPIATVAVVGKFHTGKSFLLNQLM----------------GKQAGFGVGPFVRPETMGIWMWGKPLKIKLQDGQEVALVFLDTEGFAATNVSESYDAKVFAVATLLSSYLIYNSVKIIDQGDIDYLELLSRRTQLFALKSQMSKAKWNNDFNHDLLKFPPLLWVVQDFVQLTENN---EDPTSWLHRLLASPAKDSEEHAISLKAI---FPSVECHTLFFPATKKAILQDLSKAREEDLTEEYREERDELLEKMRRS--IRHKGKNGSPITGPELASLLEILVEAANEGSLAQIPSRWNTFLEKLERTANEDCLEFYEGEM 412          
BLAST of Atlastin-1-like vs. Ensembl Medaka
Match: atl1 (atlastin GTPase 1 [Source:NCBI gene;Acc:101159304])

HSP 1 Score: 378.637 bits (971), Expect = 1.692e-122
Identity = 201/481 (41.79%), Postives = 303/481 (62.99%), Query Frame = 2
Query:   53 NKDNFKLNEDALKEILENEKIRDKSVVVISIAGDMRRGKSFMLNFFLKYLEAEDKNNWLSDPDTPLTGFSWKNGRDCDTTGILIWSEPYLMELEDGEECAVLLMDTQGTFDKKSTMRKNAMIFALSTMISSMQIFNVNSQLREDNLEFLSVFINYGRLAMERNETIKPFQHLQFLIRDWNSPYLNPYGLEGGKKYLDEFLMYDENDNPQIIGVRKFLHRCFSRIDCCLMPFPGSKVMSSEVFNGKLSDIKKGFVENLRLYVPKMLSADYVVPKAINGCNITCQELLEYFKAYFRIFSSDDIVAPQGIFDGIAEASNMASLNICKRFYNEEMEKICAS--KFLKESKLQKEHERICGAAIDKFNNRKNFGNAEHSVQFRLQLEQEIEECFKIFVEKNSFKN--KLDREAWTLFVL--VMWYIIGQILRYILTWIGFDTASSWIGWALFVIVLTAISWG-VAYCTD-SQIKEYIDEVINASWE 1471
            +   F+L+E AL  IL  E+++D+ VV IS+AG  R+GKSF+++F L+++      NW+ D D PLTGFSW+ G + +TTGI IWSE +L++  DG + AVLLMDTQGTFD +ST+R +A +FALSTMISSMQ++N++  ++ED+L+ L +F  YGRLAME    +KPFQ + FL+RDW+ PY  PYGLEGG K+L++ L   EN + ++  VRK +H CF+ I C LMP PG KV ++  F+G++ +I   F+ NL++ VP +LS   +  K ING  ITC+ LLEYFKAY +I+  +++  P+ +    AEA+N+A++   +  YN++ME++C     F+  S+LQ  H  +   A+  F   K  G  + S ++  QLE EI+E F  +++ N  KN     R   TLFV+  VM+   G     I  ++G D  +S     L + ++T  +W  + Y  +  ++   ID+V  A W+
Sbjct:   43 DDHTFELDEAALSRILLAEEVQDREVVAISVAGAFRKGKSFLMDFMLRFMYNHTTENWVGDSDEPLTGFSWRGGSERETTGIQIWSEVFLVDKPDGRKVAVLLMDTQGTFDSQSTLRDSATVFALSTMISSMQVYNISQNVQEDDLQHLQLFTEYGRLAMEET-FLKPFQSMIFLVRDWSFPYEFPYGLEGGTKFLEKRLKISENQHEELQNVRKHIHSCFTNISCFLMPHPGLKVATNPHFDGRMKEIDGEFINNLKVLVPWLLSPGNIDVKEINGSRITCRGLLEYFKAYIKIYQGEELPHPKSMLQATAEANNLAAVAAAQDLYNKKMEQVCGGDRPFMAPSELQARHGGVREEALQLFRGVKKMGGEDFSRRYLQQLEGEIDEVFVQYIKHNDSKNIFHAARTPATLFVVIFVMYVAAG-----ITGFVGVDIIASLCNMILGLALITLCTWAYIRYSGEYRELGAVIDQVAGALWD 517          
BLAST of Atlastin-1-like vs. Ensembl Medaka
Match: atl2 (atlastin-2 [Source:NCBI gene;Acc:101156948])

HSP 1 Score: 374.4 bits (960), Expect = 4.154e-120
Identity = 192/502 (38.25%), Postives = 311/502 (61.95%), Query Frame = 2
Query:   62 NFKLNEDALKEILENEKIRDKSVVVISIAGDMRRGKSFMLNFFLKYLEAEDKNNWLSDPDTPLTGFSWKNGRDCDTTGILIWSEPYLMELEDGEECAVLLMDTQGTFDKKSTMRKNAMIFALSTMISSMQIFNVNSQLREDNLEFLSVFINYGRLAMERNETIKPFQHLQFLIRDWNSPYLNPYGLEGGKKYLDEFLMYDENDNPQIIGVRKFLHRCFSRIDCCLMPFPGSKVMSSEVFNGKLSDIKKGFVENLRLYVPKMLSADYVVPKAINGCNITCQELLEYFKAYFRIFSSDDIVAPQGIFDGIAEASNMASLNICKRFYNEEMEKICAS--KFLKESKLQKEHERICGAAIDKFNNRKNFGNAEHSVQFRLQLEQEIEECFKIFVEKNSFKNKL--DREAWTLF-VLVMWYIIGQILRYILTWIGFDTASSWIGWALFVIVLTAISWG-VAYCTD-SQIKEYIDEVINASWESCLRPAYRYVAQRLVSQLAQNSLRA 1546
            +F+L+  AL++IL  + ++D +VVV+S+AG  R+GKSF+L+F L+Y+ ++    W+   D PLTGF W+ G + +TTGI +WS+ ++++  DG + AVLL+DTQG FD +ST++  A +FALSTM SS+Q++N++  ++ED+L+ L +F  YGRLAME     KPFQ L FLIRDW+ PY + YGLEGGK +L++ L   +N + ++  VRK +H CFS+I+C L+P PG KV ++  F+G+L DI + F + L   VP +LS +++V K I G  +TC++LLEYFKAY +I+  +++  P+ +    AEA+N+ ++   K  Y++ ME+IC     ++  + L++ HE     +I  F + K  G  E   +++ QLE E++E +  F + N  KN     R   TLF V+ + Y++  +  +    IG  T ++     + V +L+  +W  V Y  +  ++   ID+V    WE  L+P   +  +  V Q   NS++A
Sbjct:  100 SFELDAAALEKILLQDHVKDLNVVVVSVAGAFRKGKSFLLDFMLRYMHSQSNECWMGGDDDPLTGFIWRGGCERETTGIQVWSDVFVVDKPDGTKVAVLLVDTQGAFDSQSTIKDCATVFALSTMTSSVQVYNLSQNVQEDDLQHLQLFTEYGRLAMEEI-YFKPFQSLMFLIRDWSYPYEHEYGLEGGKAFLEKRLQVKQNQHEELQNVRKHIHSCFSKIECFLLPHPGLKVSTNPKFDGRLRDIDEDFKKELAKLVPLLLSPEHLVEKEIGGNKVTCRDLLEYFKAYIKIYQGEELPHPKSMLQATAEANNLTAVAGAKDMYSKSMEQICGGDKPYIAPADLERCHEEFRQHSIHFFRSVKKMGGEEFCQRYQNQLESELDETYSSFTKHNDGKNLFYAARTPATLFAVMFVTYVVSGVTGF----IGLSTFATLANLVMGVALLSLCAWAYVKYSGEFRELGLLIDQVAETLWEQVLKPLTEHYMEDNVRQTVVNSIKA 596          
BLAST of Atlastin-1-like vs. Ensembl Medaka
Match: atl2 (atlastin-2 [Source:NCBI gene;Acc:101156948])

HSP 1 Score: 374.785 bits (961), Expect = 6.915e-120
Identity = 192/504 (38.10%), Postives = 312/504 (61.90%), Query Frame = 2
Query:   56 KDNFKLNEDALKEILENEKIRDKSVVVISIAGDMRRGKSFMLNFFLKYLEAEDKNNWLSDPDTPLTGFSWKNGRDCDTTGILIWSEPYLMELEDGEECAVLLMDTQGTFDKKSTMRKNAMIFALSTMISSMQIFNVNSQLREDNLEFLSVFINYGRLAMERNETIKPFQHLQFLIRDWNSPYLNPYGLEGGKKYLDEFLMYDENDNPQIIGVRKFLHRCFSRIDCCLMPFPGSKVMSSEVFNGKLSDIKKGFVENLRLYVPKMLSADYVVPKAINGCNITCQELLEYFKAYFRIFSSDDIVAPQGIFDGIAEASNMASLNICKRFYNEEMEKICAS--KFLKESKLQKEHERICGAAIDKFNNRKNFGNAEHSVQFRLQLEQEIEECFKIFVEKNSFKNKL--DREAWTLF-VLVMWYIIGQILRYILTWIGFDTASSWIGWALFVIVLTAISWG-VAYCTD-SQIKEYIDEVINASWESCLRPAYRYVAQRLVSQLAQNSLRA 1546
            + +F+L+  AL++IL  + ++D +VVV+S+AG  R+GKSF+L+F L+Y+ ++    W+   D PLTGF W+ G + +TTGI +WS+ ++++  DG + AVLL+DTQG FD +ST++  A +FALSTM SS+Q++N++  ++ED+L+ L +F  YGRLAME     KPFQ L FLIRDW+ PY + YGLEGGK +L++ L   +N + ++  VRK +H CFS+I+C L+P PG KV ++  F+G+L DI + F + L   VP +LS +++V K I G  +TC++LLEYFKAY +I+  +++  P+ +    AEA+N+ ++   K  Y++ ME+IC     ++  + L++ HE     +I  F + K  G  E   +++ QLE E++E +  F + N  KN     R   TLF V+ + Y++  +  +    IG  T ++     + V +L+  +W  V Y  +  ++   ID+V    WE  L+P   +  +  V Q   NS++A
Sbjct:  135 EHSFELDAAALEKILLQDHVKDLNVVVVSVAGAFRKGKSFLLDFMLRYMHSQSNECWMGGDDDPLTGFIWRGGCERETTGIQVWSDVFVVDKPDGTKVAVLLVDTQGAFDSQSTIKDCATVFALSTMTSSVQVYNLSQNVQEDDLQHLQLFTEYGRLAMEEI-YFKPFQSLMFLIRDWSYPYEHEYGLEGGKAFLEKRLQVKQNQHEELQNVRKHIHSCFSKIECFLLPHPGLKVSTNPKFDGRLRDIDEDFKKELAKLVPLLLSPEHLVEKEIGGNKVTCRDLLEYFKAYIKIYQGEELPHPKSMLQATAEANNLTAVAGAKDMYSKSMEQICGGDKPYIAPADLERCHEEFRQHSIHFFRSVKKMGGEEFCQRYQNQLESELDETYSSFTKHNDGKNLFYAARTPATLFAVMFVTYVVSGVTGF----IGLSTFATLANLVMGVALLSLCAWAYVKYSGEFRELGLLIDQVAETLWEQVLKPLTEHYMEDNVRQTVVNSIKA 633          
BLAST of Atlastin-1-like vs. Ensembl Medaka
Match: atl3 (atlastin-3 [Source:NCBI gene;Acc:101173476])

HSP 1 Score: 354.369 bits (908), Expect = 2.390e-113
Identity = 188/462 (40.69%), Postives = 291/462 (62.99%), Query Frame = 2
Query:   41 IID*NKDN--FKLNEDALKEILENEKIRDKSVVVISIAGDMRRGKSFMLNFFLKYLEAEDKNNWLSDPDTPLTGFSWKNGRDCDTTGILIWSEPYLMELEDGEECAVLLMDTQGTFDKKSTMRKNAMIFALSTMISSMQIFNVNSQLREDNLEFLSVFINYGRLAMERNETIKPFQHLQFLIRDWNSPYLNPYGLEGGKKYLDEFLMYDENDNPQIIGVRKFLHRCFSRIDCCLMPFPGSKVMSSEVFNGKLSDIKKGFVENLRLYVPKMLSADYVVPKAINGCNITCQELLEYFKAYFRIFSSDDIVAPQGIFDGIAEASNMASLNICKRFYNEEMEKICAS--KFLKESKLQKEHERICGAAIDKFNNRKNFGNAEHSVQFRLQLEQEIEECFKIFVEKNSFKNKLD--REAWTLFVLV-MWYIIGQILRYILTWIGFDTASSWIGWALFVIVLTAISWG 1405
            II  +KD+  F+LN +AL +IL   ++RDK VVV+S+AG  R+GKSF+L+F ++Y+  ++  NWL   D PLTGFSW+ G + +TTGI +WSE ++++  DG E AV+LMDTQG FD +ST+R  A IFALSTM SS+QI+N++  ++ED+L+ L +F  YGRLA++     KPFQ L FL+RDW+ PY   YG +GG  +LD+ L   E  + ++  VR+ +H CF+ I C L+P PG KV +S  F G+L D+   F E L+  +PK+L  D++  K ING  +TC+ LLE+FKAY +I+  +D+  P+ +    AEA+N+A++   K  Y + MEK+C     ++    L+++H      AI  F++ K  G  E   +++ QL++E+EE ++   + N  KN     R    LFVLV + Y    +L  +L ++G  T +    ++L +I++  ++W 
Sbjct:   41 IITVSKDDHSFELNTEALSQILLAPEVRDKHVVVLSVAGAFRKGKSFLLDFMIRYMHRKEDKNWLGRDDEPLTGFSWRGGSEPETTGIQLWSEVFVVQKSDGTEVAVVLMDTQGAFDDQSTVRDCATIFALSTMTSSIQIYNLSQNVQEDDLQQLQLFTEYGRLALDEIFQ-KPFQSLMFLVRDWSFPYEYKYGFKGGNDFLDKRLQVKETQHEELQTVREHIHSCFTNISCFLLPHPGLKVATSPAFKGQLCDVSPEFKEQLQSLIPKLLHPDWLTEKEINGNKVTCRGLLEFFKAYIKIYQGEDLPQPKTMLMATAEANNLAAVAAAKDQYQKNMEKVCGGDLPYVAPESLREKHSFFFKEAIHAFSSTKKMGGQEFCDRYQAQLQKELEEMWQSLSKHNESKNIFSAFRTPAVLFVLVCLLY----VLSGVLLFVGLSTFALACDYSLGLIMIAMLTWA 497          
BLAST of Atlastin-1-like vs. Ensembl Medaka
Match: ENSORLT00000001294.2 (atlastin GTPase 2 [Source:NCBI gene;Acc:101169833])

HSP 1 Score: 349.362 bits (895), Expect = 4.978e-111
Identity = 181/493 (36.71%), Postives = 291/493 (59.03%), Query Frame = 2
Query:   56 KDNFKLNEDALKEILENEKIRDKSVVVISIAGDMRRGKSFMLNFFLKYLEAEDKNNWLSDPDTPLTGFSWKNGRDCDTTGILIWSEPYLMELEDGEECAVLLMDTQGTFDKKSTMRKNAMIFALSTMISSMQIFNVNSQLREDNLEFLSVFINYGRLAMERNETIKPFQHLQFLIRDWNSPYLNPYGLEGGKKYLDEFLMYDENDNPQIIGVRKFLHRCFSRIDCCLMPFPGSKVMSSEVFNGKLSDIKKGFVENLRLYVPKMLSADYVVPKAINGCNITCQELLEYFKAYFRIFSSDDIVAPQGIFDGIAEASNMASLNICKRFYNEEMEKICAS--KFLKESKLQKEHERICGAAIDKFNNRKNFGNAEHSVQFRLQLEQEIEECFKIFVEKNSFKNKL--DREAWTLF-VLVMWYIIGQILRYILTWIGFDTASSWIGWALFVIVLTAISWG-VAYCTD-SQIKEYIDEVINASWESCLRPAYRYVAQRL 1513
            + +F L E AL+++L  ++++D  VVV+S+AG  R+GKSF+L+F L+Y+  + ++ W+   + PLTGF+W+ G + +TTGIL WSE +++E  DG++ AVLL+DTQG FD +ST++  A +FALSTM SS+Q++N++  ++ED+L+ L +F  YGRLAME     KPFQ L FLIRDW  PY + YGLEGG+ +L++ L   +N + ++  VRK +H CFS I C L+P PG KV ++  F+G+L DI   F   L+  +P +LS + +V K I G  ITC++LL YFKAY +I+  +++  P+ +    AEA+N+A++   K  YN+ ME+IC     ++  ++L++ H  +   ++  F + K  G  +   +++ QLE E+ E +  F + N  KN     R    LF V+ + Y++      +  ++G    +      + V +     W  V Y      +   ID V    WE      +     R+
Sbjct:   67 EHSFSLQEAALEQLLLQKEVQDLHVVVVSVAGAFRKGKSFLLDFMLRYMYKKSEDWWIGGENDPLTGFTWRGGCERETTGILAWSEVFVVEKPDGQKVAVLLIDTQGAFDSQSTIKDCATLFALSTMTSSVQVYNLSQNVQEDDLQHLQLFTEYGRLAMEEVYE-KPFQTLMFLIRDWCYPYEHQYGLEGGQSFLEKRLQVKQNQHEELQNVRKHIHSCFSNISCFLLPHPGLKVATNPHFDGRLRDIDDEFKRALQDLIPTLLSPENLVEKEIGGVKITCRDLLHYFKAYMKIYQGEELPHPKSMLQATAEANNLAAVAGAKDLYNKSMEQICGGDKPYISPAELERRHTELLQTSVRHFRSVKKMGGEDFCRRYQEQLEAELNESYTNFTKHNDGKNIFFAARTPAMLFAVMFVMYVVS----LVTGFVGISYVAVLCNLVMGVALTALCIWAYVKYSGKFRDVGRVIDIVAETLWEQVFSKLFEVARSRI 554          
BLAST of Atlastin-1-like vs. Planmine SMEST
Match: SMESG000048488.1 (SMESG000048488.1)

HSP 1 Score: 1033.09 bits (2670), Expect = 0.000e+0
Identity = 499/499 (100.00%), Postives = 499/499 (100.00%), Query Frame = 2
Query:   56 KDNFKLNEDALKEILENEKIRDKSVVVISIAGDMRRGKSFMLNFFLKYLEAEDKNNWLSDPDTPLTGFSWKNGRDCDTTGILIWSEPYLMELEDGEECAVLLMDTQGTFDKKSTMRKNAMIFALSTMISSMQIFNVNSQLREDNLEFLSVFINYGRLAMERNETIKPFQHLQFLIRDWNSPYLNPYGLEGGKKYLDEFLMYDENDNPQIIGVRKFLHRCFSRIDCCLMPFPGSKVMSSEVFNGKLSDIKKGFVENLRLYVPKMLSADYVVPKAINGCNITCQELLEYFKAYFRIFSSDDIVAPQGIFDGIAEASNMASLNICKRFYNEEMEKICASKFLKESKLQKEHERICGAAIDKFNNRKNFGNAEHSVQFRLQLEQEIEECFKIFVEKNSFKNKLDREAWTLFVLVMWYIIGQILRYILTWIGFDTASSWIGWALFVIVLTAISWGVAYCTDSQIKEYIDEVINASWESCLRPAYRYVAQRLVSQLAQNSLRAIQ 1552
            KDNFKLNEDALKEILENEKIRDKSVVVISIAGDMRRGKSFMLNFFLKYLEAEDKNNWLSDPDTPLTGFSWKNGRDCDTTGILIWSEPYLMELEDGEECAVLLMDTQGTFDKKSTMRKNAMIFALSTMISSMQIFNVNSQLREDNLEFLSVFINYGRLAMERNETIKPFQHLQFLIRDWNSPYLNPYGLEGGKKYLDEFLMYDENDNPQIIGVRKFLHRCFSRIDCCLMPFPGSKVMSSEVFNGKLSDIKKGFVENLRLYVPKMLSADYVVPKAINGCNITCQELLEYFKAYFRIFSSDDIVAPQGIFDGIAEASNMASLNICKRFYNEEMEKICASKFLKESKLQKEHERICGAAIDKFNNRKNFGNAEHSVQFRLQLEQEIEECFKIFVEKNSFKNKLDREAWTLFVLVMWYIIGQILRYILTWIGFDTASSWIGWALFVIVLTAISWGVAYCTDSQIKEYIDEVINASWESCLRPAYRYVAQRLVSQLAQNSLRAIQ
Sbjct:   14 KDNFKLNEDALKEILENEKIRDKSVVVISIAGDMRRGKSFMLNFFLKYLEAEDKNNWLSDPDTPLTGFSWKNGRDCDTTGILIWSEPYLMELEDGEECAVLLMDTQGTFDKKSTMRKNAMIFALSTMISSMQIFNVNSQLREDNLEFLSVFINYGRLAMERNETIKPFQHLQFLIRDWNSPYLNPYGLEGGKKYLDEFLMYDENDNPQIIGVRKFLHRCFSRIDCCLMPFPGSKVMSSEVFNGKLSDIKKGFVENLRLYVPKMLSADYVVPKAINGCNITCQELLEYFKAYFRIFSSDDIVAPQGIFDGIAEASNMASLNICKRFYNEEMEKICASKFLKESKLQKEHERICGAAIDKFNNRKNFGNAEHSVQFRLQLEQEIEECFKIFVEKNSFKNKLDREAWTLFVLVMWYIIGQILRYILTWIGFDTASSWIGWALFVIVLTAISWGVAYCTDSQIKEYIDEVINASWESCLRPAYRYVAQRLVSQLAQNSLRAIQ 512          
BLAST of Atlastin-1-like vs. Planmine SMEST
Match: SMESG000061982.1 (SMESG000061982.1)

HSP 1 Score: 196.052 bits (497), Expect = 2.284e-54
Identity = 126/441 (28.57%), Postives = 236/441 (53.51%), Query Frame = 2
Query:   68 KLNEDALKEILENEKIRDKSVVVISIAGDMRRGKSFMLNFFLKYLEAEDKNNWLSDPDTPLTGFSWKNGRDCDTTGILIWSEPYLMELEDGEECAVLLMDTQGTFDKKSTMRKNAMIFALSTMISSMQIFNVNSQLREDNLEFLSVFINYGRLAMERNE------TIKPFQHLQFLIRDWNSPYLNPYGLEGGKKYLDEFLMYDENDNP-QIIGVRKFLHRCFSRIDCCLMPFPGSKVMSSEVFNGKLSDIKKGFVENLRLYVPKMLSADYVVPKAINGCNITCQELLEYFKAYFRIFSSDDIVAPQGIFDGIAEASNMASLNICKRFYNEEME-KICASKFLKESKLQKEHERICGAAIDKFNNRKNFGNAEHSVQFRLQLEQEIEECFKIFVEKNSFKNKLDREAWTLFVLVMWY--IIGQILRYILTWIGFDTASSWI 1360
            KL+   L+++  + ++ +  ++++SI G  R GKSF +N  ++YL+ +   + +++ ++ ++GF WK   D     + +WSEPY++E+    + A+LL+D +G  + K   +++   +AL  ++SS+ I+N+ S++ E +L+ LS+ ++Y  ++ + ++      T KP+Q L  LIRDW  PY   YG  GG++YL+ FL   +   P Q I +R FL+  ++ I+C LMP    +  S+  F+GK  ++   F E++  ++    S   +  K + G  +   ++L Y +  F   +S +   PQ  FD  A   +  + + C ++Y++ M+ ++  S+   E  L   H+R    A+ KF++    G  ++S  FR +LE  I+E F  F   NS +        +L VL + +  IIG + R I  +I  +  S +I
Sbjct:   38 KLSIKNLRKVFLDPRVANNKLMILSIDGPRRTGKSFFMNICIQYLQKQRVESLIANQES-ISGFPWKTSMDDRGFAVYLWSEPYIIEMSPKSKVAILLIDCEGFLNNKLLAKESYAAYALIQVMSSLHIYNILSEINESHLQSLSLKLDYSNISRDPDKNTFDFITNKPYQSLCILIRDWPYPYEFFYGAAGGQQYLNRFLSTQQKALPEQNIVLRHFLNSQYNNINCFLMPHLQIEASSTNSFDGKWDELSNEFQEHILGFMKSTFSIQNISIKEVGGQTLVGTDMLAYIEDCFSSTTSAENPVPQTCFDACALEHHYITYDKCIKYYDDSMKLRLINSQSAVE--LLAFHDRCKIIALQKFDDASKLGERKYSETFRTKLESNIDEDFIRFYAMNSTRPVAVTHLLSLIVLSVIFLSIIGLVGR-ICVYIKMEYLSIYI 474          
BLAST of Atlastin-1-like vs. Planmine SMEST
Match: SMESG000081995.1 (SMESG000081995.1)

HSP 1 Score: 177.178 bits (448), Expect = 8.092e-48
Identity = 122/448 (27.23%), Postives = 211/448 (47.10%), Query Frame = 2
Query:   65 FKLNEDALKEILENEKIRDKSVVVISIAGDMRRGKSFMLNFFLKYLEAEDKNNWLSDPDTPLTGFSWKNGRDCDTTGILIWSEPYLMELEDGEECAVLLMDTQGTFDKKSTMRKNAMIFALSTMISSMQIFNVNSQLREDNLEFLSVFINYGRLAMERNETIKPFQHLQFLIRDWNSPYLNPYGLEGGKKYLDEFLMYDENDNPQIIGV-----------------------RKFLHRCFSRIDCCLMPFPGSKVMSSEVFNGKLSDIKKGFVENLRLYVPKMLSADYVVPKAINGCNITCQELLEYFKAYFRIFSSDDIVAPQGIFDGIAEASNMASLNICKRFYNEEMEKICASK--FLKESKLQKEHERICGAAIDKFNNRKNFGNAEHSVQFRLQLEQEIEECFKIFVEKNSFKNKLDREAWTLFVLVMWYIIGQILRYILTWI 1333
            F  N  +L+E+L +  I  K + VISI G  R+GKSF+LN  L+Y  ++  +NWLS+ D PL GFSW  G + +T GI++W+EP+L ++ D EE  +L++D QG F+K S++ +   + A S ++SS  + N+      D                                 DW  P   PYGL GG +Y+   +      +P++  V                       +++    FS + C L+P PG KV  +  F+G++ DI   F+E+++  +  +LS D +  K ING  +TC+E  +YFK+   I  +++    Q I    A  + +  +   K  Y   M+KI AS+  ++ + KL  EH ++      +    + F  ++        L++ +      +   N+ KN L+   +T + L++   I  +L +++  I
Sbjct:   34 FVYNVQSLEELLCDPSISTKHLSVISIIGPGRKGKSFLLNILLRYFFSKCNSNWLSNLDQPLDGFSWNCGINSNTVGIVMWNEPFLTKI-DSEERVLLILDVQGIFNKFSSLNECTKLSAFSLLMSSHLLVNIPEVWSLD--------------------------------LDWTFPNEFPYGLHGGDQYMKYSM--KTGSSPKVSKVPSQISYVSKDNTSRSANIDNAYFKQYYKNIFSSLQCFLLPHPGLKVSMNSNFDGRMRDINPLFLEHVKTLITSILSPDNLQLKKINGHYLTCKEYFQYFKSLIHIMETENFPQIQNIMTENASFNQLEFIENMKYLYITSMDKIIASEESYVDDEKLDAEHIKLLKIIQSELATARMFNKSKTVESTSNILDKTLYSILLKYKSDNNNKN-LNMSIFTPYSLIIVLTISYLLYHLMNII 445          
BLAST of Atlastin-1-like vs. Planmine SMEST
Match: SMESG000081995.1 (SMESG000081995.1)

HSP 1 Score: 177.178 bits (448), Expect = 1.560e-47
Identity = 122/448 (27.23%), Postives = 211/448 (47.10%), Query Frame = 2
Query:   65 FKLNEDALKEILENEKIRDKSVVVISIAGDMRRGKSFMLNFFLKYLEAEDKNNWLSDPDTPLTGFSWKNGRDCDTTGILIWSEPYLMELEDGEECAVLLMDTQGTFDKKSTMRKNAMIFALSTMISSMQIFNVNSQLREDNLEFLSVFINYGRLAMERNETIKPFQHLQFLIRDWNSPYLNPYGLEGGKKYLDEFLMYDENDNPQIIGV-----------------------RKFLHRCFSRIDCCLMPFPGSKVMSSEVFNGKLSDIKKGFVENLRLYVPKMLSADYVVPKAINGCNITCQELLEYFKAYFRIFSSDDIVAPQGIFDGIAEASNMASLNICKRFYNEEMEKICASK--FLKESKLQKEHERICGAAIDKFNNRKNFGNAEHSVQFRLQLEQEIEECFKIFVEKNSFKNKLDREAWTLFVLVMWYIIGQILRYILTWI 1333
            F  N  +L+E+L +  I  K + VISI G  R+GKSF+LN  L+Y  ++  +NWLS+ D PL GFSW  G + +T GI++W+EP+L ++ D EE  +L++D QG F+K S++ +   + A S ++SS  + N+      D                                 DW  P   PYGL GG +Y+   +      +P++  V                       +++    FS + C L+P PG KV  +  F+G++ DI   F+E+++  +  +LS D +  K ING  +TC+E  +YFK+   I  +++    Q I    A  + +  +   K  Y   M+KI AS+  ++ + KL  EH ++      +    + F  ++        L++ +      +   N+ KN L+   +T + L++   I  +L +++  I
Sbjct:   34 FVYNVQSLEELLCDPSISTKHLSVISIIGPGRKGKSFLLNILLRYFFSKCNSNWLSNLDQPLDGFSWNCGINSNTVGIVMWNEPFLTKI-DSEERVLLILDVQGIFNKFSSLNECTKLSAFSLLMSSHLLVNIPEVWSLD--------------------------------LDWTFPNEFPYGLHGGDQYMKYSM--KTGSSPKVSKVPSQISYVSKDNTSRSANIDNAYFKQYYKNIFSSLQCFLLPHPGLKVSMNSNFDGRMRDINPLFLEHVKTLITSILSPDNLQLKKINGHYLTCKEYFQYFKSLIHIMETENFPQIQNIMTENASFNQLEFIENMKYLYITSMDKIIASEESYVDDEKLDAEHIKLLKIIQSELATARMFNKSKTVESTSNILDKTLYSILLKYKSDNNNKN-LNMSIFTPYSLIIVLTISYLLYHLMNII 445          
BLAST of Atlastin-1-like vs. Planmine SMEST
Match: SMESG000081995.1 (SMESG000081995.1)

HSP 1 Score: 176.792 bits (447), Expect = 9.453e-47
Identity = 122/448 (27.23%), Postives = 211/448 (47.10%), Query Frame = 2
Query:   65 FKLNEDALKEILENEKIRDKSVVVISIAGDMRRGKSFMLNFFLKYLEAEDKNNWLSDPDTPLTGFSWKNGRDCDTTGILIWSEPYLMELEDGEECAVLLMDTQGTFDKKSTMRKNAMIFALSTMISSMQIFNVNSQLREDNLEFLSVFINYGRLAMERNETIKPFQHLQFLIRDWNSPYLNPYGLEGGKKYLDEFLMYDENDNPQIIGV-----------------------RKFLHRCFSRIDCCLMPFPGSKVMSSEVFNGKLSDIKKGFVENLRLYVPKMLSADYVVPKAINGCNITCQELLEYFKAYFRIFSSDDIVAPQGIFDGIAEASNMASLNICKRFYNEEMEKICASK--FLKESKLQKEHERICGAAIDKFNNRKNFGNAEHSVQFRLQLEQEIEECFKIFVEKNSFKNKLDREAWTLFVLVMWYIIGQILRYILTWI 1333
            F  N  +L+E+L +  I  K + VISI G  R+GKSF+LN  L+Y  ++  +NWLS+ D PL GFSW  G + +T GI++W+EP+L ++ D EE  +L++D QG F+K S++ +   + A S ++SS  + N+      D                                 DW  P   PYGL GG +Y+   +      +P++  V                       +++    FS + C L+P PG KV  +  F+G++ DI   F+E+++  +  +LS D +  K ING  +TC+E  +YFK+   I  +++    Q I    A  + +  +   K  Y   M+KI AS+  ++ + KL  EH ++      +    + F  ++        L++ +      +   N+ KN L+   +T + L++   I  +L +++  I
Sbjct:   34 FVYNVQSLEELLCDPSISTKHLSVISIIGPGRKGKSFLLNILLRYFFSKCNSNWLSNLDQPLDGFSWNCGINSNTVGIVMWNEPFLTKI-DSEERVLLILDVQGIFNKFSSLNECTKLSAFSLLMSSHLLVNIPEVWSLD--------------------------------LDWTFPNEFPYGLHGGDQYMKYSM--KTGSSPKVSKVPSQISYVSKDNTSRSANIDNAYFKQYYKNIFSSLQCFLLPHPGLKVSMNSNFDGRMRDINPLFLEHVKTLITSILSPDNLQLKKINGHYLTCKEYFQYFKSLIHIMETENFPQIQNIMTENASFNQLEFIENMKYLYITSMDKIIASEESYVDDEKLDAEHIKLLKIIQSELATARMFNKSKTVESTSNILDKTLYSILLKYKSDNNNKN-LNMSIFTPYSLIIVLTISYLLYHLMNII 445          
The following BLAST results are available for this feature:
BLAST of Atlastin-1-like vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ATL11.214e-12440.45atlastin GTPase 1 [Source:HGNC Symbol;Acc:HGNC:112... [more]
ATL13.535e-12340.76atlastin GTPase 1 [Source:HGNC Symbol;Acc:HGNC:112... [more]
ATL21.724e-12138.65atlastin GTPase 2 [Source:HGNC Symbol;Acc:HGNC:240... [more]
ATL21.861e-12138.65atlastin GTPase 2 [Source:HGNC Symbol;Acc:HGNC:240... [more]
ATL21.357e-11938.12atlastin GTPase 2 [Source:HGNC Symbol;Acc:HGNC:240... [more]
back to top
BLAST of Atlastin-1-like vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atln-17.587e-12239.01ATLastiN (Endoplasmic reticulum GTPase) related [... [more]
atln-13.828e-12040.94ATLastiN (Endoplasmic reticulum GTPase) related [... [more]
atln-24.106e-8038.13ATLastiN (Endoplasmic reticulum GTPase) related [... [more]
atln-22.033e-7938.13ATLastiN (Endoplasmic reticulum GTPase) related [... [more]
atln-22.893e-5235.69ATLastiN (Endoplasmic reticulum GTPase) related [... [more]
back to top
BLAST of Atlastin-1-like vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
atl4.976e-11436.25gene:FBgn0039213 transcript:FBtr0084656[more]
atl4.976e-11436.25gene:FBgn0039213 transcript:FBtr0084657[more]
atl4.976e-11436.25gene:FBgn0039213 transcript:FBtr0345218[more]
back to top
BLAST of Atlastin-1-like vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atl11.898e-12942.54atlastin GTPase 1 [Source:ZFIN;Acc:ZDB-GENE-030131... [more]
atl15.935e-12842.89atlastin GTPase 1 [Source:ZFIN;Acc:ZDB-GENE-030131... [more]
atl28.180e-11837.60atlastin GTPase 2 [Source:ZFIN;Acc:ZDB-GENE-030131... [more]
atl28.180e-11837.60atlastin GTPase 2 [Source:ZFIN;Acc:ZDB-GENE-030131... [more]
atl28.180e-11837.60atlastin GTPase 2 [Source:ZFIN;Acc:ZDB-GENE-030131... [more]
back to top
BLAST of Atlastin-1-like vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atl11.014e-12841.27atlastin GTPase 1 [Source:NCBI gene;Acc:779669][more]
atl12.842e-12741.60atlastin GTPase 1 [Source:NCBI gene;Acc:779669][more]
atl12.979e-12741.42atlastin GTPase 1 [Source:NCBI gene;Acc:779669][more]
atl13.111e-12741.60atlastin GTPase 1 [Source:NCBI gene;Acc:779669][more]
atl13.610e-12741.42atlastin GTPase 1 [Source:NCBI gene;Acc:779669][more]
back to top
BLAST of Atlastin-1-like vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Atl17.619e-12340.55atlastin GTPase 1 [Source:MGI Symbol;Acc:MGI:19212... [more]
Atl26.519e-12238.45atlastin GTPase 2 [Source:MGI Symbol;Acc:MGI:19294... [more]
Atl31.387e-10740.26atlastin GTPase 3 [Source:MGI Symbol;Acc:MGI:19242... [more]
Atl31.685e-10740.26atlastin GTPase 3 [Source:MGI Symbol;Acc:MGI:19242... [more]
Atl27.735e-8536.57atlastin GTPase 2 [Source:MGI Symbol;Acc:MGI:19294... [more]
back to top
BLAST of Atlastin-1-like vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q58D72|ATLA1_BOVIN6.841e-12340.76Atlastin-1 OS=Bos taurus OX=9913 GN=ATL1 PE=2 SV=2[more]
sp|Q60HD2|ATLA1_MACFA1.416e-12240.76Atlastin-1 OS=Macaca fascicularis OX=9541 GN=ATL1 ... [more]
sp|Q5R4P1|ATLA1_PONAB1.698e-12240.76Atlastin-1 OS=Pongo abelii OX=9601 GN=ATL1 PE=2 SV... [more]
sp|Q8WXF7|ATLA1_HUMAN1.698e-12240.76Atlastin-1 OS=Homo sapiens OX=9606 GN=ATL1 PE=1 SV... [more]
sp|Q6PST4|ATLA1_RAT2.290e-12240.97Atlastin-1 OS=Rattus norvegicus OX=10116 GN=Atl1 P... [more]
back to top
BLAST of Atlastin-1-like vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A210PFC78.628e-12940.86Atlastin-2 OS=Mizuhopecten yessoensis OX=6573 GN=K... [more]
B8A6H14.248e-12642.54Atlastin GTPase 1 OS=Danio rerio OX=7955 GN=atl1 P... [more]
A0A5G3HBW91.591e-12541.27GB1/RHD3-type G domain-containing protein OS=Xenop... [more]
A0A3B3SMX31.988e-12543.29Atlastin GTPase 1 OS=Paramormyrops kingsleyae OX=1... [more]
A0A2C9K9763.882e-12538.06GB1/RHD3-type G domain-containing protein OS=Biomp... [more]
back to top
BLAST of Atlastin-1-like vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atl15.622e-12442.68atlastin GTPase 1 [Source:NCBI gene;Acc:103024846][more]
atl22.320e-11838.58atlastin GTPase 2 [Source:NCBI gene;Acc:103030630][more]
atl17.464e-11641.61atlastin GTPase 1 [Source:NCBI gene;Acc:103024846][more]
atl35.106e-11039.70atlastin-3-like [Source:NCBI gene;Acc:103047852][more]
atl38.658e-11039.70atlastin-3-like [Source:NCBI gene;Acc:103047852][more]
back to top
BLAST of Atlastin-1-like vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
atl21.437e-12140.44atlastin GTPase 2 [Source:ZFIN;Acc:ZDB-GENE-030131... [more]
atl21.576e-12140.66atlastin GTPase 2 [Source:ZFIN;Acc:ZDB-GENE-030131... [more]
GBP64.270e-1020.27guanylate binding protein family member 6 [Source:... [more]
ENSPMAT00000010770.11.704e-827.81pep scaffold:Pmarinus_7.0:GL476415:1116328:1128394... [more]
back to top
BLAST of Atlastin-1-like vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Atlastin-1-like vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO430033.000e-11141.87Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO346707.790e-1020.30Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Atlastin-1-like vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atl11.692e-12241.79atlastin GTPase 1 [Source:NCBI gene;Acc:101159304][more]
atl24.154e-12038.25atlastin-2 [Source:NCBI gene;Acc:101156948][more]
atl26.915e-12038.10atlastin-2 [Source:NCBI gene;Acc:101156948][more]
atl32.390e-11340.69atlastin-3 [Source:NCBI gene;Acc:101173476][more]
ENSORLT00000001294.24.978e-11136.71atlastin GTPase 2 [Source:NCBI gene;Acc:101169833][more]
back to top
BLAST of Atlastin-1-like vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000048488.10.000e+0100.00SMESG000048488.1[more]
SMESG000061982.12.284e-5428.57SMESG000061982.1[more]
SMESG000081995.18.092e-4827.23SMESG000081995.1[more]
SMESG000081995.11.560e-4727.23SMESG000081995.1[more]
SMESG000081995.19.453e-4727.23SMESG000081995.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028046 ID=SMED30028046|Name=Atlastin-1-like|organism=Schmidtea mediterranea sexual|type=transcript|length=2236bp
CTCTTCCGATCTCAAATATGGAAAAAGGATATCCTATTCAATTATTGACT
GAAACAAAGATAATTTCAAATTAAATGAAGATGCTTTGAAAGAAATTTTA
GAAAATGAAAAAATTAGGGATAAGTCTGTTGTTGTTATTTCTATTGCAGG
TGATATGCGTAGGGGCAAATCGTTTATGCTGAATTTTTTTCTCAAATACT
TAGAAGCTGAAGATAAAAATAATTGGTTAAGTGATCCAGATACTCCTTTA
ACGGGGTTTAGTTGGAAAAATGGTAGAGATTGTGATACAACTGGTATATT
AATATGGAGTGAACCATATCTTATGGAACTGGAAGATGGTGAAGAGTGTG
CAGTTTTATTAATGGACACTCAAGGTACATTTGATAAAAAATCAACAATG
AGAAAGAACGCAATGATATTTGCATTAAGTACTATGATAAGTTCAATGCA
AATATTCAACGTAAATTCACAACTCCGAGAAGATAATTTAGAATTTCTAA
GTGTATTTATTAATTATGGTAGATTGGCAATGGAAAGAAATGAAACAATT
AAACCTTTCCAGCATTTGCAATTTTTAATTCGCGACTGGAATAGTCCGTA
TTTGAATCCATATGGATTGGAAGGAGGAAAGAAATATTTAGACGAGTTTT
TGATGTACGACGAAAATGACAATCCTCAAATAATCGGAGTACGGAAATTC
CTTCATCGGTGCTTTTCAAGAATCGATTGTTGTTTAATGCCTTTCCCCGG
ATCTAAAGTGATGTCTAGCGAAGTGTTTAATGGGAAATTGAGTGATATTA
AAAAGGGGTTTGTGGAAAATTTACGTTTATATGTGCCAAAAATGCTGTCA
GCAGATTACGTAGTGCCGAAAGCCATCAACGGTTGCAATATCACTTGCCA
AGAGTTGCTTGAGTATTTCAAAGCATATTTCCGGATTTTCAGCAGTGATG
ATATTGTGGCTCCTCAGGGAATATTCGATGGCATCGCCGAGGCGAGCAAC
ATGGCGTCATTGAACATATGCAAGCGTTTCTACAATGAGGAAATGGAAAA
GATCTGTGCCTCCAAATTTCTCAAGGAAAGTAAGCTGCAGAAAGAGCACG
AACGGATATGTGGTGCCGCTATTGATAAGTTCAACAATAGAAAGAACTTC
GGCAATGCTGAGCATTCCGTACAGTTCCGGTTGCAATTAGAACAGGAAAT
CGAGGAATGCTTCAAAATTTTCGTGGAAAAAAATTCATTCAAGAATAAGC
TCGATCGAGAAGCATGGACACTGTTTGTGCTCGTGATGTGGTACATAATC
GGGCAAATTCTTCGTTACATCTTGACTTGGATTGGATTCGATACCGCGAG
CAGCTGGATTGGTTGGGCGCTGTTTGTCATCGTGCTTACGGCGATATCGT
GGGGCGTCGCATATTGCACTGACAGTCAGATCAAGGAATACATTGATGAG
GTTATCAATGCCAGCTGGGAATCGTGCCTGCGTCCAGCATATCGGTATGT
AGCTCAGCGGTTGGTCAGTCAGCTGGCCCAGAACTCACTGCGCGCAATCC
AGTAACCTGATCGATCATTGCCATAATCGAAGCCGCTATGCTCAATCACA
CAGTTACCAGAACTTGCTGATCAATATCACATATTTGATGCCTTGCTAGA
GTAGTGTAGTTATCATTATCCCGTGGCCCGCGTATTAACAGTCAGAGTCG
AACACTTTATCGATACGGTTTCCTTGGAATTGTTACCACTGTCTTTGAAC
TGGTGCTGCTTTAGAGTTTTTCTATAATTATTCCCCTCTTTTCTAATATT
AGCAACCGCATTGTGGCGGTTCCACAATTCGAGCTTCAATTATTGTTTGC
AATTTGTTATTATTTATTGTTACTATTATTAATATCCAATCAGAATCGAG
TGTAAATTATTATTAACAAATTGATGGAAAAAGAGCTTTATTCACTGAGA
TTTGATTGTGAATAAATACTTTTTGTCTTGGATGTGTGCATGCTTTATTT
TTGTTCGGTTGGGATTTTCTGTTACCAGAATCCATCAATATTTTATTTTA
GGAAATTCGGGAGGATCTATTATGGTACATGTAATTGATGATTGTAAAGA
GAATTTCTATCAATAAATTTTTATTCGATATATTAGTTGGATTGAATTAA
GCTTTTGTGTAGAGAAGGTATTGGTTAGTTACTATGGAAATCAAAGGTTG
TATTATTTCATTTTGAATAATATAATGGGTTTTGCA
back to top

protein sequence of SMED30028046-orf-1

>SMED30028046-orf-1 ID=SMED30028046-orf-1|Name=SMED30028046-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=467bp
MRRGKSFMLNFFLKYLEAEDKNNWLSDPDTPLTGFSWKNGRDCDTTGILI
WSEPYLMELEDGEECAVLLMDTQGTFDKKSTMRKNAMIFALSTMISSMQI
FNVNSQLREDNLEFLSVFINYGRLAMERNETIKPFQHLQFLIRDWNSPYL
NPYGLEGGKKYLDEFLMYDENDNPQIIGVRKFLHRCFSRIDCCLMPFPGS
KVMSSEVFNGKLSDIKKGFVENLRLYVPKMLSADYVVPKAINGCNITCQE
LLEYFKAYFRIFSSDDIVAPQGIFDGIAEASNMASLNICKRFYNEEMEKI
CASKFLKESKLQKEHERICGAAIDKFNNRKNFGNAEHSVQFRLQLEQEIE
ECFKIFVEKNSFKNKLDREAWTLFVLVMWYIIGQILRYILTWIGFDTASS
WIGWALFVIVLTAISWGVAYCTDSQIKEYIDEVINASWESCLRPAYRYVA
QRLVSQLAQNSLRAIQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0003001lateral region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR027417P-loop_NTPase
IPR015894Guanylate-bd_N
IPR030386G_GB1_RHD3_dom
IPR003191Guanylate-bd_C
Vocabulary: molecular function
TermDefinition
GO:0003924GTPase activity
GO:0005525GTP binding
GO:0000166nucleotide binding
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane