HMG box-containing protein 1

Overview
NameHMG box-containing protein 1
Smed IDSMED30028043
Length (bp)1133
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of HMG box-containing protein 1 (SMED30028043) t-SNE clustered cells

Violin plots show distribution of expression levels for HMG box-containing protein 1 (SMED30028043) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of HMG box-containing protein 1 (SMED30028043) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for HMG box-containing protein 1 (SMED30028043) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028043

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
muscle cellSMED30028043SMESG000010590.1 dd_Smed_v4_11388_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30028043SMESG000010590.1 dd_Smed_v4_11388_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30028043SMESG000010590.1 dd_Smed_v4_11388_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior sideSMED30028043SMESG000010590.1 dd_Smed_v4_11388_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
dorsal-ventral muscle cellSMED30028043SMESG000010590.1 dd_Smed_v4_11388_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of HMG box-containing protein 1 vs. Ensembl Human
Match: ATXN1L (ataxin 1 like [Source:HGNC Symbol;Acc:HGNC:33279])

HSP 1 Score: 50.0618 bits (118), Expect = 6.092e-6
Identity = 28/117 (23.93%), Postives = 55/117 (47.01%), Query Frame = 2
Query:  653 MINLQSGVKKRLEEITESDLWHCTKQNDEFTPNWSEVVQISQISEDKKIEITFQTNNKQ--IVYQTDLHRPFFVKNVGWCSLFPGLTQKMYGIQSSLMDIGQTCLTLSRKRKSSNNI 997
            +I L +G  KR+E++   D     + +     + S VV I +      + + F    +Q  +  +     PFFV   GW S  PG T +++ +    + +G  C+++S +  +SN++
Sbjct:  474 IIQLATGELKRVEDLQTQDFVRSAEVSGGLKIDSSTVVDIQESQWPGFVMLHFVVGEQQSKVSIEVPPEHPFFVYGQGWSSCSPGRTTQLFSLPCHRLQVGDVCISISLQSLNSNSV 590          
BLAST of HMG box-containing protein 1 vs. Ensembl Celegans
Match: K04F10.1 (pep chromosome:WBcel235:I:6364886:6366224:1 gene:WBGene00019394.1 transcript:K04F10.1.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:K04F10.1)

HSP 1 Score: 60.4622 bits (145), Expect = 3.992e-10
Identity = 30/108 (27.78%), Postives = 56/108 (51.85%), Query Frame = 2
Query:  656 INLQSGVKKRLEEITESDLWHCTKQNDEFTPNWSEVVQISQISEDKKIEITFQTN-NKQIV-YQTDLHRPFFVKNVGWCSLFPGLTQKMYGIQSSLMDIGQTCLTLSR 973
            +N+ +G  K++E+++  D   C  ++D+   N S +  I   S    + I F+T   KQ++  +  +  PFFV   GWCS  P  + + YG+   ++ +   C+ L+R
Sbjct:  128 LNVANGNIKKVEDLSSDDFLRCAAESDDVIVNASVIKSIK--STAGSVTIIFETGIEKQLIPLKCQVEHPFFVLGKGWCSCNPRKSGENYGLDCEILQVDDVCIVLTR 233          
BLAST of HMG box-containing protein 1 vs. Ensembl Fly
Match: Atx-1 (gene:FBgn0029907 transcript:FBtr0299814)

HSP 1 Score: 50.0618 bits (118), Expect = 9.381e-7
Identity = 29/106 (27.36%), Postives = 50/106 (47.17%), Query Frame = 2
Query:  656 INLQSGVKKRLEEITESDLWHCTKQNDEFTPNWSEVVQISQISEDKKIEITF--QTNNKQIVYQTDLHRPFFVKNVGWCSLFPGLTQKMYGIQSSLMDIGQTCLTL 967
            I L SG  +R+E+I   D      ++  F    + VV+I        + +TF   T++ ++  Q     P FV   GW S  P L+ ++Y ++   + +G  CL+L
Sbjct:   50 IELASGAMRRVEDIRTEDFIQSALRSQLFELREATVVRIDWSGCPSLVTLTFSYDTHHAKMDLQVQPGHPMFVYGQGWASCDPQLSLQLYELKCQQLQVGDICLSL 155          
BLAST of HMG box-containing protein 1 vs. Ensembl Zebrafish
Match: atxn1b (ataxin 1b [Source:ZFIN;Acc:ZDB-GENE-061218-2])

HSP 1 Score: 50.8322 bits (120), Expect = 2.220e-6
Identity = 28/110 (25.45%), Postives = 49/110 (44.55%), Query Frame = 2
Query:  653 MINLQSGVKKRLEEITESDLWHCTKQNDEFTPNWSEVVQISQISEDKKIEITFQT--NNKQIVYQTDLHRPFFVKNVGWCSLFPGLTQKMYGIQSSLMDIGQTCLTLSRK 976
            +I L  G  KR+E++   D     + + E   + S V +I        + I F    N  Q+  +  +  PFFV   GW S  P  T ++  +  + + +G  C++L+ K
Sbjct:  571 IIQLADGELKRVEDLRTEDFVQSAEVSGELKIDSSTVERIEGSGTPNAVIIQFSVGENKAQVCVEVLVEYPFFVFGQGWSSCCPDRTTQLLALSCAKLSVGDVCISLTLK 680          
BLAST of HMG box-containing protein 1 vs. Ensembl Zebrafish
Match: atxn1b (ataxin 1b [Source:ZFIN;Acc:ZDB-GENE-061218-2])

HSP 1 Score: 50.8322 bits (120), Expect = 2.220e-6
Identity = 28/110 (25.45%), Postives = 49/110 (44.55%), Query Frame = 2
Query:  653 MINLQSGVKKRLEEITESDLWHCTKQNDEFTPNWSEVVQISQISEDKKIEITFQT--NNKQIVYQTDLHRPFFVKNVGWCSLFPGLTQKMYGIQSSLMDIGQTCLTLSRK 976
            +I L  G  KR+E++   D     + + E   + S V +I        + I F    N  Q+  +  +  PFFV   GW S  P  T ++  +  + + +G  C++L+ K
Sbjct:  571 IIQLADGELKRVEDLRTEDFVQSAEVSGELKIDSSTVERIEGSGTPNAVIIQFSVGENKAQVCVEVLVEYPFFVFGQGWSSCCPDRTTQLLALSCAKLSVGDVCISLTLK 680          
BLAST of HMG box-containing protein 1 vs. Ensembl Zebrafish
Match: atxn1a (ataxin 1a [Source:ZFIN;Acc:ZDB-GENE-060503-759])

HSP 1 Score: 48.9062 bits (115), Expect = 7.830e-6
Identity = 34/140 (24.29%), Postives = 62/140 (44.29%), Query Frame = 2
Query:  653 MINLQSGVKKRLEEITESDLWHCTKQNDEFTPNWSEVVQI--SQISEDKKIEITFQTNNKQIVYQTDLHRPFFVKNVGWCSLFPGLTQKMYGIQSSLMDIGQTCLTLSRKRKSSNNIHDTNGHKRSKDTPRLHLSVHSNK 1066
            +I L  G  KR+E++   D     + ++E   + S V +I  S  +    I+        Q+  +  +  PFFV   GW S  P  T ++  +  + + +G  C++L+ K   + +I  + G  +  D P L   + S K
Sbjct:  535 IIQLADGELKRVEDLKTEDFIQSAEISNELKIDSSTVERIDSSHTANFAIIQFAVGAQRSQVSVEVLVEYPFFVFGQGWSSCCPDRTTQLLELPCTKLSVGDVCISLTLKNLRNGSIKKSQG--QVLDAPALGPPLKSPK 672          
BLAST of HMG box-containing protein 1 vs. Ensembl Zebrafish
Match: atxn1a (ataxin 1a [Source:ZFIN;Acc:ZDB-GENE-060503-759])

HSP 1 Score: 48.9062 bits (115), Expect = 7.830e-6
Identity = 34/140 (24.29%), Postives = 62/140 (44.29%), Query Frame = 2
Query:  653 MINLQSGVKKRLEEITESDLWHCTKQNDEFTPNWSEVVQI--SQISEDKKIEITFQTNNKQIVYQTDLHRPFFVKNVGWCSLFPGLTQKMYGIQSSLMDIGQTCLTLSRKRKSSNNIHDTNGHKRSKDTPRLHLSVHSNK 1066
            +I L  G  KR+E++   D     + ++E   + S V +I  S  +    I+        Q+  +  +  PFFV   GW S  P  T ++  +  + + +G  C++L+ K   + +I  + G  +  D P L   + S K
Sbjct:  535 IIQLADGELKRVEDLKTEDFIQSAEISNELKIDSSTVERIDSSHTANFAIIQFAVGAQRSQVSVEVLVEYPFFVFGQGWSSCCPDRTTQLLELPCTKLSVGDVCISLTLKNLRNGSIKKSQG--QVLDAPALGPPLKSPK 672          
BLAST of HMG box-containing protein 1 vs. Ensembl Zebrafish
Match: atxn1a (ataxin 1a [Source:ZFIN;Acc:ZDB-GENE-060503-759])

HSP 1 Score: 48.9062 bits (115), Expect = 7.830e-6
Identity = 34/140 (24.29%), Postives = 62/140 (44.29%), Query Frame = 2
Query:  653 MINLQSGVKKRLEEITESDLWHCTKQNDEFTPNWSEVVQI--SQISEDKKIEITFQTNNKQIVYQTDLHRPFFVKNVGWCSLFPGLTQKMYGIQSSLMDIGQTCLTLSRKRKSSNNIHDTNGHKRSKDTPRLHLSVHSNK 1066
            +I L  G  KR+E++   D     + ++E   + S V +I  S  +    I+        Q+  +  +  PFFV   GW S  P  T ++  +  + + +G  C++L+ K   + +I  + G  +  D P L   + S K
Sbjct:  535 IIQLADGELKRVEDLKTEDFIQSAEISNELKIDSSTVERIDSSHTANFAIIQFAVGAQRSQVSVEVLVEYPFFVFGQGWSSCCPDRTTQLLELPCTKLSVGDVCISLTLKNLRNGSIKKSQG--QVLDAPALGPPLKSPK 672          
BLAST of HMG box-containing protein 1 vs. Ensembl Mouse
Match: Atxn1l (ataxin 1-like [Source:MGI Symbol;Acc:MGI:3694797])

HSP 1 Score: 50.0618 bits (118), Expect = 3.632e-6
Identity = 28/117 (23.93%), Postives = 55/117 (47.01%), Query Frame = 2
Query:  653 MINLQSGVKKRLEEITESDLWHCTKQNDEFTPNWSEVVQISQISEDKKIEITFQTNNKQ--IVYQTDLHRPFFVKNVGWCSLFPGLTQKMYGIQSSLMDIGQTCLTLSRKRKSSNNI 997
            +I L +G  KR+E++   D     + +     + S VV I +      + + F    +Q  +  +     PFFV   GW S  PG T +++ +    + +G  C+++S +  +SN++
Sbjct:  472 IIQLATGELKRVEDLQTQDFVRSAEVSGGLKIDSSTVVDIQESQWPGFVMLHFVVGEQQSKVSIEVPPEHPFFVYGQGWSSCSPGRTAQLFSLPCHRLQVGDVCISISLQSLNSNSV 588          
BLAST of HMG box-containing protein 1 vs. Ensembl Mouse
Match: Atxn1l (ataxin 1-like [Source:MGI Symbol;Acc:MGI:3694797])

HSP 1 Score: 50.0618 bits (118), Expect = 3.632e-6
Identity = 28/117 (23.93%), Postives = 55/117 (47.01%), Query Frame = 2
Query:  653 MINLQSGVKKRLEEITESDLWHCTKQNDEFTPNWSEVVQISQISEDKKIEITFQTNNKQ--IVYQTDLHRPFFVKNVGWCSLFPGLTQKMYGIQSSLMDIGQTCLTLSRKRKSSNNI 997
            +I L +G  KR+E++   D     + +     + S VV I +      + + F    +Q  +  +     PFFV   GW S  PG T +++ +    + +G  C+++S +  +SN++
Sbjct:  472 IIQLATGELKRVEDLQTQDFVRSAEVSGGLKIDSSTVVDIQESQWPGFVMLHFVVGEQQSKVSIEVPPEHPFFVYGQGWSSCSPGRTAQLFSLPCHRLQVGDVCISISLQSLNSNSV 588          
BLAST of HMG box-containing protein 1 vs. TrEMBL
Match: W2TDM7 (Ataxin-1 and HBP1 module OS=Necator americanus OX=51031 GN=NECAME_09360 PE=4 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 4.424e-11
Identity = 36/117 (30.77%), Postives = 58/117 (49.57%), Query Frame = 2
Query:  653 MINLQSGVKKRLEEITESDLWHCTKQNDEFTPNWSEVVQISQISEDKKIEITFQTNNKQIVYQTDLHRPFFVKNVGWCSLFPGLTQKMYGIQSSLMDIGQTCLTLSRKRKSSNNIHD 1003
            MI + SG  K++EE++  D         EF  + S VV+I++ S   +++        +   +  L  PFFV   GWCS  P  T + YG++   M +G  C++LSR+ +S     D
Sbjct:  209 MIQMASGKLKKVEEMSSDDFLLAAPLTREFNVDASVVVEIAKASTLARVKFAVGQTQYEATLEPQLEHPFFVLGKGWCSCDPHRTAETYGLECQEMKVGDVCISLSRRSESDAKQLD 325          
BLAST of HMG box-containing protein 1 vs. TrEMBL
Match: A0A158PDA1 (AXH domain-containing protein OS=Angiostrongylus costaricensis OX=334426 GN=ACOC_LOCUS437 PE=4 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 7.122e-11
Identity = 34/108 (31.48%), Postives = 57/108 (52.78%), Query Frame = 2
Query:  653 MINLQSGVKKRLEEITESDLWHCTKQNDEFTPNWSEVVQISQISEDKKIEITFQTNNKQIVYQTDLHRPFFVKNVGWCSLFPGLTQKMYGIQSSLMDIGQTCLTLSRK 976
            MI + SG  K++EE++  D         EF  + S VV+I++ S   +I+ +   +  +   +  L  PFFV   GWCS  P  T + YG++   + +G  C++LSR+
Sbjct:  238 MIQMASGKLKKVEEMSSDDFLLAAPLTGEFNVDASVVVEIAKASSLARIKFSVGQSQYEATLEPQLEHPFFVLGKGWCSCDPHRTAETYGLECQELKVGDVCISLSRR 345          
BLAST of HMG box-containing protein 1 vs. TrEMBL
Match: A0A158P8U5 (AXH domain-containing protein OS=Angiostrongylus cantonensis OX=6313 PE=4 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 8.833e-11
Identity = 34/108 (31.48%), Postives = 57/108 (52.78%), Query Frame = 2
Query:  653 MINLQSGVKKRLEEITESDLWHCTKQNDEFTPNWSEVVQISQISEDKKIEITFQTNNKQIVYQTDLHRPFFVKNVGWCSLFPGLTQKMYGIQSSLMDIGQTCLTLSRK 976
            MI + SG  K++EE++  D         EF  + S VV+I++ S   +I+ +   +  +   +  L  PFFV   GWCS  P  T + YG++   + +G  C++LSR+
Sbjct:  237 MIQMASGKLKKVEEMSSDDFLLAAPLTGEFNVDASVVVEIAKASTLARIKFSVGQSQYEATLEPQLEHPFFVLGKGWCSCDPHRTAETYGLECQELKVGDVCISLSRR 344          
BLAST of HMG box-containing protein 1 vs. TrEMBL
Match: A0A0M3JU54 (Ataxin 1 (inferred by orthology to a D. melanogaster protein) OS=Anisakis simplex OX=6269 GN=ASIM_LOCUS11158 PE=4 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 2.161e-10
Identity = 35/112 (31.25%), Postives = 57/112 (50.89%), Query Frame = 2
Query:  653 MINLQSGVKKRLEEITESDLWHCTKQNDEFTPNWSEVVQISQISEDKKIEITFQTN--NKQIVYQTDLHRPFFVKNVGWCSLFPGLTQKMYGIQSSLMDIGQTCLTLSRKRK 982
            +I LQSG  KR+EE++ SD         + +   S VV I ++ +D+ + +TF     N Q+  +  +  P+FV   GW S  P  T+  YG+Q   + +G  C+T+    K
Sbjct:  529 VIRLQSGQLKRVEEMSTSDFVLSAAMKSDLSLCNSTVVSIQEVDKDRHVLVTFAVGEHNTQVSIEAGIEHPYFVVGQGWASCSPERTRNTYGLQCKRLAVGDVCITIRHCEK 640          
BLAST of HMG box-containing protein 1 vs. TrEMBL
Match: A0A016U4L4 (AXH domain-containing protein OS=Ancylostoma ceylanicum OX=53326 GN=Acey_s0059.g3053 PE=4 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 1.001e-9
Identity = 33/108 (30.56%), Postives = 55/108 (50.93%), Query Frame = 2
Query:  653 MINLQSGVKKRLEEITESDLWHCTKQNDEFTPNWSEVVQISQISEDKKIEITFQTNNKQIVYQTDLHRPFFVKNVGWCSLFPGLTQKMYGIQSSLMDIGQTCLTLSRK 976
            MI + SG  K++EE++  D         EF  + S VV+I++ S   +++     +  +   +  L  PFFV   GWCS  P  T + YG++   +  G  C++LSR+
Sbjct:  211 MIQMASGKLKKVEEMSSDDFLLAAPLTREFNVDASVVVEIAKASTLARVKFAVGQSQYEATLEPQLEHPFFVLGKGWCSCDPHRTAETYGLECQELKAGDVCISLSRR 318          
BLAST of HMG box-containing protein 1 vs. Ensembl Cavefish
Match: atxn1b (ataxin-1-like [Source:NCBI gene;Acc:103029611])

HSP 1 Score: 55.4546 bits (132), Expect = 5.550e-8
Identity = 38/150 (25.33%), Postives = 65/150 (43.33%), Query Frame = 2
Query:  653 MINLQSGVKKRLEEITESDLWHCTKQNDEFTPNWSEVVQI--SQISEDKKIEITFQTNNKQIVYQTDLHRPFFVKNVGWCSLFPGLTQKMYGIQSSLMDIGQTCLTLSRKR---------------KSSNNIH----DTNGHKRSKDTPR 1039
            +I L  G  KR+E++   D     + + E   + S V +I  S+  +   I+ +   +  Q+  +  +  PFFV   GW S  P  T ++  +  + + +G  C++L+ K                K+ NNIH     TNG    + TPR
Sbjct:  599 IIQLADGELKRVEDLRTEDFLQSAEVSGELKIDSSTVERIDTSRTPDAVIIQFSVGEHKAQVCVEVLVEYPFFVFGQGWSSCCPDRTTQLLALSCAKLSVGDVCISLTLKSLRNGALSKDQTFGTLKNHNNIHLKTAKTNGQAGDRPTPR 748          
BLAST of HMG box-containing protein 1 vs. Ensembl Cavefish
Match: atxn1b (ataxin-1-like [Source:NCBI gene;Acc:103029611])

HSP 1 Score: 55.4546 bits (132), Expect = 5.550e-8
Identity = 38/150 (25.33%), Postives = 65/150 (43.33%), Query Frame = 2
Query:  653 MINLQSGVKKRLEEITESDLWHCTKQNDEFTPNWSEVVQI--SQISEDKKIEITFQTNNKQIVYQTDLHRPFFVKNVGWCSLFPGLTQKMYGIQSSLMDIGQTCLTLSRKR---------------KSSNNIH----DTNGHKRSKDTPR 1039
            +I L  G  KR+E++   D     + + E   + S V +I  S+  +   I+ +   +  Q+  +  +  PFFV   GW S  P  T ++  +  + + +G  C++L+ K                K+ NNIH     TNG    + TPR
Sbjct:  599 IIQLADGELKRVEDLRTEDFLQSAEVSGELKIDSSTVERIDTSRTPDAVIIQFSVGEHKAQVCVEVLVEYPFFVFGQGWSSCCPDRTTQLLALSCAKLSVGDVCISLTLKSLRNGALSKDQTFGTLKNHNNIHLKTAKTNGQAGDRPTPR 748          
BLAST of HMG box-containing protein 1 vs. Ensembl Cavefish
Match: ENSAMXT00000002788.2 (ataxin-1-like [Source:NCBI gene;Acc:103038298])

HSP 1 Score: 53.5286 bits (127), Expect = 2.298e-7
Identity = 29/107 (27.10%), Postives = 48/107 (44.86%), Query Frame = 2
Query:  653 MINLQSGVKKRLEEITESDLWHCTKQNDEFTPNWSEVVQISQISEDK--KIEITFQTNNKQIVYQTDLHRPFFVKNVGWCSLFPGLTQKMYGIQSSLMDIGQTCLTL 967
            +I L  G  KR+EE+   D  H    + EF  +   ++ IS    +    +++     N Q +       PFFV++ GW S  P  + ++YG+    +  G  CL L
Sbjct:  400 LIELAGGRLKRVEELRTEDFLHSADTSPEFHLSTCTILLISPGPTNGFNHLQVLLADRNTQELLTVLEEYPFFVRDRGWSSCSPQRSAQLYGLPCRQLSAGDVCLAL 506          
BLAST of HMG box-containing protein 1 vs. Ensembl Nematostella
Match: EDO32536 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUT3])

HSP 1 Score: 51.9878 bits (123), Expect = 1.674e-8
Identity = 31/108 (28.70%), Postives = 48/108 (44.44%), Query Frame = 2
Query:  653 MINLQSGVKKRLEEITESDLWHCTKQNDEFTPNWSEVVQISQISEDKK--IEITFQTNNKQIVYQTDLHRPFFVKNVGWCSLFPGLTQKMYGIQSSLMDIGQTCLTLS 970
            +I L SG  KR+E++T  D  H T    +     S VV + +  E     +  T  +   Q+     +  PFFV   GW S  P  + K Y +Q   + +G  C+ L+
Sbjct:   11 IIQLTSGELKRVEDLTTDDFVHSTGLCPDLKLETSTVVSVRKNDEVGMALVGFTITSTKAQVTLSCAVEHPFFVYGQGWSSCVPEQSLKKYNLQCHPLKVGDVCIFLT 118          
BLAST of HMG box-containing protein 1 vs. Ensembl Medaka
Match: ENSORLT00000027865.1 (ataxin-1-like [Source:NCBI gene;Acc:105354405])

HSP 1 Score: 55.8398 bits (133), Expect = 4.549e-8
Identity = 32/108 (29.63%), Postives = 51/108 (47.22%), Query Frame = 2
Query:  653 MINLQSGVKKRLEEITESDLWHCTKQNDEFTPNWSEVVQISQISED--KKIEITFQTNNKQIVYQTDLHRPFFVKNVGWCSLFPGLTQKMYGIQSSLMDIGQTCLTLS 970
            +I L SG  KR+EE+   D       + EF  +   V+ IS  S     ++++     N Q   +  +  PFFV++ GW S  P  T ++YG+    +  G  CL L+
Sbjct:  466 LIELASGRLKRVEELRTEDFLRSADTSSEFHLSTCTVLSISPSSAQGFSQLQLHLTDRNTQESLKVLVEYPFFVQDRGWSSCSPQRTTQLYGLPCRQLSEGDICLALT 573          
BLAST of HMG box-containing protein 1 vs. Planmine SMEST
Match: SMESG000010590.1 (SMESG000010590.1)

HSP 1 Score: 541.576 bits (1394), Expect = 0.000e+0
Identity = 284/286 (99.30%), Postives = 285/286 (99.65%), Query Frame = 2
Query:  209 MTLPIDFSIHGSEKPFSNSPKSTMPFLPSNFSRFLSSVSEQKLPRFLGNISNPLFWRHFPPYLQYDQKLPFNPAIIDQISGKSSRTRFNHLPMSPSRLFSPSHSFMXXXXXXXXXXXXXXXXXWNHSSPTAMATTNSEKNGLSTNSTLMINLQSGVKKRLEEITESDLWHCTKQNDEFTPNWSEVVQISQISEDKKIEITFQTNNKQIVYQTDLHRPFFVKNVGWCSLFPGLTQKMYGIQSSLMDIGQTCLTLSRKRKSSNNIHDTNGHKRSKDTPRLHLSVHSNK 1066
            MTLPIDFSIHGSEKPFSNSPKSTMPFLPSNFSRFLSSVSEQKLPRFLGNISNPLFWRHFPPYLQYDQKLPFNPAIIDQISGKSSRTRFNHLPMSPSRLFSPSHSFMDKKSSASMNSMSAFFDSWNHSSPTA ATTNSEKNGLSTNSTLMINLQSGVKKRLEEITESDLWHCTKQNDEFTPNWSEVVQISQISEDKKIEITFQTNNKQIVYQTDLHRPFFVKNVGWCSLFPGLTQKMYGIQSSLMDIGQTCLTLSRKRKSSNNIHDTNGHKRSKDTPRLHLS+HSNK
Sbjct:    1 MTLPIDFSIHGSEKPFSNSPKSTMPFLPSNFSRFLSSVSEQKLPRFLGNISNPLFWRHFPPYLQYDQKLPFNPAIIDQISGKSSRTRFNHLPMSPSRLFSPSHSFMDKKSSASMNSMSAFFDSWNHSSPTATATTNSEKNGLSTNSTLMINLQSGVKKRLEEITESDLWHCTKQNDEFTPNWSEVVQISQISEDKKIEITFQTNNKQIVYQTDLHRPFFVKNVGWCSLFPGLTQKMYGIQSSLMDIGQTCLTLSRKRKSSNNIHDTNGHKRSKDTPRLHLSMHSNK 286          
BLAST of HMG box-containing protein 1 vs. Planmine SMEST
Match: SMESG000006149.1 (SMESG000006149.1)

HSP 1 Score: 49.2914 bits (116), Expect = 2.396e-6
Identity = 25/109 (22.94%), Postives = 47/109 (43.12%), Query Frame = 2
Query:  653 MINLQSGVKKRLEEITESDLWHCTKQNDEFTPNWSEVVQISQISEDKKIEITFQTNNKQIVYQTDLHRPFFVKNVGWCSLFPGLTQKMYGIQSSLMDIGQTCLTLSRKR 979
            +I +  G  K +E ++ SD     K ++      SEV  I     D    I     N+  V    + +PFF+++ GW ++ P      Y + ++ + +   C  L +K+
Sbjct:  180 LIKMSDGELKVVESLSASDFEKSCKSHNGMVLVPSEVKLIEVSHSDNTARIQLIHENRSSVIVVSVSKPFFIRDAGWAAIDPDACLNKYSLHATKLQLNDVCFCLVKKK 288          
BLAST of HMG box-containing protein 1 vs. Planmine SMEST
Match: SMESG000006149.1 (SMESG000006149.1)

HSP 1 Score: 48.9062 bits (115), Expect = 3.197e-6
Identity = 25/109 (22.94%), Postives = 47/109 (43.12%), Query Frame = 2
Query:  653 MINLQSGVKKRLEEITESDLWHCTKQNDEFTPNWSEVVQISQISEDKKIEITFQTNNKQIVYQTDLHRPFFVKNVGWCSLFPGLTQKMYGIQSSLMDIGQTCLTLSRKR 979
            +I +  G  K +E ++ SD     K ++      SEV  I     D    I     N+  V    + +PFF+++ GW ++ P      Y + ++ + +   C  L +K+
Sbjct:  166 LIKMSDGELKVVESLSASDFEKSCKSHNGMVLVPSEVKLIEVSHSDNTARIQLIHENRSSVIVVSVSKPFFIRDAGWAAIDPDACLNKYSLHATKLQLNDVCFCLVKKK 274          
The following BLAST results are available for this feature:
BLAST of HMG box-containing protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ATXN1L6.092e-623.93ataxin 1 like [Source:HGNC Symbol;Acc:HGNC:33279][more]
back to top
BLAST of HMG box-containing protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
K04F10.13.992e-1027.78pep chromosome:WBcel235:I:6364886:6366224:1 gene:W... [more]
back to top
BLAST of HMG box-containing protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Atx-19.381e-727.36gene:FBgn0029907 transcript:FBtr0299814[more]
back to top
BLAST of HMG box-containing protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atxn1b2.220e-625.45ataxin 1b [Source:ZFIN;Acc:ZDB-GENE-061218-2][more]
atxn1b2.220e-625.45ataxin 1b [Source:ZFIN;Acc:ZDB-GENE-061218-2][more]
atxn1a7.830e-624.29ataxin 1a [Source:ZFIN;Acc:ZDB-GENE-060503-759][more]
atxn1a7.830e-624.29ataxin 1a [Source:ZFIN;Acc:ZDB-GENE-060503-759][more]
atxn1a7.830e-624.29ataxin 1a [Source:ZFIN;Acc:ZDB-GENE-060503-759][more]
back to top
BLAST of HMG box-containing protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of HMG box-containing protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Atxn1l3.632e-623.93ataxin 1-like [Source:MGI Symbol;Acc:MGI:3694797][more]
Atxn1l3.632e-623.93ataxin 1-like [Source:MGI Symbol;Acc:MGI:3694797][more]
back to top
BLAST of HMG box-containing protein 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of HMG box-containing protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
W2TDM74.424e-1130.77Ataxin-1 and HBP1 module OS=Necator americanus OX=... [more]
A0A158PDA17.122e-1131.48AXH domain-containing protein OS=Angiostrongylus c... [more]
A0A158P8U58.833e-1131.48AXH domain-containing protein OS=Angiostrongylus c... [more]
A0A0M3JU542.161e-1031.25Ataxin 1 (inferred by orthology to a D. melanogast... [more]
A0A016U4L41.001e-930.56AXH domain-containing protein OS=Ancylostoma ceyla... [more]
back to top
BLAST of HMG box-containing protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
atxn1b5.550e-825.33ataxin-1-like [Source:NCBI gene;Acc:103029611][more]
atxn1b5.550e-825.33ataxin-1-like [Source:NCBI gene;Acc:103029611][more]
ENSAMXT00000002788.22.298e-727.10ataxin-1-like [Source:NCBI gene;Acc:103038298][more]
back to top
BLAST of HMG box-containing protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of HMG box-containing protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of HMG box-containing protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO325361.674e-828.70Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of HMG box-containing protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSORLT00000027865.14.549e-829.63ataxin-1-like [Source:NCBI gene;Acc:105354405][more]
back to top
BLAST of HMG box-containing protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000010590.10.000e+099.30SMESG000010590.1[more]
SMESG000006149.12.396e-622.94SMESG000006149.1[more]
SMESG000006149.13.197e-622.94SMESG000006149.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028043 ID=SMED30028043|Name=HMG box-containing protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=1133bp
TGGGGGACAATTATAGTCTACTACTGCGATGTGATTGGTTGAAAATTTAT
TCTCCCGATAGTTCACAGAGAGTAAATAATTGTAAGTCACAACGAGAAAA
AAACATTTTCCAGAAATTACAAGAGATTACGGTAAAAAAAATTTTTGGCT
TAAATTTTTTGAAAGTTGGTTGAAAACGATTTTAGAGGAAAATAATTTTT
TTTTCACAATGACATTGCCCATAGATTTTTCAATTCACGGCTCAGAGAAA
CCGTTTTCCAACTCGCCGAAATCCACAATGCCGTTTCTGCCGTCGAATTT
CTCCAGGTTTCTCTCGTCAGTATCTGAACAGAAGCTGCCAAGGTTTCTGG
GCAATATATCAAATCCGCTTTTCTGGAGGCATTTCCCACCATATTTGCAA
TACGATCAAAAGCTTCCGTTCAATCCAGCGATAATTGACCAGATTTCCGG
CAAATCCTCCCGGACACGATTCAACCATTTACCAATGAGCCCATCCAGAT
TATTCTCTCCCTCTCACTCTTTTATGGACAAAAAATCCTCGGCCTCCATG
AATTCAATGTCAGCTTTTTTTGATAGTTGGAATCATTCTTCGCCGACCGC
AATGGCAACGACAAATAGCGAGAAAAACGGCCTATCAACCAATTCGACAT
TGATGATAAATTTACAGTCCGGCGTTAAAAAACGCCTTGAAGAAATCACA
GAATCCGATTTGTGGCACTGCACAAAGCAAAATGATGAATTCACTCCGAA
TTGGTCAGAAGTTGTTCAAATATCCCAAATATCCGAGGACAAGAAAATTG
AAATAACTTTTCAAACAAATAATAAACAGATTGTTTACCAAACTGATCTC
CATCGGCCGTTCTTCGTGAAAAATGTCGGCTGGTGTTCCTTATTCCCGGG
TCTGACGCAGAAAATGTATGGGATCCAGAGCTCCCTAATGGACATCGGGC
AAACGTGTCTGACTCTTTCAAGGAAAAGGAAATCATCTAACAATATCCAT
GATACAAATGGTCACAAGAGGTCAAAGGACACCCCTAGATTACATTTATC
GGTGCATTCAAACAAATTGTAAAATGATCTCATCCTTGAATTATTTATAT
AAATAATTGATTGATATAAATTGTCACTTTGTG
back to top

protein sequence of SMED30028043-orf-1

>SMED30028043-orf-1 ID=SMED30028043-orf-1|Name=SMED30028043-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=288bp
MTLPIDFSIHGSEKPFSNSPKSTMPFLPSNFSRFLSSVSEQKLPRFLGNI
SNPLFWRHFPPYLQYDQKLPFNPAIIDQISGKSSRTRFNHLPMSPSRLFS
PSHSFMDKKSSASMNSMSAFFDSWNHSSPTAMATTNSEKNGLSTNSTLMI
NLQSGVKKRLEEITESDLWHCTKQNDEFTPNWSEVVQISQISEDKKIEIT
FQTNNKQIVYQTDLHRPFFVKNVGWCSLFPGLTQKMYGIQSSLMDIGQTC
LTLSRKRKSSNNIHDTNGHKRSKDTPRLHLSVHSNKL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0005515protein binding
GO:0003723RNA binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0002028dorsal-ventral muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR036096Ataxin_AXH_dom_sf
IPR003652Ataxin_AXH_dom
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003652Ataxin, AXH domainSMARTSM00536toby4coord: 144..256
e-value: 2.3E-5
score: 16.9
IPR003652Ataxin, AXH domainPFAMPF08517AXHcoord: 149..254
e-value: 3.9E-19
score: 69.3
IPR003652Ataxin, AXH domainPROSITEPS51148AXHcoord: 132..261
score: 16.147
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 257..287
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 258..281
NoneNo IPR availablePANTHERPTHR13392ATAXIN 1coord: 148..264
NoneNo IPR availablePANTHERPTHR13392:SF13ATAXIN 1coord: 148..264
IPR036096Ataxin, AXH domain superfamilySUPERFAMILYSSF102031AXH domaincoord: 149..254