Transmembrane channel protein

Overview
NameTransmembrane channel protein
Smed IDSMED30028041
Length (bp)2145
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Transmembrane channel protein (SMED30028041) t-SNE clustered cells

Violin plots show distribution of expression levels for Transmembrane channel protein (SMED30028041) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Transmembrane channel protein (SMED30028041) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Transmembrane channel protein (SMED30028041) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028041

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30028041SMESG000017383.1 SMESG000017356.1 SMESG000017353.1 Contig5514GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30028041SMESG000013576.1 Contig5514GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
parenchymal cellSMED30028041SMESG000013576.1 dd_Smed_v4_12376_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30028041SMESG000013576.1 dd_Smed_v4_6619_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30028041SMESG000013576.1 Contig46007newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30028041SMESG000013576.1 Contig46007uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Transmembrane channel protein vs. Ensembl Human
Match: TMC7 (transmembrane channel like 7 [Source:HGNC Symbol;Acc:HGNC:23000])

HSP 1 Score: 117.472 bits (293), Expect = 8.191e-27
Identity = 131/631 (20.76%), Postives = 283/631 (44.85%), Query Frame = 3
Query:  135 FYRKITGILEPLSIWYSSLKTIEKNCGCAVSSYFQFITWLMRINLWMFAIFLTVLLIPFLIKKPESFSDLIIDGNFTNNNDKFTL-AVNCTQKAYVKDNPMTVEVIIDILNGKGLLVKSPMFIGYYFNISYFNMTGSEFTRPLYNTPVAYCFAFWLCXXXXXXXXXXXXGTNYKLYKIDEDEFSGKFGLCLLTGFDYGVTKKNRILAMRNDLTKKLKIQYNQIEEFNYRSKLPKKSA--IIKAFP-KIVVNIIFIGFLCLIYFVIVEAQDVPIMLAQNKIVKSNAILVLLKD----YVPSVTVAMINVVFQIINTKVVRFENYTKTVAVEVCFIRLILVQVISLLIFMVSLLDQTSQSNITDKVCQQTG----AIKCWENFIGQQFYRYSLLLFFSSVFVKPLIQLLQSVIFNRFGKD-PDSQNTKSKVVKLIGTAGFDLSEEGFVLINAQCVCWMGFWFCPXXXXXXXXXXXXXXYIRKAMFLRNLFETKMETATVAGGQKFLLGMLLNGLAFIMLPMGYILSNKSPSRGCSPFRIYD-----YPGDGYSFTTFLVEFVTSQSKIFSKICNFVTSLQFFLPVLGVLIIITYVKYAQAKTYSRSIQAIRKEILNEENNLLFYEKQMMNAKE 1973
            F  K   +   L +W   +++IE   G  + SYF F+ +L+ +NL +F I   ++L+P L+ K +  +   +   F + + + T+  V+ +   Y          IID+L+G G L ++ +F G+Y       + G +F    Y+ P+AY  +    +  S +  +  S   +K+  I  +E    +   +  G+D+ +T ++      + L  +L+     +EE   R K+ ++++   I+ +  ++ +N I +  L   ++ I     V  + +Q  + K    +V  ++    Y+PS+ + + N +  +I  K++R+E+Y+    + +  +R + +++ ++ + + +L  + +  +  D  C   G       CWE  +GQ+ Y+  L++F         I +L   +F  F +    +  +  K+++  G   F + +    ++  Q +CW+G +F P L  +  L   ++FY+++   L             +    F L +LL GL   ++P+   +S    S+ C PF  ++      P    +F + L  F+             VTS  F +P   ++ +I +   A A  + R +  +R+++  E  +  +  +++  A+ 
Sbjct:   21 FLEKAREMTTHLELWREDIRSIEGKFGTGIQSYFSFLRFLVLLNLVIFLIIFMLVLLPVLLTKYKITNSSFVLIPFKDMDKQCTVYPVSSSGLIYF------YSYIIDLLSGTGFLEETSLFYGHY------TIDGVKFQNFTYDLPLAYLLSTIASLALSLLWIVKRSVEGFKINLIRSEEHFQSYCNKIFAGWDFCITNRSMADLKHSSLRYELR---ADLEEERMRQKIAERTSEETIRIYSLRLFLNCIVLAVLGACFYAIY----VATVFSQEHMKKEIDKMVFGENLFILYLPSIVITLANFITPMIFAKIIRYEDYSPGFEIRLTILRCVFMRLATICVLVFTLGSKITSCD--DDTCDLCGYNQKLYPCWETQVGQEMYK--LMIF-------DFIIILAVTLFVDFPRKLLVTYCSSCKLIQCWGQQEFAIPDNVLGIVYGQTICWIGAFFSPLLPAIATLKFIIIFYVKEWSLLYTC-RPSPRPFRASNSNFFFLLVLLIGLCLAIIPLTISISRIPSSKACGPFTNFNTTWEVIPKTVSTFPSSLQSFIHG-----------VTSEAFAVPFFMIICLIMFYFIALAGAHKRVVIQLREQLSLESRDKCYLIQKLTEAQR 609          
BLAST of Transmembrane channel protein vs. Ensembl Human
Match: TMC7 (transmembrane channel like 7 [Source:HGNC Symbol;Acc:HGNC:23000])

HSP 1 Score: 116.316 bits (290), Expect = 2.843e-26
Identity = 131/631 (20.76%), Postives = 284/631 (45.01%), Query Frame = 3
Query:  135 FYRKITGILEPLSIWYSSLKTIEKNCGCAVSSYFQFITWLMRINLWMFAIFLTVLLIPFLIKKPESFSDLIIDGNFTNNNDKFTL-AVNCTQKAYVKDNPMTVEVIIDILNGKGLLVKSPMFIGYYFNISYFNMTGSEFTRPLYNTPVAYCFAFWLCXXXXXXXXXXXXGTNYKLYKIDEDEFSGKFGLCLLTGFDYGVTKKNRILAMRNDLTKKLKIQYNQIEEFNYRSKLPKKSA--IIKAFP-KIVVNIIFIGFLCLIYFVIVEAQDVPIMLAQNKIVKSNAILVLLKD----YVPSVTVAMINVVFQIINTKVVRFENYTKTVAVEVCFIRLILVQVISLLIFMVSLLDQTSQSNITDKVCQQTG----AIKCWENFIGQQFYRYSLLLFFSSVFVKPLIQLLQSVIFNRFGKD-PDSQNTKSKVVKLIGTAGFDLSEEGFVLINAQCVCWMGFWFCPXXXXXXXXXXXXXXYIRKAMFLRNLFETKMETATVAGGQKFLLGMLLNGLAFIMLPMGYILSNKSPSRGCSPFRIYDY-----PGDGYSFTTFLVEFVTSQSKIFSKICNFVTSLQFFLPVLGVLIIITYVKYAQAKTYSRSIQAIRKEILNEENNLLFYEKQMMNAKE 1973
            F  K   +   L +W   +++IE   G  + SYF F+ +L+ +NL +F I   ++L+P L+ K +  +   +   F + + + T+  V+ +   Y          IID+L+G G L ++ +F G+Y       + G +F    Y+ P+AY  +    +  S +  +  S   +K+  I  +E    +   +  G+D+ +T ++      + L  +L+     +EE   R K+ ++++   I+ +  ++ +N I +  L   ++ I     V  + +Q  + K    +V  ++    Y+PS+ + + N +  +I  K++R+E+Y+    + +  +R + +++ ++ + + +L  + +  +  D  C   G       CWE  +GQ+ Y+  L++F         I +L   +F  F +    +  +  K+++  G   F + +    ++  Q +CW+G +F P L  +  L   ++FY+++   L     +       +    F L +LL GL   ++P+   +S    S+ C PF  ++      P    +F + L  F+             VTS  F +P   ++ +I +   A A  + R +  +R+++  E  +  +  +++  A+ 
Sbjct:  131 FLEKAREMTTHLELWREDIRSIEGKFGTGIQSYFSFLRFLVLLNLVIFLIIFMLVLLPVLLTKYKITNSSFVLIPFKDMDKQCTVYPVSSSGLIYF------YSYIIDLLSGTGFLEETSLFYGHY------TIDGVKFQNFTYDLPLAYLLSTIASLALSLLWIVKRSVEGFKINLIRSEEHFQSYCNKIFAGWDFCITNRSMADLKHSSLRYELR---ADLEEERMRQKIAERTSEETIRIYSLRLFLNCIVLAVLGACFYAIY----VATVFSQEHMKKEIDKMVFGENLFILYLPSIVITLANFITPMIFAKIIRYEDYSPGFEIRLTILRCVFMRLATICVLVFTLGSKITSCD--DDTCDLCGYNQKLYPCWETQVGQEMYK--LMIF-------DFIIILAVTLFVDFPRKLLVTYCSSCKLIQCWGQQEFAIPDNVLGIVYGQTICWIGAFFSPLLPAIATLKFIIIFYVKEWSLLYTCRPSP-RPFRASNSNFFFLLVLLIGLCLAIIPLTISISRIPSSKACGPFTNFNTTWEVIPKTVSTFPSSLQSFIHG-----------VTSEAFAVPFFMIICLIMFYFIALAGAHKRVVIQLREQLSLESRDKCYLIQKLTEAQR 719          
BLAST of Transmembrane channel protein vs. Ensembl Human
Match: TMC7 (transmembrane channel like 7 [Source:HGNC Symbol;Acc:HGNC:23000])

HSP 1 Score: 113.62 bits (283), Expect = 2.442e-25
Identity = 130/612 (21.24%), Postives = 276/612 (45.10%), Query Frame = 3
Query:  135 FYRKITGILEPLSIWYSSLKTIEKNCGCAVSSYFQFITWLMRINLWMFAIFLTVLLIPFLIKKPESFSDLIIDGNFTNNNDKFTL-AVNCTQKAYVKDNPMTVEVIIDILNGKGLLVKSPMFIGYYFNISYFNMTGSEFTRPLYNTPVAYCFAFWLCXXXXXXXXXXXXGTNYKLYKIDEDEFSGKFGLCLLTGFDYGVTKKNRILAMRNDLTKKLKIQYNQIEEFNYRSKLPKKSA--IIKAFP-KIVVNIIFIGFLCLIYFVIVEAQDVPIMLAQNKIVKSNAILVLLKD----YVPSVTVAMINVVFQIINTKVVRFENYTKTVAVEVCFIRLILVQVISLLIFMVSLLDQTSQSNITDKVCQQTG----AIKCWENFIGQQFYRYSLLLFFSSVFVKPLIQLLQSVIFNRFGKDPDSQNTKS-KVVKLIGTAGFDLSEEGFVLINAQCVCWMGFWFCPXXXXXXXXXXXXXXYIRKAMFLRNLFETKMETATVAGGQKFLLGMLLNGLAFIMLPMGYILSNKSPSRGCSPFRIYDY-----PGDGYSFTTFLVEFVTSQSKIFSKICNFVTSLQFFLPVLGVLIIITYVKYAQAKTYSRSIQAIRKEI 1916
            F  K   +   L +W   +++IE   G  + SYF F+ +L+ +NL +F I   ++L+P L+ K +  +   +   F + + + T+  V+ +   Y          IID+L+G G L ++ +F G+Y       + G +F    Y+ P+AY  +    +  S +  +  S   +K+  I  +E    +   +  G+D+ +T ++      + L  +L+     +EE   R K+ ++++   I+ +  ++ +N I +  L   ++ I     V  + +Q  + K    +V  ++    Y+PS+ + + N +  +I  K++R+E+Y+    + +  +R + +++ ++ + + +L  + +  +  D  C   G       CWE  +GQ+ Y+  L++F         I +L   +F  F +        S K+++  G   F + +    ++  Q +CW+G +F P L  +  L   ++FY+++   L     +       +    F L +LL GL   ++P+   +S    S+ C PF  ++      P    +F + L  F+           + VTS  F +P   ++ +I +   A A  + R +  +R+++
Sbjct:  131 FLEKAREMTTHLELWREDIRSIEGKFGTGIQSYFSFLRFLVLLNLVIFLIIFMLVLLPVLLTKYKITNSSFVLIPFKDMDKQCTVYPVSSSGLIYF------YSYIIDLLSGTGFLEETSLFYGHY------TIDGVKFQNFTYDLPLAYLLSTIASLALSLLWIVKRSVEGFKINLIRSEEHFQSYCNKIFAGWDFCITNRSMADLKHSSLRYELR---ADLEEERMRQKIAERTSEETIRIYSLRLFLNCIVLAVLGACFYAIY----VATVFSQEHMKKEIDKMVFGENLFILYLPSIVITLANFITPMIFAKIIRYEDYSPGFEIRLTILRCVFMRLATICVLVFTLGSKITSCD--DDTCDLCGYNQKLYPCWETQVGQEMYK--LMIF-------DFIIILAVTLFVDFPRKLLVTYCSSCKLIQCWGQQEFAIPDNVLGIVYGQTICWIGAFFSPLLPAIATLKFIIIFYVKEWSLLYTCRPSP-RPFRASNSNFFFLLVLLIGLCLAIIPLTISISRIPSSKACGPFTNFNTTWEVIPKTVSTFPSSLQSFI-----------HGVTSEAFAVPFFMIICLIMFYFIALAGAHKRVVIQLREQL 700          
BLAST of Transmembrane channel protein vs. Ensembl Human
Match: TMC5 (transmembrane channel like 5 [Source:HGNC Symbol;Acc:HGNC:22999])

HSP 1 Score: 88.5817 bits (218), Expect = 1.407e-17
Identity = 142/640 (22.19%), Postives = 270/640 (42.19%), Query Frame = 3
Query:   93 NEIIEIVEQSKLSLFYRKITGILEPLSIWYSSLKTIEKNCGCAVSSYFQFITWLMRINLWMFAIFLTVLLIPFLIKKPESFSDLIIDGNFTNNNDKFTLAVNCTQKAYVKDNPMTVEVIIDILNGKGLLVKSPMFIGYYFN--ISYFNMTGSEFTRPLYNTPVAYCFAFWLCXXXXXXXXXXXXGTNYKLYKIDEDEFSGKFGLC-LLTGFDYGVTKKNRILAMRNDLTKKLKIQYNQIEEFNYRSKLPKKSAIIKAFPKIVVNIIFIGFLCLIYFVIVEAQDVPIMLAQNKI----VKSNAILVLLKDYVPSVTVAMINVVFQIINTKVVRFENYT-KTVAVEVCFIRLILVQVISLLIFMVSLLDQTSQSNITDKVCQQTGAIKCWENFIGQQFYRYSLLLFFSSVFVKPLIQLLQSVIFNRFGKDPDSQNTKSKVVKLIGTAGFDLSEEGFVLINAQCVCWMGFWFCPXXXXXXXXXXXXXXYIRKAMFLRNLFETKMETATVAGGQKFLLGML-LNGLAFIMLPMGYILSNKSPSRGCSPFRIYDYPGDGYSFTTFLVEFVTSQSKIFSKIC--NFVTSLQFFLPVLGVLIIITYVKYAQAKTYSRSIQAIRKEILNEENNLLFYEKQMMNAKEID 1979
            N I     +SK SL     + IL  +S+W  +LK I    G +V SYF F+ WL++ N++ F +  + ++IP                       +FT+A         K N +     ++   G G    + M+ G+Y N  I + N   S      YN  +AY F    C+ + F   ++S    ++   I+   +SG  G+  L+  +D+ VT +  +   + +L+ +++   +++ + N  SKL     + +    +V  ++  G       V +        LA+  +      SN   VLL  +V    V+ IN+    I +     E Y      V V  IR I +++  + I     L+  + S             +CWE  IGQ  YR  L+ F  S+    L + L+ +I               +++  +G   FD++     LI AQ + W+G +FCP L  + ++ LF++FY +    + N F+   +    +    F + +L       ++  +   +    PS  C PFR    P   +S  +++    T    ++      N + S+ FF  +  +++IITY+ +   +     I+ + ++I+NE  + +F  ++++  ++++
Sbjct:   49 NSISRAYRRSKNSL-----SEILNSISLWQKTLKIIGGKFGTSVLSYFNFLRWLLKFNIFSFILNFSFIIIP-----------------------QFTVA---------KKNTLQFTG-LEFFTGVGYFRDTVMYYGFYTNSTIQHGNSGAS------YNMQLAYIFTIGACLTTCFFSLLFSMAKYFRNNFINPHIYSG--GITKLIFCWDFTVTHEKAVKLKQKNLSTEIRENLSELRQEN--SKLTFNQLLTRFSAYMVAWVVSTG-------VAIACCAAVYYLAEYNLEFLKTHSNPGAVLLLPFV----VSCINLAVPCIYSMFRLVERYEMPRHEVYVLLIRNIFLKISIIGILCYYWLNTVALS-----------GEECWETLIGQDIYRLLLMDFVFSLVNSFLGEFLRRII-------------GMQLITSLGLQEFDIARNVLELIYAQTLVWIGIFFCPLLPFIQMIMLFIMFYSKNISLMMN-FQPPSKAWRASQMMTFFIFLLFFPSFTGVLCTLAITIWRLKPSADCGPFR--GLPLFIHSIYSWIDTLSTRPGYLWVVWIYRNLIGSVHFFFILTLIVLIITYLYWQITEGRKIMIRLLHEQIINEGKDKMFLIEKLIKLQDME 602          
BLAST of Transmembrane channel protein vs. Ensembl Human
Match: TMC5 (transmembrane channel like 5 [Source:HGNC Symbol;Acc:HGNC:22999])

HSP 1 Score: 87.8113 bits (216), Expect = 2.551e-17
Identity = 142/640 (22.19%), Postives = 270/640 (42.19%), Query Frame = 3
Query:   93 NEIIEIVEQSKLSLFYRKITGILEPLSIWYSSLKTIEKNCGCAVSSYFQFITWLMRINLWMFAIFLTVLLIPFLIKKPESFSDLIIDGNFTNNNDKFTLAVNCTQKAYVKDNPMTVEVIIDILNGKGLLVKSPMFIGYYFN--ISYFNMTGSEFTRPLYNTPVAYCFAFWLCXXXXXXXXXXXXGTNYKLYKIDEDEFSGKFGLC-LLTGFDYGVTKKNRILAMRNDLTKKLKIQYNQIEEFNYRSKLPKKSAIIKAFPKIVVNIIFIGFLCLIYFVIVEAQDVPIMLAQNKI----VKSNAILVLLKDYVPSVTVAMINVVFQIINTKVVRFENYT-KTVAVEVCFIRLILVQVISLLIFMVSLLDQTSQSNITDKVCQQTGAIKCWENFIGQQFYRYSLLLFFSSVFVKPLIQLLQSVIFNRFGKDPDSQNTKSKVVKLIGTAGFDLSEEGFVLINAQCVCWMGFWFCPXXXXXXXXXXXXXXYIRKAMFLRNLFETKMETATVAGGQKFLLGML-LNGLAFIMLPMGYILSNKSPSRGCSPFRIYDYPGDGYSFTTFLVEFVTSQSKIFSKIC--NFVTSLQFFLPVLGVLIIITYVKYAQAKTYSRSIQAIRKEILNEENNLLFYEKQMMNAKEID 1979
            N I     +SK SL     + IL  +S+W  +LK I    G +V SYF F+ WL++ N++ F +  + ++IP                       +FT+A         K N +     ++   G G    + M+ G+Y N  I + N   S      YN  +AY F    C+ + F   ++S    ++   I+   +SG  G+  L+  +D+ VT +  +   + +L+ +++   +++ + N  SKL     + +    +V  ++  G       V +        LA+  +      SN   VLL  +V    V+ IN+    I +     E Y      V V  IR I +++  + I     L+  + S             +CWE  IGQ  YR  L+ F  S+    L + L+ +I               +++  +G   FD++     LI AQ + W+G +FCP L  + ++ LF++FY +    + N F+   +    +    F + +L       ++  +   +    PS  C PFR    P   +S  +++    T    ++      N + S+ FF  +  +++IITY+ +   +     I+ + ++I+NE  + +F  ++++  ++++
Sbjct:   91 NSISRAYRRSKNSL-----SEILNSISLWQKTLKIIGGKFGTSVLSYFNFLRWLLKFNIFSFILNFSFIIIP-----------------------QFTVA---------KKNTLQFTG-LEFFTGVGYFRDTVMYYGFYTNSTIQHGNSGAS------YNMQLAYIFTIGACLTTCFFSLLFSMAKYFRNNFINPHIYSG--GITKLIFCWDFTVTHEKAVKLKQKNLSTEIRENLSELRQEN--SKLTFNQLLTRFSAYMVAWVVSTG-------VAIACCAAVYYLAEYNLEFLKTHSNPGAVLLLPFV----VSCINLAVPCIYSMFRLVERYEMPRHEVYVLLIRNIFLKISIIGILCYYWLNTVALS-----------GEECWETLIGQDIYRLLLMDFVFSLVNSFLGEFLRRII-------------GMQLITSLGLQEFDIARNVLELIYAQTLVWIGIFFCPLLPFIQMIMLFIMFYSKNISLMMN-FQPPSKAWRASQMMTFFIFLLFFPSFTGVLCTLAITIWRLKPSADCGPFR--GLPLFIHSIYSWIDTLSTRPGYLWVVWIYRNLIGSVHFFFILTLIVLIITYLYWQITEGRKIMIRLLHEQIINEGKDKMFLIEKLIKLQDME 644          
BLAST of Transmembrane channel protein vs. Ensembl Celegans
Match: tmc-1 (Transmembrane channel-like protein 1 [Source:UniProtKB/Swiss-Prot;Acc:D3KZG3])

HSP 1 Score: 60.077 bits (144), Expect = 6.037e-9
Identity = 79/338 (23.37%), Postives = 148/338 (43.79%), Query Frame = 3
Query:  177 WYSSLKTIEKNCGCAVSSYFQFITWLMRINLWMFAIFLTVLLIPFLIKKPESFSDLII-DGNFTNNNDKFTLAVNCTQKAYVKDNPMTVEVIIDILNGKGLLVKSPMFIGYYFNISYFNMTGSEFTRPLYNTPVAYCFAFWLCXXXXXXXXXXXXGTNYKLYKIDEDEFSGK-FGLCLLTGFDYGV----TKKNRILAMRNDLTKKLKIQYNQIEEFNYRSKLPKKSAIIKAFPKIVVNIIFIGFLCLIYFVIVEAQDVPIMLAQNKIVKSNAILVLLKDYVPSVTVAMINVVFQIINTKVVRFENYTKTVAVEVCFIRLILVQVISLLIFMVSLLDQ 1172
            W S +K IE + G  VSSYF F+ W++ +N     I +T++ + F++  PE+ +D +  +G F  N  K    +   ++ +  +       +  + +  G L  SP+F GYY +  +    G++     Y  P+AY          SF   +     N ++ K+   +     F   L TG+DY +    T  N ++A    +  KL+     I++  +      K  +++   ++  NII    L    + I       I   Q   V+ +  L   K+ VPSV V+ I  VF +I   + + ENY    A+     R++++  ++ +  + +L ++
Sbjct:  152 WESKIKRIESHFGSVVSSYFTFLRWIVFVN-----IMITLIALVFVV-LPETLADSVANEGRF--NRTKTRKQIPANERVHADE-------LAVVWHYDGYLRYSPLFYGYYSDDPFL---GNKIK---YALPLAYFMVTLTIFAYSFFAILRKMAANARMSKLSGSKAEQYIFNWKLFTGWDYTIGNSETASNTVMA----VVIKLRESIADIKKDAH-----GKFRLLQFSLRVFANIIICAMLGFSIYCI-------IFAVQKSQVQDDGNL-FTKNQVPSV-VSTITHVFPMIFDLIGKMENYHPRTALRAHLGRVLILYTVNYITLIFALFEK 450          
BLAST of Transmembrane channel protein vs. Ensembl Fly
Match: Tmc (gene:FBgn0267796 transcript:FBtr0347574)

HSP 1 Score: 53.5286 bits (127), Expect = 8.457e-7
Identity = 82/352 (23.30%), Postives = 148/352 (42.05%), Query Frame = 3
Query:  135 FYRKITGILEPLSIWYSSLKTIEKNCGCAVSSYFQFITWLMRINLWMFAIFLTVLLIPFLIKKPESFSDLIIDGNFTNNNDKFTLAVNCTQKAYVKDNPMTVEVIIDILNGKGLLVKSPMFIGYYFNISYFNMTGSEFTRPLYNTPVAYCFAFWLCXXXXXXXXXXXXGTNYKLYKIDEDEFSGKFGLCLLTGFD----YGVTKKNRILAMRNDLTKKLKIQYNQIEEFNYRSKLPKKSAIIKAFPKIVVNIIFIGFLCL----IYFVIVEAQDVPIMLAQNKIVKSNAILVLLKDYVPSVTVAMINVVFQIINTKVVRFENYTKTVAVEVCFIRLILVQVISLLIFMVSLL 1166
            + R+    L  L  W   +K IE + G  V+SYF F+ WLM +N     I + + L+ F+I  PE F+        T + +          +A V  N      +      +G L  SPMF GYY + S  + +        Y  P+AY     L  I SF+ T+     N +  K+   +    F   L TG+D    +  T  NRI ++     + L      +EE   +        I++   +I+VNI+ +G L L    +  ++  ++D   +   +  +  NA+         +VT+ +++    +I   +  FEN+     + +   R++++ +++L   M S +
Sbjct:  212 WKRETASFLTVLIPWELRIKEIESHFGSGVASYFTFLRWLMWVN-----IMIAIPLVAFVI-GPEYFA--------TKHGETDPRKRMSDPEARVAGN------LFTFWEFEGYLKYSPMFYGYYSSTSGISTS-------GYKLPLAYFLTAVLVYIYSFVATLRKMAENSRNSKLSSKDDECVFSWKLFTGWDFMIGHAETAHNRIASVVVGFKEAL------LEEAEKKKDNRNWRVILQ---RILVNILVMGLLGLSGATVVLLVNHSED---LAKHDNWLSRNAV---------NVTMTLLSFFLPMIFEALGLFENWHPRQQLRLQLARIMILNMLNLYSLMFSFI 515          
BLAST of Transmembrane channel protein vs. Ensembl Fly
Match: Tmc (gene:FBgn0267796 transcript:FBtr0347573)

HSP 1 Score: 53.1434 bits (126), Expect = 9.502e-7
Identity = 82/352 (23.30%), Postives = 148/352 (42.05%), Query Frame = 3
Query:  135 FYRKITGILEPLSIWYSSLKTIEKNCGCAVSSYFQFITWLMRINLWMFAIFLTVLLIPFLIKKPESFSDLIIDGNFTNNNDKFTLAVNCTQKAYVKDNPMTVEVIIDILNGKGLLVKSPMFIGYYFNISYFNMTGSEFTRPLYNTPVAYCFAFWLCXXXXXXXXXXXXGTNYKLYKIDEDEFSGKFGLCLLTGFD----YGVTKKNRILAMRNDLTKKLKIQYNQIEEFNYRSKLPKKSAIIKAFPKIVVNIIFIGFLCL----IYFVIVEAQDVPIMLAQNKIVKSNAILVLLKDYVPSVTVAMINVVFQIINTKVVRFENYTKTVAVEVCFIRLILVQVISLLIFMVSLL 1166
            + R+    L  L  W   +K IE + G  V+SYF F+ WLM +N     I + + L+ F+I  PE F+        T + +          +A V  N      +      +G L  SPMF GYY + S  + +        Y  P+AY     L  I SF+ T+     N +  K+   +    F   L TG+D    +  T  NRI ++     + L      +EE   +        I++   +I+VNI+ +G L L    +  ++  ++D   +   +  +  NA+         +VT+ +++    +I   +  FEN+     + +   R++++ +++L   M S +
Sbjct:  316 WKRETASFLTVLIPWELRIKEIESHFGSGVASYFTFLRWLMWVN-----IMIAIPLVAFVI-GPEYFA--------TKHGETDPRKRMSDPEARVAGN------LFTFWEFEGYLKYSPMFYGYYSSTSGISTS-------GYKLPLAYFLTAVLVYIYSFVATLRKMAENSRNSKLSSKDDECVFSWKLFTGWDFMIGHAETAHNRIASVVVGFKEAL------LEEAEKKKDNRNWRVILQ---RILVNILVMGLLGLSGATVVLLVNHSED---LAKHDNWLSRNAV---------NVTMTLLSFFLPMIFEALGLFENWHPRQQLRLQLARIMILNMLNLYSLMFSFI 619          
BLAST of Transmembrane channel protein vs. Ensembl Zebrafish
Match: tmc4 (transmembrane channel-like 4 [Source:ZFIN;Acc:ZDB-GENE-030131-7489])

HSP 1 Score: 117.087 bits (292), Expect = 1.121e-26
Identity = 125/538 (23.23%), Postives = 231/538 (42.94%), Query Frame = 3
Query:  156 ILEPLSIWYSSLKTIEKNCGCAVSSYFQFITWLMRINLWMFAIFLTVLLIPFLIKKPESFSDLIIDGNFTNNNDKFTLAVNCTQKAYVKDNPMTV-EVIIDILNGKGLLVKSPMFIGYYFNISYFNMTGSEFTRPLYNTPVAY----CFAFWLCXXXXXXXXXXXXGTNYKLYKIDEDEFSGKFGLCLLTGFDYGVTKKNRILAMRNDLTKKLKIQYNQIEEFNYRSKLPKKSAIIKAFP-------KIVVNIIFIGFLCLIYFVIVEAQDVPIMLAQNKIVKSNAILVLLKDYVPSVTVAMINVVFQIINTKVVRFENYTKTVAVEVCFIRLILVQVISLLIFMVSLLDQ-TSQSNITDKVCQQTG----AIKCWENFIGQQFYRYSLLLFFSSVFVKPLIQLLQSVIFNRFGKDPDSQNTKSKVVKLIGTAGFDLSEEGFVLINAQCVCWMGFWFCPXXXXXXXXXXXXXXYIRKAMFLRNLFET----KMETATVAGGQKFLLGMLLNGLAFIMLPMGYILSNKSPSRGCSPFRI 1706
            IL    +W   ++ I  + G  V SYF F+ +L+ +N     +    +LIP ++ +  +F+      N T  N   T    C Q     D  M      +D+++G G +  S +F GYY      N T  E     YN P+AY     F F  C     I      G   ++        +G + + + TG+D+G+     +   +N++  +L++    +EE     +L KK+A +           +I +N+I +  +   +F I +A         ++ +K+     LL  Y+PS+ +   N V  ++  K+   E Y+ +  V +  +R + ++++SL + + +L +Q T +  I    C+  G      KCWE  +GQ+ Y+ +L  F  +V    L++  + ++ +         +   K+ +L+G   F ++     L+ +Q V W G  FCP L  +  L   + +Y +K    +N        +  T+        L G +L  +  +     Y ++   PS GC PFR+
Sbjct:  110 ILSYFVLWKRGIQRIGGHFGGGVQSYFLFLRFLVILNFLSSLLIAAFVLIPSIVFRSLNFNS---TSNITIVNT--TGLETCMQYDPKPDALMVFFNYFLDLVSGTGFMEYSYLFYGYY------NNTMIESDGFSYNIPLAYLLTAAFYFLFCFFCIIIRM----GGTARVVVETGAGAAGGYCMLVFTGWDHGLQGDRAVKLKQNNVRYRLQVD---LEE----ERLKKKAASLTLGQTVSLYALRIFLNLIVLTLIVATFFGIAKATQF------SQSMKTTGFTGLLLQYLPSMVITASNFVVPLLCDKIALLEKYSPSTTVILALLRAVFLRLVSLGVLLYTLWEQITCKGEIGSDDCKLCGYYYNQYKCWETRVGQEMYKLTLFDFLITVATLILVEFPRRIVVD---------HCSCKLSQLVGRQEFLVAPNVLALVYSQTVVWTGALFCPLLPFINTLKFVIFYYCKKITLFQNCQPATRNFRSTTSNFFFLLVLLFGWMLASVVLL-----YSVAKIHPSYGCGPFRL 605          
BLAST of Transmembrane channel protein vs. Ensembl Zebrafish
Match: tmc8 (transmembrane channel-like 8 [Source:ZFIN;Acc:ZDB-GENE-081114-2])

HSP 1 Score: 92.0485 bits (227), Expect = 8.038e-19
Identity = 122/535 (22.80%), Postives = 221/535 (41.31%), Query Frame = 3
Query:  141 RKITGILEPLSIWYSSLKTIEKNCGCAVSSYFQFITWLMRINLWMFAIFLTVLLIPFLIKKPESFSDLIIDGNFTNNNDKFTLAVNCTQKAYVKDNPMTVEVIIDILNGKGLLVKSPMFIGYYFNISYFNMTGSEFTRPLYNTPVAYCFAFWLCXXXXXXXXXXXXGTNYKLYKIDEDEFSGKFGLCLLTGFDYGVTKKNRILAMRNDLTKKLKIQYNQIEEFNYRSKLPKKS-------AIIKAFPKIVVNIIFIGFLCLIYFVIVEAQDVPIMLAQNKIVKSNAILVLLKDYVPSVTVAMINVVFQIINTKVVRFENYTKTVAVEVCFIRLILVQVISLLI----FMVSLLD----QTSQSNITDKVCQQTGAIKCWENFIGQQFYRYSLLLFFSSVFVKPLIQLLQSVIFNRFGKDPDSQNTKSKVVKLIGTAGFDLSEEGFVLINAQCVCWMGFWFCPXXXXXXXXXXXXXXYIRKAMFLRNLFETKMETATVAGGQKFLLGMLLNGLAFIMLPMGYILSNKSPSRGCSPF 1700
            R ++G+L     W   +  IE   G  V +YF F+ +L+ +NL    I    +L+P L+ + ES                               NP    +  D+  G G+L KS +F  +Y        T         NTP+ +       I  S I+ +  +   YK   I    FS      + +G+D+ +         +N    +LK+    +EE  + +++ +++        + +    + V  +  G   LIY+ I           Q      +   V+LK Y+P +T+ +IN+    I TK+  FE+Y+ T+ + +  IR I +++ SL I    F+ +  D    Q  Q   T K  Q    I C EN  G++ Y+ ++       F    +   ++ +  +F          S++ +++G   F+++     L+N+Q V W+G ++CP L  +  L L +L+YI+K   +R     +    T +    F   +LL GL   ++ +   ++  +P  GC PF
Sbjct:  121 RAVSGLLP----WRHMIHRIEGQFGVGVKAYFVFLRYLLGLNLLYCVIIGGSVLVPTLVYRGESTE---------------------------TQNPDWSSLYKDMFVGSGVLEKSAVFHSFY--------TRGSLDGACLNTPLLFLLGMVSIIFLSIIMLVRRTVVGYKHSWITGKHFSSNLSYKVFSGWDFSIQSPQAASLKQNFTRNELKMD---LEEQAFHARVKQRTLTQWVRLVLFRILLNLAVLFLLTGSFVLIYYAI---------HLQQSCTDESTECVMLK-YLPPITMTLINIALPRIFTKISEFEDYSLTIQLNLTLIRSIFLKLASLSIYLFFFICADKDYQFCQFGQKKKTLKPSQHNRTILCEENEFGKEMYKLTIFNLLEGFFSAFCVAYPRTFLVEKF--------PSSRLAQILGNNQFEITLNVLDLVNSQTVMWVGVFYCPLLPAISTLRLLILYYIKKFTVMRCCAPAQRMFRTASSSVLFHFTLLL-GLFMSVVTLVVNINRFNPG-GCGPF 593          
BLAST of Transmembrane channel protein vs. Ensembl Zebrafish
Match: tmc8 (transmembrane channel-like 8 [Source:ZFIN;Acc:ZDB-GENE-081114-2])

HSP 1 Score: 85.5001 bits (210), Expect = 8.306e-17
Identity = 117/527 (22.20%), Postives = 217/527 (41.18%), Query Frame = 3
Query:  141 RKITGILEPLSIWYSSLKTIEKNCGCAVSSYFQFITWLMRINLWMFAIFLTVLLIPFLIKKPESFSDLIIDGNFTNNNDKFTLAVNCTQKAYVKDNPMTVEVIIDILNGKGLLVKSPMFIGYYFNISYFNMTGSEFTRPLYNTPVAYCFAFWLCXXXXXXXXXXXXGTNYKLYKIDEDEFSGKFGLCLLTGFDYGVTKKNRILAMRNDLTKKLKIQYNQIEEFNYRSKLPKKS-------AIIKAFPKIVVNIIFIGFLCLIYFVIVEAQDVPIMLAQNKIVKSNAILVLLKDYVPSVTVAMINVVFQIINTKVVRFENYTKTVAVEVCFIRLILVQVISLLIFMVSLLDQTSQSNITDKVCQQTGAIKCWENFIGQQFYRYSLLLFFSSVFVKPLIQLLQSVIFNRFGKDPDSQNTKSKVVKLIGTAGFDLSEEGFVLINAQCVCWMGFWFCPXXXXXXXXXXXXXXYIRKAMFLRNLFETKMETATVAGGQKFLLGMLLNGLAFIMLPMGYILSNKSPSRGCSPF 1700
            R ++G+L     W   +  IE   G  V +YF F+ +L+ +NL    I    +L+P L+ + ES                               NP    +  D+  G G+L KS +F  +Y        T         NTP+ +       I  S I+ +  +   YK   I    FS      + +G+D+ +         +N    +LK+    +EE  + +++ +++        + +    + V  +  G   LIY+ I           Q      +   V+LK Y+P +T+ +IN+    I TK+  FE+Y+ T+ + +  IR I +++ SL I++   +         DK  Q      C EN  G++ Y+ ++       F    +   ++ +  +F          S++ +++G   F+++     L+N+Q V W+G ++CP L  +  L L +L+YI+K   +R     +    T +    F   +LL GL   ++ +   ++  +P  GC PF
Sbjct:  121 RAVSGLLP----WRHMIHRIEGQFGVGVKAYFVFLRYLLGLNLLYCVIIGGSVLVPTLVYRGESTE---------------------------TQNPDWSSLYKDMFVGSGVLEKSAVFHSFY--------TRGSLDGACLNTPLLFLLGMVSIIFLSIIMLVRRTVVGYKHSWITGKHFSSNLSYKVFSGWDFSIQSPQAASLKQNFTRNELKMD---LEEQAFHARVKQRTLTQWVRLVLFRILLNLAVLFLLTGSFVLIYYAI---------HLQQSCTDESTECVMLK-YLPPITMTLINIALPRIFTKISEFEDYSLTIQLNLTLIRSIFLKLASLSIYLFFFI-------CADKDYQ------CEENEFGKEMYKLTIFNLLEGFFSAFCVAYPRTFLVEKF--------PSSRLAQILGNNQFEITLNVLDLVNSQTVMWVGVFYCPLLPAISTLRLLILYYIKKFTVMRCCAPAQRMFRTASSSVLFHFTLLL-GLFMSVVTLVVNINRFNPG-GCGPF 572          
BLAST of Transmembrane channel protein vs. Ensembl Zebrafish
Match: tmc5 (transmembrane channel like 5 [Source:ZFIN;Acc:ZDB-GENE-120411-6])

HSP 1 Score: 83.5741 bits (205), Expect = 3.657e-16
Identity = 141/638 (22.10%), Postives = 262/638 (41.07%), Query Frame = 3
Query:  117 QSKLSLFYRK----ITGILEPLSIWYSSLKTIEKNCGCAVSSYFQFITWLMRINLWMFAIFLTVLLIPFLIKKPESFSDLIIDGNFTNNNDKFTLAVNCTQKAYVKDNPMTVEVIIDILNGKGLLVKSPMFIGYYFNISYFNMTGSEF-TRPLYNTPVAYCFAFW----LCXXXXXXXXXXXXGTNYKLYKIDEDEFSGKFGLCLLTGFDYGVTKKNRILAMRNDLTKKLKIQYNQIEEFNYRSKLPKKSAIIKAFPKIVVNIIFI--------GFLCLIYFVIVEAQDVPIMLAQNKIVKSNAILVLLKDYVPSVTVAMINVVFQIINTKVVRFENYTKTVA-VEVCFIRLILVQVISLLIFMVSLLDQTSQSNITDKVCQQTGAIKCWENFIGQQFYRYSLLLFFSSVFVKPLIQLLQSVIFNRFGKDPDSQNTKSKVVKLIGTAGFDLSEEGFVLINAQCVCWMGFWFCPXXXXXXXXXXXXXXYIRKAMFLRNLFETKMETATVAGGQKFLLGMLLNGLAFIMLPM-GYILSNKSPSRGCSPFRIYDYPGDGYSFTTFLVEFVTSQSKIFSKICNFVTSLQFFLPVLGVLIIITYVKYAQAKTYSRSIQAIRKEILNEENNLLFYEKQMMNAKE 1973
            + ++SL +R+    +T   + L +W  +LK I    G +V SYF F+ WL++ N++ F I    + IP ++  P                       N +     +         +++L G G   ++ +F G Y         G    ++P YN  +AY F       LC +S       S   N+ L   +    SG     LL  +D+ V  +  I   +N+L  +LK      E  + R ++  K ++      + +N++          G    IYF+  E          N +V   + L+L       V V++IN++  ++ + + + E Y+   A + +   R I++++  L I     L+      + DK       I CWE+F+GQ  YR   LL    +F       L  + F  F ++       +  ++ +G   FD++     LI AQ + W+G +F P L V+ +L LF++FY++K     N    K  T   A  Q   + +L        L M  + + +  PS  C PF+    P       T  ++       ++    N + S  F+  +  ++++IT+  +   +   + I+++R++I+N   +  F   ++ N + 
Sbjct:   83 RQQVSLSFRRFRASLTSARQRLVVWQDTLKEIGGRFGTSVLSYFLFLKWLLKFNVFSFVINFCFITIPQIVHAP-----------------------NISHVTGFRG--------LELLTGVGYFNQTVLFYGGY--------DGEVIVSKPAYNMQLAYFFTIAAYMVLCGLSLIYSMSRSFQKNFVL---ETGPVSGG-AWRLLCSWDFSVVNEKAIQYNKNNLGIQLK------ESLSERLQMKNKISLSDRIKHLSLNLVAWLLCLLLALGSGAGIYFLGTEQLTFSFNQDPNDLVSEASTLLL------PVVVSLINLIVPLLYSLIGKMETYSNPRAKIYISIARNIILKMSLLGILCFYWLN-----FVPDK-------IPCWESFVGQSVYR---LLIIDFIFC------LLGIFFGEFLRNV----IGTMCIQSLGVPEFDIARNVLDLIYAQTLAWIGIYFSPLLPVMQVLKLFIIFYLKKLSLSMNCQPPK-HTGRAAQIQTVFIALLFFPSFVGALSMVAFTVWSLQPSDQCGPFQGLKTPFHTIFNWTDSIQGPPETHWVWWIFENVLRSELFYYLISLIVLVITFFLWQITQGRKQLIKSLREQIVNGGKDKAFLLNKLQNIQR 639          
BLAST of Transmembrane channel protein vs. Ensembl Zebrafish
Match: tmc6b (transmembrane channel-like 6b [Source:ZFIN;Acc:ZDB-GENE-040718-460])

HSP 1 Score: 67.0106 bits (162), Expect = 4.911e-11
Identity = 100/441 (22.68%), Postives = 184/441 (41.72%), Query Frame = 3
Query:  450 IDILNGKGLLVKSPMFIGYYFNISYFNMTGSEFTRPL----------YNTPVAYCF----AFWLCXXXXXXXXXXXXGTNYKLYKIDEDEFSGKFGLCLLTGFDYGVTKKNRILAMRNDLTKKLKIQYNQIEEFNYRSKLPKKSAIIKAFPKIVVNIIFIG-----FLCLIYFVIVEAQDVPIMLAQNK---IVKSNAILVLLKDYVPSVTVAMINVVFQIINTKVVRFENY-TKTVAVEVCFIRLILVQVISLLIFMVSLLDQTSQSNITDKVCQQTGAIKCWENFIGQQFYRYSLLLFFSSVFVKPLIQLLQSVIFNRFGKDPDSQNTKSKVVKLIGTAGFDLSEEGFVLINAQCVCWMGFWFCPXXXXXXXXXXXXXXYIRKAMFLRNLFETKMETATVAGGQKFLLGMLLNGLAFIMLPMGYILSNKSPSRGCSPFR 1703
            + +L G G    S ++ GYY N +    +G   ++            YN P+ Y F    AF++  I        S G ++++     D+  G   + + + +DY V+KK+ +   R +++ +LK    ++     +S L ++  + + F  ++  I+ +G      L + YF     +D+   +  +    ++K  ++L      VP V V+ IN++       V   E Y + +V   V   R +L++V  L +     L + +          Q   ++CWE+F+GQ+ YR+ L+ F         I +L    F  F     SQ    +  K +    FD++     LI  Q + W+G  F P L V+ ++ L  LFY++K   + N   +            F+  +         + + Y +    PS GC PFR
Sbjct:   15 LKVLTGAGYFSDSVLYYGYYSNQTL--QSGRRCSQSSNGTSCDAAFSYNMPLVYFFTIGAAFFITCIILVYSMSKSFGRSFRI-----DKSKGLLAIKVFSSWDYKVSKKSSVRLQRANISTQLKELVAEVNRQELKSPLLQR--LFRIFIHMLAWIMCLGSTLASVLGVYYFSEYMHKDLTSRVRSSSSDSLLKEASLLA-----VP-VLVSSINLLLPGFFNAVAWMEEYDSPSVLNYVSISRNLLLKVSVLGVLCFHWLGRVAMD-------PQILGLQCWESFVGQELYRFLLMDF---------IFMLLDTFFGEFLWRLFSQKALKRKRKPV----FDIARNVLELIYGQTLAWLGVLFSPLLPVVQIIKLLFLFYMKKVSLMMNCQVSGKPWRASQMTTIFITLLCFPSFLGAAVCVTYTMWTMKPSAGCGPFR 420          
BLAST of Transmembrane channel protein vs. Ensembl Xenopus
Match: TMC7 (transmembrane channel like 7 [Source:NCBI gene;Acc:100493700])

HSP 1 Score: 132.109 bits (331), Expect = 2.443e-31
Identity = 144/621 (23.19%), Postives = 270/621 (43.48%), Query Frame = 3
Query:  168 LSIWYSSLKTIEKNCGCAVSSYFQFITWLMRINLWMFAIFLTVLLIPFLIKKPESFSDLIIDGNFTNNNDKFTLA-VNCTQKA-------YVKDNPMTVEVIIDILNGKGLLVKSPMFIGYYFNISYFNMTGSEFTRPLYNTPVAYCFAFWLCXXXXXXXXXXXXGTNYKLYKI-DEDEFSGKFGLCLLTGFDYGVTKKNRILAMRNDLTKKLKIQYNQIEEFNYRSKLPKKSAIIKAFPKIVVNIIFIGFLCLIYFVIVEAQDVPIMLAQNKIVKSNAILV-LLKDYVPSVTVAMINVVFQIINTKVVRFENYTKTVAVEVCFIRLILVQVISLLIFMVSLLDQ-TSQSNITDKVCQQTGAI-KCWENFIGQQFYRYSLLLFFSSVFVKPLIQLLQSVIFNRFGKDPDSQNTKSKVVKLIGTAGFDLSEEGFVLINAQCVCWMGFWFCPXXXXXXXXXXXXXXYIRKAMFLRNLFETKMETATVAGGQKFLLGMLLNGLAFIMLPMGYILSNKSPSRGCSPFRIYDYPGDGYSFTTFLVEFVTSQSKIF----SKICNFVTSLQFFLPVLGVLIIITYVKYAQAKTYSRSIQAIRKEILNEENNLLFYEKQMMNAKEIDL 1982
            L++W  ++  IE   G  + SYF F+ +L+ +N  MF +      +P  I K          G F ++N   +LA   CT  +       Y   N      IID+L+G G L  + +F GYY       +    F    Y+ P+AY      C++ S    +  +   +K   + DED+F   +   +  G+D+ +T +       + L  +LK    +      + K  +       F + ++NII IG L   ++ I  A           +  SNA  + LL +Y+PS+ + + N+V  +I   +VR+E+Y+    +    IR + V++ S+ + ++SL  + TS  N T  +C     +  CWE+ +GQ+ Y+   L+ F  + +  L       +F  F +        SK+V+  G   F++ +    ++  Q +CW+G ++ P L  +  +  F++FYI+K   + N           +    F   +LL GL    +P+G+ ++    S+ C  F          +FTT   E + +  K F     K    + S  F +P   +  ++ +   A A  + + ++ +++++  E  + LF  +++     I +
Sbjct:  113 LTLWRGNIHNIEGKFGTGIGSYFSFLRFLVILNFVMFLLMFCFTTLPVAISK---------QGAFNSSNIIPSLADSECTYYSPGGYGLLYFYSN------IIDLLSGTGFLELTYLFYGYY------TIETVTFYVFNYSLPLAYVLVTISCLLLSIAWIVKRAVNGFKQSLVHDEDKFQS-YCNKIFAGWDFCITDQYSASLKHSSLQYELKTDLAEERIRQRKQKRTRGETFRIYFFRFLLNIIVIGVLAGSFYAIYRA----------TVSGSNADPINLLVEYLPSIVITIANIVTPLIFESIVRYEDYSPAFEIRFTLIRCVFVRLASIAVLLISLWTRITSCQNQTCNLCGYNYKMYPCWESRVGQEMYK---LMIFDFLIIVAL------TLFVEFPRKLMVTYWSSKLVQWWGQQEFEIPQNVLEIVYGQTICWIGIFYSPLLPAIATVKYFIIFYIKKISLIENC-RPSTRPFRASSSNFFFQVILLIGLVLACIPVGFGIAYIPASKACGLF---------VNFTTSW-EIIPTVVKTFPNGLQKFIYVIASESFAVPFFLLSCLVMFYFIALAGAHKKVVEQLQEQLAMESRDKLFLIRRLTEVHHIKV 681          
BLAST of Transmembrane channel protein vs. Ensembl Xenopus
Match: TMC7 (transmembrane channel like 7 [Source:NCBI gene;Acc:100493700])

HSP 1 Score: 128.257 bits (321), Expect = 3.938e-30
Identity = 142/624 (22.76%), Postives = 268/624 (42.95%), Query Frame = 3
Query:  168 LSIWYSSLKTIEKNCGCAVSSYFQFITWLMRINLWMFAIFLTVLLIPFLIKKPESFSDLIIDGNFTNNNDKFTLA-VNCTQKA-------YVKDNPMTVEVIIDILNGKGLLVKSPMFIGYYFNISYFNMTGSEFTRPLYNTPVAYCFAFWLCXXXXXXXXXXXXGTNYKLYKI-DEDEFSGKFGLCLLTGFDYGVTKKNRILAMRNDLTKKLKIQYNQIEEFNYRSKLPKKSAIIKAFPKIVVNIIFIGFLCLIYFVIVEAQDVPIMLAQNKIVKSNAILVLLKD----YVPSVTVAMINVVFQIINTKVVRFENYTKTVAVEVCFIRLILVQVISLLIFMVSLLDQ-TSQSNITDKVCQQTGAI-KCWENFIGQQFYRYSLLLFFSSVFVKPLIQLLQSVIFNRFGKDPDSQNTKSKVVKLIGTAGFDLSEEGFVLINAQCVCWMGFWFCPXXXXXXXXXXXXXXYIRKAMFLRNLFETKMETATVAGGQKFLLGMLLNGLAFIMLPMGYILSNKSPSRGCSPFRIYDYPGDGYSFTTFLVEFVTSQSKIF----SKICNFVTSLQFFLPVLGVLIIITYVKYAQAKTYSRSIQAIRKEILNEENNLLFYEKQMMNAKEIDL 1982
            L++W  ++  IE   G  + SYF F+ +L+ +N  MF +      +P  I K          G F ++N   +LA   CT  +       Y   N      IID+L+G G L  + +F GYY       +    F    Y+ P+AY      C++ S    +  +   +K   + DED+F   +   +  G+D+ +T +       + L  +LK    +      + K  +       F + ++NII IG L   ++ I  A    +  +     K +A  V        Y+PS+ + + N+V  +I   +VR+E+Y+    +    IR + V++ S+ + ++SL  + TS  N T  +C     +  CWE+ +GQ+ Y+   L+ F  + +  L       +F  F +        SK+V+  G   F++ +    ++  Q +CW+G ++ P L  +  +  F++FYI+K   + N           +    F   +LL GL    +P+G+ ++    S+ C  F          +FTT   E + +  K F     K    + S  F +P   +  ++ +   A A  + + ++ +++++  E  + LF  +++     I +
Sbjct:  135 LTLWRGNIHNIEGKFGTGIGSYFSFLRFLVILNFVMFLLMFCFTTLPVAISK---------QGAFNSSNIIPSLADSECTYYSPGGYGLLYFYSN------IIDLLSGTGFLELTYLFYGYY------TIETVTFYVFNYSLPLAYVLVTISCLLLSIAWIVKRAVNGFKQSLVHDEDKFQS-YCNKIFAGWDFCITDQYSASLKHSSLQYELKTDLAEERIRQRKQKRTRGETFRIYFFRFLLNIIVIGVLAGSFYAIYRATVYSLENSNTNNKKQSATYVFPLGIYIIYLPSIVITIANIVTPLIFESIVRYEDYSPAFEIRFTLIRCVFVRLASIAVLLISLWTRITSCQNQTCNLCGYNYKMYPCWESRVGQEMYK---LMIFDFLIIVAL------TLFVEFPRKLMVTYWSSKLVQWWGQQEFEIPQNVLEIVYGQTICWIGIFYSPLLPAIATVKYFIIFYIKKISLIENC-RPSTRPFRASSSNFFFQVILLIGLVLACIPVGFGIAYIPASKACGLF---------VNFTTSW-EIIPTVVKTFPNGLQKFIYVIASESFAVPFFLLSCLVMFYFIALAGAHKKVVEQLQEQLAMESRDKLFLIRRLTEVHHIKV 716          
BLAST of Transmembrane channel protein vs. Ensembl Xenopus
Match: TMC4 (transmembrane channel like 4 [Source:NCBI gene;Acc:101732113])

HSP 1 Score: 125.561 bits (314), Expect = 2.342e-29
Identity = 145/609 (23.81%), Postives = 276/609 (45.32%), Query Frame = 3
Query:  135 FYRKITGILEPLSIWYSSLKTIEKNCGCAVSSYFQFITWLMRINLWMFAIFLTVLLIPFLIKKPESFSDLIIDGNFTNNNDKFTLAV--NCTQKAYVKDNPMTVEVIIDILNGKGLLVKSPMFIGYYFNISYFNMTGSEFTRPLYNTPVAYCFAFWLCXXXXXXXXXXXXGTNYKLYKIDEDEFSGKFGLCLLTGFDYGVTKKNRILAMRNDLTKKLKIQYNQIEEFNYRSKLPKKSAIIKA--------FPKIVVNIIFIGFLCLIYFVIVEAQDVPIMLAQNKIVKSNAILVLLKDYVPSVTVAMINVVFQIINTKVVRFENYTKTVAVEVCFIRLILVQVISLLIFMVSLLDQ-TSQSNITDKVCQQTG----AIKCWENFIGQQFYRYSLLLFFSSVFVKPLIQLLQSVIFNRFGKDPDSQNTKSKVVKLIGTAGFDLSEEGFVLINAQCVCWMGFWFCPXXXXXXXXXXXXXXYIRKAMFLRNLFETKMETATVAGGQKFLLGMLLNGLAFIMLPMGYILSNKSPSRGCSPFRIYDYPGDGYSFTTFLVEFVTSQSKIFSKICNFVTSLQFFLPVLGVLIIITYVKYAQAKTYSRSIQAIRKEI 1916
            F  K +  L+ L +W  ++ TI  N G  ++SYF F+ +L+ +NL  F +    ++IP ++ +  + +      N +N   K  +AV   C       +   T   I+DIL G G +  + MF G+Y N     +  +EF    YN P+AY        + S +  +  S   +K   + E+     +   +  G+D+ + K  RI+ ++   + + ++Q + +EE N + K  +++   +A        F  +V+ +    F C IY   V +Q +         VK N IL L+  Y+PS+ +   N    I+   ++++E YT +  + +  IR + +++ SL + + SL D+ T      D  C   G      KCWE  +GQ+ Y+  LL+F         + +L  ++   F +     +   K ++  G   F + +    ++  Q VCW+G +FCP L +L  +  F++FY+++     N       T   +    F + +LL GLA   +P+ Y + + +PS+ C PF+  +   +    T      + +  K  ++   F+ S  F +P+     I+ +   A A +Y + +  ++ ++
Sbjct:   35 FQSKASESLQFLVLWRRTINTIGGNFGTGIASYFTFLRFLILMNLVTFLLIGGFIVIPNIVFQELNVNQTSQSSN-SNGRSKAQIAVFQGCQYSGSGLERYYTF--IMDILMGTGFMELTYMFYGFYKNTL---VILAEF---YYNLPLAYLTTTLFYFLLSLVWIVVRSVKGFKQSLVTENTQLSNYTSKIFVGWDFCI-KDPRIVKLKQK-SIRYELQMD-LEEENMKRKHAERTTSQRATIYTLRVFFNLVVICLTGAAFYC-IYLSTVNSQVLS--------VKENFILDLVVGYLPSIVITAANFFLPIVFGIIIQWEKYTLSWEIRLTLIRCVFLRLASLGMLLYSLWDKITCSGTPQDAQCVTCGYNIDQYKCWETRVGQEMYK--LLIF-------DFLTVLVVILLVDFPRKMMVDHCSCKPIQFWGQQEFLVPQNVLDIVYGQTVCWIGTFFCPLLPLLNTVKYFIIFYLKRLTLFANC-RPADRTFRASSANFFFMLVLLLGLAISWVPVLYSIFSMTPSKACGPFQGQNKIWETVPMT------IETLPKTAAEFFMFIGSQAFVVPLF--CFILMFYLIALASSYGKLVMTLKDQL 604          
BLAST of Transmembrane channel protein vs. Ensembl Xenopus
Match: TMC7 (transmembrane channel like 7 [Source:NCBI gene;Acc:100493700])

HSP 1 Score: 124.02 bits (310), Expect = 8.332e-29
Identity = 136/571 (23.82%), Postives = 243/571 (42.56%), Query Frame = 3
Query:  168 LSIWYSSLKTIEKNCGCAVSSYFQFITWLMRINLWMFAIFLTVLLIPFLIKKPESFSDLIIDGNFTNNNDKFTLA-VNCTQKA-------YVKDNPMTVEVIIDILNGKGLLVKSPMFIGYYFNISYFNMTGSEFTRPLYNTPVAYCFAFWLCXXXXXXXXXXXXGTNYKLYKI-DEDEFSGKFGLCLLTGFDYGVTKKNRILAMRNDLTKKLKIQYNQIEEFNYRSKLPKKSAIIKAFPKIVVNIIFIGFLCLIYFVIVEAQDVPIMLAQNKIVKSNAILVLLKD----YVPSVTVAMINVVFQIINTKVVRFENYTKTVAVEVCFIRLILVQVISLLIFMVSLLDQ-TSQSNITDKVCQQTGAI-KCWENFIGQQFYRYSLLLFFSSVFVKPLIQLLQSVIFNRFGKDPDSQNTKSKVVKLIGTAGFDLSEEGFVLINAQCVCWMGFWFCPXXXXXXXXXXXXXXYIRKAMFLRNLFETKMETATVAGGQKFLLGMLLNGLAFIMLPMGYILSNKSPSRGCSPFRIYDYPGDGYSFTTFLVEFVTSQSKIFSKICNFVTSLQFFLPVLG 1835
            L++W  ++  IE   G  + SYF F+ +L+ +N  MF +      +P  I K          G F ++N   +LA   CT  +       Y   N      IID+L+G G L  + +F GYY       +    F    Y+ P+AY      C++ S    +  +   +K   + DED+F   +   +  G+D+ +T +       + L  +LK    +      + K  +       F + ++NII IG L   ++ I  A    +  +     K +A  V        Y+PS+ + + N+V  +I   +VR+E+Y+    +    IR + V++ S+ + ++SL  + TS  N T  +C     +  CWE+ +GQ+ Y+   L+ F  + +  L       +F  F +        SK+V+  G   F++ +    ++  Q +CW+G ++ P L  +  +  F++FYI+K   + N           +    F   +LL GL    +P+G+ ++    S+ C  F                V F TS   I + +  F   LQ F+ V+ 
Sbjct:  135 LTLWRGNIHNIEGKFGTGIGSYFSFLRFLVILNFVMFLLMFCFTTLPVAISK---------QGAFNSSNIIPSLADSECTYYSPGGYGLLYFYSN------IIDLLSGTGFLELTYLFYGYY------TIETVTFYVFNYSLPLAYVLVTISCLLLSIAWIVKRAVNGFKQSLVHDEDKFQS-YCNKIFAGWDFCITDQYSASLKHSSLQYELKTDLAEERIRQRKQKRTRGETFRIYFFRFLLNIIVIGVLAGSFYAIYRATVYSLENSNTNNKKQSATYVFPLGIYIIYLPSIVITIANIVTPLIFESIVRYEDYSPAFEIRFTLIRCVFVRLASIAVLLISLWTRITSCQNQTCNLCGYNYKMYPCWESRVGQEMYK---LMIFDFLIIVAL------TLFVEFPRKLMVTYWSSKLVQWWGQQEFEIPQNVLEIVYGQTICWIGIFYSPLLPAIATVKYFIIFYIKKISLIENC-RPSTRPFRASSSNFFFQVILLIGLVLACIPVGFGIAYIPASKACGLF----------------VNFTTSWEIIPTVVKTFPNGLQKFIYVIA 657          
BLAST of Transmembrane channel protein vs. Ensembl Xenopus
Match: TMC7 (transmembrane channel like 7 [Source:NCBI gene;Acc:100493700])

HSP 1 Score: 123.635 bits (309), Expect = 1.249e-28
Identity = 134/560 (23.93%), Postives = 239/560 (42.68%), Query Frame = 3
Query:  168 LSIWYSSLKTIEKNCGCAVSSYFQFITWLMRINLWMFAIFLTVLLIPFLIKKPESFSDLIIDGNFTNNNDKFTLAVNCTQKAYVKDNPMTVEVIIDILNGKGLLVKSPMFIGYYFNISYFNMTGSEFTRPLYNTPVAYCFAFWLCXXXXXXXXXXXXGTNYKLYKI-DEDEFSGKFGLCLLTGFDYGVTKKNRILAMRNDLTKKLKIQYNQIEEFNYRSKLPKKSAIIKAFPKIVVNIIFIGFLCLIYFVIVEAQDVPIMLAQNKIVKSNAILV-LLKDYVPSVTVAMINVVFQIINTKVVRFENYTKTVAVEVCFIRLILVQVISLLIFMVSLLDQ-TSQSNITDKVCQQTGAI-KCWENFIGQQFYRYSLLLFFSSVFVKPLIQLLQSVIFNRFGKDPDSQNTKSKVVKLIGTAGFDLSEEGFVLINAQCVCWMGFWFCPXXXXXXXXXXXXXXYIRKAMFLRNLFETKMETATVAGGQKFLLGMLLNGLAFIMLPMGYILSNKSPSRGCSPFRIYDYPGDGYSFTTFLVEFVTSQSKIFSKICNFVTSLQFFLPVLG 1835
            L++W  ++  IE   G  + SYF F+ +L+ +N  MF + L + LI   +  P S       G +                 Y   N      IID+L+G G L  + +F GYY       +    F    Y+ P+AY      C++ S    +  +   +K   + DED+F   +   +  G+D+ +T +       + L  +LK    +      + K  +       F + ++NII IG L   ++ I  A           +  SNA  + LL +Y+PS+ + + N+V  +I   +VR+E+Y+    +    IR + V++ S+ + ++SL  + TS  N T  +C     +  CWE+ +GQ+ Y+   L+ F  + +  L       +F  F +        SK+V+  G   F++ +    ++  Q +CW+G ++ P L  +  +  F++FYI+K   + N           +    F   +LL GL    +P+G+ ++    S+ C  F                V F TS   I + +  F   LQ F+ V+ 
Sbjct:  135 LTLWRGNIHNIEGKFGTGIGSYFSFLRFLVILNFVMFLLILVIHLINTCLLFPNSECTYYSPGGYG--------------LLYFYSN------IIDLLSGTGFLELTYLFYGYY------TIETVTFYVFNYSLPLAYVLVTISCLLLSIAWIVKRAVNGFKQSLVHDEDKFQS-YCNKIFAGWDFCITDQYSASLKHSSLQYELKTDLAEERIRQRKQKRTRGETFRIYFFRFLLNIIVIGVLAGSFYAIYRA----------TVSGSNADPINLLVEYLPSIVITIANIVTPLIFESIVRYEDYSPAFEIRFTLIRCVFVRLASIAVLLISLWTRITSCQNQTCNLCGYNYKMYPCWESRVGQEMYK---LMIFDFLIIVAL------TLFVEFPRKLMVTYWSSKLVQWWGQQEFEIPQNVLEIVYGQTICWIGIFYSPLLPAIATVKYFIIFYIKKISLIENC-RPSTRPFRASSSNFFFQVILLIGLVLACIPVGFGIAYIPASKACGLF----------------VNFTTSWEIIPTVVKTFPNGLQKFIYVIA 631          
BLAST of Transmembrane channel protein vs. Ensembl Mouse
Match: Tmc7 (transmembrane channel-like gene family 7 [Source:MGI Symbol;Acc:MGI:2443317])

HSP 1 Score: 115.161 bits (287), Expect = 4.778e-26
Identity = 130/624 (20.83%), Postives = 284/624 (45.51%), Query Frame = 3
Query:  135 FYRKITGILEPLSIWYSSLKTIEKNCGCAVSSYFQFITWLMRINLWMFAIFLTVLLIPFLIKKPESFSDLIIDGNFTNNNDKFTL-AVNCTQKAYVKDNPMTVEVIIDILNGKGLLVKSPMFIGYYFNISYFNMTGSEFTRPLYNTPVAYCFAFWLCXXXXXXXXXXXXGTNYKLYKIDEDEFSGKFGLCLLTGFDYGVTKKNRILAMRNDLTKKLKIQYNQIEEFNYRSKLPKKSA--IIKAFP-KIVVNIIFIGFLCLIYFVIVEAQDVPIMLAQNKIVKSNAILVLLKDYVPSVTVAMINVVFQIINTKVVRFENYTKTVAVEVCFIRLILVQVISLLIFMVSLLDQTSQSNITDKVCQQTG----AIKCWENFIGQQFYRYSLLLFFSSVFVKPLIQLLQSVIFNRFGKD-PDSQNTKSKVVKLIGTAGFDLSEEGFVLINAQCVCWMGFWFCPXXXXXXXXXXXXXXYIRKAMFLRNLFETKMETATVAGGQKFLLGMLLNGLAFIMLPMGYILSNKSPSRGCSPFRIYDYPGDGYSFTTFLV--EFVTSQSKIFSKICNFVTSLQFFLPVLGVLIIITYVKYAQAKTYSRSIQAIRKEILNEENNLLFYEKQMMNAKE 1973
            F  K   +   L +W   +++IE   G  + SYF F+ +L+ +NL +F I   ++L+P L+ K +  +   +   F + + + TL  ++ +   Y          IID+L+G G L ++ +F G+Y       + G +F    Y+ P+AY  +    +  S +  +  S   +K+  I  +E    +   +  G+D+ +T ++      + L  +L+     +EE   R K+ ++++   I+ +  ++ +N I +  L   ++ I  A        + +I K      LL  Y+PS+ + + N +  II  K++ +E+Y+    + +  +R + +++ ++ + + +L  + +     D  C+  G       CWE  +GQ+ Y+  L++F         I +L   +F  F +    +    SK+++  G   F + +    ++  Q +CW+G +F P L  +  L   ++FY+++   L     +  +    +    F L +LL GL   ++P+   ++    S+ C PF  ++        TT+ V  + V++       + + VTS  F +P   ++ ++ +   A A  + + +  +R+++  E  +  +  +++  A+ 
Sbjct:  129 FLEKAREMTTHLELWRKDIRSIEGKFGTGIQSYFSFLRFLVVLNLVIFLIIFMLVLLPILLTKYKITNSTFVLIPFKDMDIQCTLYPISSSGLIYF------YSYIIDLLSGTGFLEETSLFYGHY------TIDGVKFQSFTYDLPLAYLISTIAYLALSLLWIVKRSVEGFKINLIRSEEHFQSYCNKIFAGWDFCITNRSMAELKHSSLRYELR---ADLEEERIRQKIAERTSEETIRIYTLRLFLNCIVLAVLAACFYAIYLATAFSQEHMKKEIDKMVFGENLLILYLPSIVITLANFITPIIFAKIIHYEDYSPGFEIRLTILRCVFMRLATICVLVFTLGSKITSCG--DSTCELCGYNQKLYPCWETQVGQEMYK--LMIF-------DFIIILAVTLFVDFPRKLLVTYCASSKLIQCWGQQEFAIPDNVLGIVYGQTICWIGAFFSPLLPAIATLKFVIIFYVKELSLLYTCRPSPRQ-FRASNSNFFFLLVLLIGLCLAIIPLTISMARIPSSKACGPFTNFN--------TTWEVIPQTVSTFPSSLQTLIHAVTSEAFAVPFFMIICLVMFYFIALAGAHKQVVVQLREQLSLESRDKRYLIQKLTEAQR 717          
BLAST of Transmembrane channel protein vs. Ensembl Mouse
Match: Tmc4 (transmembrane channel-like gene family 4 [Source:MGI Symbol;Acc:MGI:2669035])

HSP 1 Score: 103.219 bits (256), Expect = 2.636e-22
Identity = 127/514 (24.71%), Postives = 227/514 (44.16%), Query Frame = 3
Query:  447 IIDILNGKGLLVKSPMFIGYYFNISYFNMTGSEFTRPLYNTPV-AYCFAFWLCXXXXXXX--XXXXXGTNYKLYKIDEDEFSG-KFGLCLLTGFDYGVTKKNRIL--AMRNDLTKKLKIQYNQIEEFNYRSKLPKKSAIIKAFPKIVVNIIFIGFLCLIYFVIVEAQDVPIMLAQNKIVKSNAILVLLKDYVPSVTVAMINVVFQIINTKVVRFENYTKTVAVEVCFIRLILVQVISLLIFMVSLLDQ-TSQSNITDKVCQQTG----AIKCWENFIGQQFYRYSLLLFFSSVFVKPLIQLLQSVIFNRFGKDPDSQNTKSKVVKLIGTAGFDLSEEGFVLINAQCVCWMGFWFCPXXXXXXXXXXXXXXYIRKAMFLRNLFETKMETATVAGGQKFLLGMLLNGLAFIMLPMGYILSNKSPSRGCSPFRIYDYPGDGYSFTTFLVEFVTSQSKIFSKICNFVTSLQFFLPVLGVLIIITYVKYAQAKTYSRSIQAIRKEILNEENNLLFYEKQ 1955
            + ++L+G+G L  SP+F G+Y   S   +T        Y   V A    + LCI+   +          +  L       FS   FGLC     D  V  + RI+   ++ DL + +  +    +  + R+K+    A++      ++   F G    IY+    A +  + L +  +V+   +  LL DY+PS+ +++ N V   +   +   E YT++  + +  +R + +++ SL+  +VSL  Q T   N+  + C+  G     I CWE  +GQ+ Y+  L      + V  L+Q  + ++    G  P +        +L GT  F + +E   LI AQ V W+G +FCP L ++      +LF ++K + L +++     T   +    F   +LL GLA   +P+ Y +    PS+ C PFR         S    + E + S  +       F+ +  F +P+L +  I+     A A  Y R I  ++++I  E  N +F  ++
Sbjct:  139 LFNLLSGEGYLEWSPLFYGFYPPRSNLAIT--------YLCSVFAISIIYLLCILRRSVSGLKETLLAESDILTSYSHRVFSAWNFGLC----GDVHVRLRQRIILYELQVDLEEAVVRRRAAEQTLSQRAKVWSMRALLNVLVLALLGAAFYG----IYW----ATEYTLTLQETPLVRQTPLFKLLVDYLPSIFISLFNFVLPPVFKFIASLEGYTQSRQIVLILLRTVFLRLASLVFLLVSLWSQITCGGNMEAEGCKACGYNYKEIPCWETRLGQEMYKLVLFDLLMGLLVTLLVQFPRKIL---CGLCPGALG------RLSGTLEFQVPDEVLGLIYAQTVVWVGSFFCPLLPLINTAKFLILFCLKK-ITLFSIYSPASRTFRASTANFFFPLVLLVGLAISAVPVLYSIFLIPPSKLCGPFR------GKLSIWAQIPEAIESLPQTAQNFLYFLGTQAFTVPLLILSSILMMYTVALANCYGRLISELKRQIETEVQNKVFLAQR 616          
BLAST of Transmembrane channel protein vs. Ensembl Mouse
Match: Tmc4 (transmembrane channel-like gene family 4 [Source:MGI Symbol;Acc:MGI:2669035])

HSP 1 Score: 102.449 bits (254), Expect = 5.089e-22
Identity = 127/516 (24.61%), Postives = 228/516 (44.19%), Query Frame = 3
Query:  447 IIDILNGKGLLVKSPMFIGYYFNISYFNMTGSEFTRPLYNTPV-AYCFAFWLC--XXXXXXXXXXXXGTNYKLYKIDEDEFSG-KFGLCLLTGFDYGVTKKNRIL--AMRNDLTKKLKIQYNQIEEFNYRSKLPKKSAIIKAFPKIVVNIIFIGFLCLIYFVIVEAQDVPIMLAQNKIVKSNAILVLLKDYVPSVTVAMINVVFQIINTKVVRFENYTKTVAVEVCFIRLILVQVISLLIFMVSLLDQ-TSQSNITDKVCQQTG----AIKCWENFIGQQFYRYSLLLFFSSVFVKPLIQLLQSVIFNRFGKDPDSQNTKSKVVKLIGTAGFDLSEEGFVLINAQCVCWMGFWFCPXXXXXXXXXXXXXXYIRKAMFLRNLFETKMETATVAGGQKFLLGMLLNGLAFIMLPMGYILSNKSPSRGCSPFRIYDYPGDGYSFTTFLVEFVTSQSKIFSKICNFVTSLQFFLPVLGVLIIITYVKYAQAKTYSRSIQAIRKEILNEENNLLFYEKQMM 1961
            + ++L+G+G L  SP+F G+Y   S   +T        Y   V A    + LC    S   +       +  L       FS   FGLC     D  V  + RI+   ++ DL + +  +    +  + R+K+    A++      ++   F G    IY+    A +  + L +  +V+   +  LL DY+PS+ +++ N V   +   +   E YT++  + +  +R + +++ SL+  +VSL  Q T   N+  + C+  G     I CWE  +GQ+ Y+  L      + V  L+Q  + ++    G  P +      + +L GT  F + +E   LI AQ V W+G +FCP L ++      +LF ++K + L +++     T   +    F   +LL GLA   +P+ Y +    PS+ C PFR         S    + E + S  +       F+ +  F +P+L +  I+     A A  Y R I  ++++I  E  N +F  ++ +
Sbjct:  206 LFNLLSGEGYLEWSPLFYGFYPPRSNLAIT--------YLCSVFAISIIYLLCILRRSVSGLKETLLAESDILTSYSHRVFSAWNFGLC----GDVHVRLRQRIILYELQVDLEEAVVRRRAAEQTLSQRAKVWSMRALLNVLVLALLGAAFYG----IYW----ATEYTLTLQETPLVRQTPLFKLLVDYLPSIFISLFNFVLPPVFKFIASLEGYTQSRQIVLILLRTVFLRLASLVFLLVSLWSQITCGGNMEAEGCKACGYNYKEIPCWETRLGQEMYKLVLFDLLMGLLVTLLVQFPRKIL---CGLCPGA------LGRLSGTLEFQVPDEVLGLIYAQTVVWVGSFFCPLLPLINTAKFLILFCLKK-ITLFSIYSPASRTFRASTANFFFPLVLLVGLAISAVPVLYSIFLIPPSKLCGPFR------GKLSIWAQIPEAIESLPQTAQNFLYFLGTQAFTVPLLILSSILMMYTVALANCYGRLISELKRQIETEVQNKVFLAQRAV 685          
BLAST of Transmembrane channel protein vs. Ensembl Mouse
Match: Tmc5 (transmembrane channel-like gene family 5 [Source:MGI Symbol;Acc:MGI:1921674])

HSP 1 Score: 80.4925 bits (197), Expect = 4.516e-15
Identity = 129/642 (20.09%), Postives = 257/642 (40.03%), Query Frame = 3
Query:  120 SKLSLFYRK----ITGILEPLSIWYSSLKTIEKNCGCAVSSYFQFITWLMRINLWMFAIFLTVLLIPFLIKKPESFSDLIIDGNFTNNNDKFTLAVNCTQKAYVKDNPMTVEVIIDILNGKGLLVKSPMFIGYYFNISYFNMTGSEFTRPLYNTPVAYCFAFWLCXXXXXXXXXXXXGTNYKLYKIDEDEFSGKFGLCLLTGFDYGVTKKNRILAMRNDLTKKLKIQYNQIEEFNYR----SKLPKKSAIIKAFPKIVVNIIFIGFLCLIYFVIVEAQDVPIMLAQNKIVKSNAILVLLKDYVPSVTVAMINVVFQIINTKVVRFENYTKTVA--------VEVCFIRLILVQVISLLIFMVSLLDQTSQSNITDKVCQQTGAIKCWENFIGQQFYRYSLLLFFSSVFVKPLIQLLQSVIFNRFGKDPDSQNTKSKVVKLIGTAGFDLSEEGFVLINAQCVCWMGFWFCPXXXXXXXXXXXXXXYIRKAMFLRNLFETKMETATVAGGQKFLLGMLLNGLAFIMLPMGYILSNKSPSRGCSPFRIYDYPGDGYSFTTFLVEFVTSQSKIFSKIC------NFVTSLQFFLPVLGVLIIITYVKYAQAKTYSRSIQAIRKEILNEENNLLFYEKQMMNAKEID 1979
              LSL YR+    ++ +L  +++W    K I    G +V SYF F+ WL++ N++ F +  + ++IP                       +FT+    T +             ++   G G    + M+ G+Y N +  +  G       YN  +AY F    C++  F   ++S    ++   I+   +S      L+  +D+ VT +  +   + +L+ +++   +++ + NYR     +L + SA + A+   +V+       C+  + + E                      LK +     V ++  V   IN  V RF +  + V         V V  +R I +++  + I     L+  + S             +CWE  IGQ  YR  L+ F  S+    L + L+ +I  +F                +    FD++     LI AQ + W+G +FCP L  + ++ LF++FY++    + N                F+  +       ++  +   +    PS  C PFR    P    SF   +  ++ + S+    +       N + S+ FF  +  +++IITY+ +   +     I+ + ++I+NE  + +F  +++   ++++
Sbjct:  160 GSLSLTYRRTRNGLSELLNYITLWQKRFKVIGGKFGTSVLSYFSFLRWLLKFNIFSFVMNFSFIIIP-----------------------QFTVGAKNTLQF----------TGLEFFTGAGYFGDTVMYYGFYTNSTIRHRMGG----ASYNMQLAYIFTIGACLVVCFFSLLFSMAKYFRNNFINPHIYSRGIAK-LIFCWDFTVTHEKAVKLKQKNLSTEIRENLSELRQENYRLTFNQQLTRFSAHVAAW---LVSTGVTAACCVAVYYLAEYNSE-----------------FLKTHRNPGAVLLLPFVVSCINLAVPRFYSMFRLVERYEIPRQEVYVLLVRNIFLKISIVGILCYYWLNIVALS-----------GEECWETLIGQDIYRLLLMDFVFSLADSLLGEFLRRLIGMKFTS--------------LSLQEFDIARNVLELIYAQTLTWLGIFFCPLLPFIQMITLFIMFYVKNVSLMMNFQPPSKAWRASQMITFFIFLLFFPSFTGVLCTLAITIWRLKPSADCGPFR--GLP----SFIQSIYSWIDTLSRRPGYLWVVWIYQNLIGSVHFFFILTLIVLIITYLYWQITEGRKVMIRLLHEQIINEGKDKMFLIEKLTKLQDME 712          
BLAST of Transmembrane channel protein vs. Ensembl Mouse
Match: Tmc5 (transmembrane channel-like gene family 5 [Source:MGI Symbol;Acc:MGI:1921674])

HSP 1 Score: 76.2554 bits (186), Expect = 9.983e-14
Identity = 132/644 (20.50%), Postives = 262/644 (40.68%), Query Frame = 3
Query:  120 SKLSLFYRK----ITGILEPLSIWYSSLKTIEKNCGCAVSSYFQFITWLMRINLWMFAIFLTVLLIPFLIKKPESFSDLIIDGNFTNNNDKFTLAVNCTQKAYVKDNPMTVEVIIDILNGKGLLVKSPMFIGYYFNISYFNMTGSEFTRPLYNTPVAYCFAFWLCXXXXXXXXXXXXGTNYKLYKIDEDEFSGKFGLCLLTGFDYGVTKKNRILAMRNDLTKKLKIQYNQIEEFNYR----SKLPKKSAIIKAFPKIVVNIIFIGFLCLIYFVIVEAQDVPIMLAQNKIVKSNAILVLLKDYVPSVTVAMINVVFQIINTKVVRFENYTKTVA---VEVCFIRLILVQVISLLIFMVSLLDQTSQSNITDKVCQQTGAIKCWENFIGQQFYRYSLLLFFSSVFVKPLIQLLQSVIFNRFGKDPDSQNTKSKVVKLIGTAGFDLSEEGFVLINAQCVCWMGFWFCPXXXXXXXXXXXXXXYIRKAMFLRNL-------FETKMETATVAGGQKFLLGMLLNGLAFIMLPMGYILSNKSPSRGCSPFRIYDYPGDGYSFTTFLVEFVTSQSKIFSKIC------NFVTSLQFFLPVLGVLIIITYVKYAQAKTYSRSIQAIRKEILNEENNLLFYEKQMMNAKEID 1979
              LSL YR+    ++ +L  +++W    K I    G +V SYF F+ WL++ N++ F +  + ++IP                       +FT+    T +             ++   G G    + M+ G+Y N +  +  G       YN  +AY F    C++  F   ++S    ++   I+   +S      +   +D+ VT +  +   + +L+ +++   +++ + NYR     +L + SA + A+   +V+       C+  + + E                      LK +     V ++  V   IN  V RF +  + V    +    + ++LV+ I L I +V +L           +   +G  +CWE  IGQ  YR  L+ F  S+    L + L+ +I  +F                +    FD++     LI AQ + W+G +FCP L  + ++ LF++FY++    + N          ++M T  +          +L  LA  +  +        PS  C PFR         SF   +  ++ + S+    +       N + S+ FF  +  +++IITY+ +   +     I+ + ++I+NE  + +F  +++   ++++
Sbjct:  370 GSLSLTYRRTRNGLSELLNYITLWQKRFKVIGGKFGTSVLSYFSFLRWLLKFNIFSFVMNFSFIIIP-----------------------QFTVGAKNTLQF----------TGLEFFTGAGYFGDTVMYYGFYTNSTIRHRMGGA----SYNMQLAYIFTIGACLVVCFFSLLFSMAKYFRNNFINPHIYSRGIAKLIFC-WDFTVTHEKAVKLKQKNLSTEIRENLSELRQENYRLTFNQQLTRFSAHVAAW---LVSTGVTAACCVAVYYLAEYNSE-----------------FLKTHRNPGAVLLLPFVVSCINLAVPRFYSMFRLVERYEIPRQEVYVLLVRNIFLKISIVGIL-----CYYWLNIVALSGE-ECWETLIGQDIYRLLLMDFVFSLADSLLGEFLRRLIGMKFTS--------------LSLQEFDIARNVLELIYAQTLTWLGIFFCPLLPFIQMITLFIMFYVKNVSLMMNFQPPSKAWRASQMITFFIFLLFFPSFTGVLCTLAITIWRL-------KPSADCGPFRGLP------SFIQSIYSWIDTLSRRPGYLWVVWIYQNLIGSVHFFFILTLIVLIITYLYWQITEGRKVMIRLLHEQIINEGKDKMFLIEKLTKLQDME 922          
BLAST of Transmembrane channel protein vs. UniProt/SwissProt
Match: sp|Q5YCC5|TMC7_CHICK (Transmembrane channel-like protein 7 OS=Gallus gallus OX=9031 GN=Tmc7 PE=2 SV=1)

HSP 1 Score: 139.813 bits (351), Expect = 4.994e-33
Identity = 141/609 (23.15%), Postives = 274/609 (44.99%), Query Frame = 3
Query:  168 LSIWYSSLKTIEKNCGCAVSSYFQFITWLMRINLWMFAIFLTVLLIPFLIKKPESFSDLIIDGNFTNNNDKFTLAVNCTQKAYVKDNPMTVEVIIDILNGKGLLVKSPMFIGYYFNISYFNMTGSEFTRPLYNTPVAYCFAFWLCXXXXXXXXXXXXGTNYKLYKIDEDEFSGKFGLCLLTGFDYGVTKKNRILAMRNDLTKKLKIQYNQIEEFNYRSKLPKKSAIIKA---FPKIVVNIIFIGFLCLIYFVIVEAQDVPIMLAQNKIVKSNAILVLLKDYVPSVTVAMINVVFQIINTKVVRFENYTKTVAVEVCFIRLILVQVISLLIFMVSLLDQTSQSNITDKVCQQTGAI-KCWENFIGQQFYRYSLLLFFSSVFVKPLIQLLQSVIFNRFGKDPDSQNTKSKVVKLIGTAGFDLSEEGFVLINAQCVCWMGFWFCPXXXXXXXXXXXXXXYIRKAMFLRNLFETKMETA---TVAGGQKFLLGMLLNGLAFIMLPMGYILSNKSPSRGCSPFRIYDYPGDGYSFTTFLVEFVTSQSKIFSKICNFVTSLQFFLPVLGVLIIITYVKYAQAKTYSRSIQAIRKEILNEENNLLFYEKQMMNAKE 1973
            + +W   + +IE   G  + SYF F+ +L+ +N  MF +  + + +P +I     F+      +  N     T+      K  V         + D+L G G L  + +F GYY       +  + F+   YN P+AY    +  +  SF+  I  S   ++ + +D+++    +   +  G+D+ +T  N        L  +L+     +EE   + K+ +++   K      +I +NII I  L   ++ I  A       +   I ++  I  LL  Y+PS+ +   N +   I + ++RFE+Y+    + +  IR + V++ ++ + + SL  Q    N   K C     +  CWE+ +GQ+ Y+  LL+F         + ++   +F  F +         K+V+  G   F +S+    +I  Q +CW+G +F P L  +  +  F++FYI+K     +L  T+   +     +    F L +LL GL    +P+G  ++  S S+ C PFR ++       +T  ++EF     K    I +   ++ FF  V+  L +  ++  A A  + R ++ +R++++ E  + LF  +++  A++
Sbjct:  136 MQLWRHDIHSIEGKFGTGIQSYFSFLRFLVLLNFLMFILMFSFVTLPAVISNYGIFNSSSTKISPNNTEPYCTVYTPSGNKGLV----YFYTYLKDLLTGTGFLEVTVLFYGYY------TIDAAWFSVLRYNLPLAYLLTTFAYLALSFVWIIKRSVERFRQHLVDDEDQFQSYCNKVFAGWDFCITDLNAARLKHRSLLYELQ---TNLEEERLKQKIAERTMKEKLQIYSLRIFINIIVIAVLSGCFYSIYRATVFSQENSSVSIRRNVMIANLLVQYLPSIVITSANFIAPQIFSFLIRFEDYSAAFEIRLTLIRCVFVRLANVGVLLFSLWSQIHCDNDQCKACGYDYELYPCWESAVGQEMYK--LLIF-------DFMIIIAMTLFVDFPRKLLVTYCSWKLVQWWGLQEFGISDNVLEIIYGQTICWIGTFFSPLLPAIATIKYFIIFYIKKI----SLIHTRKPASRPIRASSSNFFFLAVLLIGLILAFVPLGVSIALISSSKACGPFRNFNTSWAIVPYT--ILEFPIGLQKFLYGIASEAFAVPFF--VIACLFMFYFI--ALAGAHKRVVEQLREQLVTESRDKLFLLEKLSEAQK 712          
BLAST of Transmembrane channel protein vs. UniProt/SwissProt
Match: sp|Q7Z402|TMC7_HUMAN (Transmembrane channel-like protein 7 OS=Homo sapiens OX=9606 GN=TMC7 PE=1 SV=1)

HSP 1 Score: 116.316 bits (290), Expect = 1.365e-25
Identity = 131/631 (20.76%), Postives = 284/631 (45.01%), Query Frame = 3
Query:  135 FYRKITGILEPLSIWYSSLKTIEKNCGCAVSSYFQFITWLMRINLWMFAIFLTVLLIPFLIKKPESFSDLIIDGNFTNNNDKFTL-AVNCTQKAYVKDNPMTVEVIIDILNGKGLLVKSPMFIGYYFNISYFNMTGSEFTRPLYNTPVAYCFAFWLCXXXXXXXXXXXXGTNYKLYKIDEDEFSGKFGLCLLTGFDYGVTKKNRILAMRNDLTKKLKIQYNQIEEFNYRSKLPKKSA--IIKAFP-KIVVNIIFIGFLCLIYFVIVEAQDVPIMLAQNKIVKSNAILVLLKD----YVPSVTVAMINVVFQIINTKVVRFENYTKTVAVEVCFIRLILVQVISLLIFMVSLLDQTSQSNITDKVCQQTG----AIKCWENFIGQQFYRYSLLLFFSSVFVKPLIQLLQSVIFNRFGKD-PDSQNTKSKVVKLIGTAGFDLSEEGFVLINAQCVCWMGFWFCPXXXXXXXXXXXXXXYIRKAMFLRNLFETKMETATVAGGQKFLLGMLLNGLAFIMLPMGYILSNKSPSRGCSPFRIYDY-----PGDGYSFTTFLVEFVTSQSKIFSKICNFVTSLQFFLPVLGVLIIITYVKYAQAKTYSRSIQAIRKEILNEENNLLFYEKQMMNAKE 1973
            F  K   +   L +W   +++IE   G  + SYF F+ +L+ +NL +F I   ++L+P L+ K +  +   +   F + + + T+  V+ +   Y          IID+L+G G L ++ +F G+Y       + G +F    Y+ P+AY  +    +  S +  +  S   +K+  I  +E    +   +  G+D+ +T ++      + L  +L+     +EE   R K+ ++++   I+ +  ++ +N I +  L   ++ I     V  + +Q  + K    +V  ++    Y+PS+ + + N +  +I  K++R+E+Y+    + +  +R + +++ ++ + + +L  + +  +  D  C   G       CWE  +GQ+ Y+  L++F         I +L   +F  F +    +  +  K+++  G   F + +    ++  Q +CW+G +F P L  +  L   ++FY+++   L     +       +    F L +LL GL   ++P+   +S    S+ C PF  ++      P    +F + L  F+             VTS  F +P   ++ +I +   A A  + R +  +R+++  E  +  +  +++  A+ 
Sbjct:  131 FLEKAREMTTHLELWREDIRSIEGKFGTGIQSYFSFLRFLVLLNLVIFLIIFMLVLLPVLLTKYKITNSSFVLIPFKDMDKQCTVYPVSSSGLIYF------YSYIIDLLSGTGFLEETSLFYGHY------TIDGVKFQNFTYDLPLAYLLSTIASLALSLLWIVKRSVEGFKINLIRSEEHFQSYCNKIFAGWDFCITNRSMADLKHSSLRYELR---ADLEEERMRQKIAERTSEETIRIYSLRLFLNCIVLAVLGACFYAIY----VATVFSQEHMKKEIDKMVFGENLFILYLPSIVITLANFITPMIFAKIIRYEDYSPGFEIRLTILRCVFMRLATICVLVFTLGSKITSCD--DDTCDLCGYNQKLYPCWETQVGQEMYK--LMIF-------DFIIILAVTLFVDFPRKLLVTYCSSCKLIQCWGQQEFAIPDNVLGIVYGQTICWIGAFFSPLLPAIATLKFIIIFYVKEWSLLYTCRPSP-RPFRASNSNFFFLLVLLIGLCLAIIPLTISISRIPSSKACGPFTNFNTTWEVIPKTVSTFPSSLQSFIHG-----------VTSEAFAVPFFMIICLIMFYFIALAGAHKRVVIQLREQLSLESRDKCYLIQKLTEAQR 719          
BLAST of Transmembrane channel protein vs. UniProt/SwissProt
Match: sp|Q4R7U0|TMC7_MACFA (Transmembrane channel-like protein 7 OS=Macaca fascicularis OX=9541 GN=TMC7 PE=2 SV=1)

HSP 1 Score: 115.931 bits (289), Expect = 2.082e-25
Identity = 135/635 (21.26%), Postives = 284/635 (44.72%), Query Frame = 3
Query:  135 FYRKITGILEPLSIWYSSLKTIEKNCGCAVSSYFQFITWLMRINLWMFAIFLTVLLIPFLIKKPESFSDLIIDGNFTNNNDKFTL-AVNCTQKAYVKDNPMTVEVIIDILNGKGLLVKSPMFIGYYFNISYFNMTGSEFTRPLYNTPVAYCFAFWLCXXXXXXXXXXXXGTNYKLYKIDEDEFSGKFGLCLLTGFDYGVTKKNRILAMRNDLTKKLKIQYNQIEEFNYRSKLPKKSA--IIKAFP-KIVVNIIFIGFLCLIYFVIVEAQDVPIMLAQNKIVKSNAILV----LLKDYVPSVTVAMINVVFQIINTKVVRFENYTKTVAVEVCFIRLILVQVISLLIFMVSLLDQTSQSNITDKVCQQTG----AIKCWENFIGQQFYRYSLLLFFSSVFVKPLIQLLQSVIFNRFGKDPDSQNTKS-KVVKLIGTAGFDLSEEGFVLINAQCVCWMGFWFCPXXXXXXXXXXXXXXYIRKAMFLRNLFETKMETATVAGGQKFLLGMLLNGLAFIMLPMGYILSNKSPSRGCSPFRIYDY-----PGDGYSFTTFLVEFVTSQSKIFSKICNFVTSLQFFLPVLGVLIIITYVKYAQAKTYSRSIQAIRKEILNEENNLLFYEKQMMNAKEIDLN 1985
            F  K   +   L +W   +++IE   G  + SYF F+ +L+ +NL +F I   ++L+P L+ K +  +   +   F + + + T+  V+ +   Y          IID+L+G G L ++ +F G+Y       + G +F    Y+ P+AY  +    +  S +  +  S   +K+  I  +E    +   +  G+D+ +T ++      + L  +L+     +EE   R K+ ++++   I+ +  ++ +N I +  L   ++ I     V  + +Q  + K    +V    LL  Y+PS+ + + N +  +I  K++R+E+Y+    + +  +R + +++ ++ + + +L  + +  +  D  C   G       CWE  +GQ+ Y+  L++F         I +L   +F  F +        S K+++  G   F + +    ++  Q +CW+G +F P L  +  L   ++FY+++   L     +       +    F L +LL GL   ++P+   +S    S+ C PF  ++      P    +F + L  F+             VTS  F +P   ++ +I +   A A  + R +  +R+++  E  +  +  +++  A+    N
Sbjct:  131 FLEKAREMTTHLELWREDIRSIEGKFGTGIQSYFSFLRFLVLLNLVIFLIIFMLVLLPILLTKYKITNSSFVLIPFKDTDIQCTVYPVSSSGLIYF------YSYIIDLLSGTGFLEETSLFYGHY------TIDGVKFQNFTYDLPLAYLISTIAYLALSLLWIVKRSVEGFKINLIRSEEHFQSYCNKIFAGWDFCITNRSMADLKHSSLRYELR---ADLEEERIRQKIAERTSEETIRIYSLRLFLNCIVLAVLGACFYAIY----VATVFSQEHMKKEIDKMVFGENLLILYLPSIVITLANFITPMIFAKIIRYEDYSPGFEIRLTILRCVFMRLATICVLVFTLGSKITSCD--DDTCDLCGYNQKLYPCWETQVGQEMYK--LMIF-------DFIIILAVTLFVDFPRKLLVTYCSSWKLIQCWGQQEFAIPDNVLGIVYGQTICWIGAFFSPLLPAIATLKFIIIFYVKEWSLLYTCRPSP-RPFRASNSNFFFLLVLLIGLCLAIIPLTISISRIPSSKACGPFTNFNTTWEVIPKTVSTFPSSLQSFIHG-----------VTSEAFAVPFFMIICLIMFYFIALAGAHKRVVIQLREQLSLESRDKRYLIQKLTEAQRDTRN 723          
BLAST of Transmembrane channel protein vs. UniProt/SwissProt
Match: sp|Q8C428|TMC7_MOUSE (Transmembrane channel-like protein 7 OS=Mus musculus OX=10090 GN=Tmc7 PE=2 SV=1)

HSP 1 Score: 115.161 bits (287), Expect = 3.342e-25
Identity = 130/624 (20.83%), Postives = 284/624 (45.51%), Query Frame = 3
Query:  135 FYRKITGILEPLSIWYSSLKTIEKNCGCAVSSYFQFITWLMRINLWMFAIFLTVLLIPFLIKKPESFSDLIIDGNFTNNNDKFTL-AVNCTQKAYVKDNPMTVEVIIDILNGKGLLVKSPMFIGYYFNISYFNMTGSEFTRPLYNTPVAYCFAFWLCXXXXXXXXXXXXGTNYKLYKIDEDEFSGKFGLCLLTGFDYGVTKKNRILAMRNDLTKKLKIQYNQIEEFNYRSKLPKKSA--IIKAFP-KIVVNIIFIGFLCLIYFVIVEAQDVPIMLAQNKIVKSNAILVLLKDYVPSVTVAMINVVFQIINTKVVRFENYTKTVAVEVCFIRLILVQVISLLIFMVSLLDQTSQSNITDKVCQQTG----AIKCWENFIGQQFYRYSLLLFFSSVFVKPLIQLLQSVIFNRFGKD-PDSQNTKSKVVKLIGTAGFDLSEEGFVLINAQCVCWMGFWFCPXXXXXXXXXXXXXXYIRKAMFLRNLFETKMETATVAGGQKFLLGMLLNGLAFIMLPMGYILSNKSPSRGCSPFRIYDYPGDGYSFTTFLV--EFVTSQSKIFSKICNFVTSLQFFLPVLGVLIIITYVKYAQAKTYSRSIQAIRKEILNEENNLLFYEKQMMNAKE 1973
            F  K   +   L +W   +++IE   G  + SYF F+ +L+ +NL +F I   ++L+P L+ K +  +   +   F + + + TL  ++ +   Y          IID+L+G G L ++ +F G+Y       + G +F    Y+ P+AY  +    +  S +  +  S   +K+  I  +E    +   +  G+D+ +T ++      + L  +L+     +EE   R K+ ++++   I+ +  ++ +N I +  L   ++ I  A        + +I K      LL  Y+PS+ + + N +  II  K++ +E+Y+    + +  +R + +++ ++ + + +L  + +     D  C+  G       CWE  +GQ+ Y+  L++F         I +L   +F  F +    +    SK+++  G   F + +    ++  Q +CW+G +F P L  +  L   ++FY+++   L     +  +    +    F L +LL GL   ++P+   ++    S+ C PF  ++        TT+ V  + V++       + + VTS  F +P   ++ ++ +   A A  + + +  +R+++  E  +  +  +++  A+ 
Sbjct:  129 FLEKAREMTTHLELWRKDIRSIEGKFGTGIQSYFSFLRFLVVLNLVIFLIIFMLVLLPILLTKYKITNSTFVLIPFKDMDIQCTLYPISSSGLIYF------YSYIIDLLSGTGFLEETSLFYGHY------TIDGVKFQSFTYDLPLAYLISTIAYLALSLLWIVKRSVEGFKINLIRSEEHFQSYCNKIFAGWDFCITNRSMAELKHSSLRYELR---ADLEEERIRQKIAERTSEETIRIYTLRLFLNCIVLAVLAACFYAIYLATAFSQEHMKKEIDKMVFGENLLILYLPSIVITLANFITPIIFAKIIHYEDYSPGFEIRLTILRCVFMRLATICVLVFTLGSKITSCG--DSTCELCGYNQKLYPCWETQVGQEMYK--LMIF-------DFIIILAVTLFVDFPRKLLVTYCASSKLIQCWGQQEFAIPDNVLGIVYGQTICWIGAFFSPLLPAIATLKFVIIFYVKELSLLYTCRPSPRQ-FRASNSNFFFLLVLLIGLCLAIIPLTISMARIPSSKACGPFTNFN--------TTWEVIPQTVSTFPSSLQTLIHAVTSEAFAVPFFMIICLVMFYFIALAGAHKQVVVQLREQLSLESRDKRYLIQKLTEAQR 717          
BLAST of Transmembrane channel protein vs. UniProt/SwissProt
Match: sp|Q7TQ65|TMC4_MOUSE (Transmembrane channel-like protein 4 OS=Mus musculus OX=10090 GN=Tmc4 PE=2 SV=2)

HSP 1 Score: 102.834 bits (255), Expect = 2.886e-21
Identity = 124/513 (24.17%), Postives = 228/513 (44.44%), Query Frame = 3
Query:  447 IIDILNGKGLLVKSPMFIGYYFNISYFNMTGSEFTRPLYNTPVAYCFAFWLCXXXXXXXXXXXXGTNYKLYKIDEDEFSG-KFGLCLLTGFDYGVTKKNRIL--AMRNDLTKKLKIQYNQIEEFNYRSKLPKKSAIIKAFPKIVVNIIFIGFLCLIYFVIVEAQDVPIMLAQNKIVKSNAILVLLKDYVPSVTVAMINVVFQIINTKVVRFENYTKTVAVEVCFIRLILVQVISLLIFMVSLLDQ-TSQSNITDKVCQQTG----AIKCWENFIGQQFYRYSLLLFFSSVFVKPLIQLLQSVIFNRFGKDPDSQNTKSKVVKLIGTAGFDLSEEGFVLINAQCVCWMGFWFCPXXXXXXXXXXXXXXYIRKAMFLRNLFETKMETATVAGGQKFLLGMLLNGLAFIMLPMGYILSNKSPSRGCSPFRIYDYPGDGYSFTTFLVEFVTSQSKIFSKICNFVTSLQFFLPVLGVLIIITYVKYAQAKTYSRSIQAIRKEILNEENNLLFYEKQMM 1961
            + ++L+G+G L  SP+F G+Y   S   +T   +   ++   V Y     +   S   +       +  L       FS   FGLC     D  V  + RI+   ++ DL + +  +    +  + R+K+    A++      ++   F G    IY+    A +  + L +  +V+   +  LL DY+PS+ +++ N V   +   +   E YT++  + +  +R + +++ SL+  +VSL  Q T   N+  + C+  G     I CWE  +GQ+ Y+  L      + V  L+Q  + ++    G  P +      + +L GT  F + +E   LI AQ V W+G +FCP L ++      +LF ++K + L +++     T   +    F   +LL GLA   +P+ Y +    PS+ C PFR         S    + E + S  +       F+ +  F +P+L +  I+     A A  Y R I  ++++I  E  N +F  ++ +
Sbjct:  206 LFNLLSGEGYLEWSPLFYGFYPPRSNLAIT---YLCSVFAISVIYLLC--ILRRSVSGLKETLLAESDILTSYSHRVFSAWNFGLC----GDVHVRLRQRIILYELQVDLEEAVVRRRAAEQTLSQRAKVWSMRALLNVLVLALLGAAFYG----IYW----ATEYTLTLQETPLVRQTPLFKLLVDYLPSIFISLFNFVLPPVFKFIASLEGYTQSRQIVLILLRTVFLRLASLVFLLVSLWSQITCGGNMEAEGCKACGYNYKEIPCWETRLGQEMYKLVLFDLLMGLLVTLLVQFPRKIL---CGLCPGA------LGRLSGTLEFQVPDEVLGLIYAQTVVWVGSFFCPLLPLINTAKFLILFCLKK-ITLFSIYSPASRTFRASTANFFFPLVLLVGLAISAVPVLYSIFLIPPSKLCGPFR------GKLSIWAQIPEAIESLPQTAQNFLYFLGTQAFTVPLLILSSILMMYTVALANCYGRLISELKRQIETEVQNKVFLAQRAV 685          
BLAST of Transmembrane channel protein vs. TrEMBL
Match: V3ZD29 (TMC domain-containing protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_228950 PE=4 SV=1)

HSP 1 Score: 204.142 bits (518), Expect = 2.698e-51
Identity = 173/673 (25.71%), Postives = 333/673 (49.48%), Query Frame = 3
Query:   60 LRDGFQDTLHKNEIIEIVEQSKLSLFYRK--ITGILEPLSIWYSSLKTIEKNCGCAVSSYFQFITWLMRINLWMFAIFLTVLLIPFLIKKPESFSDLIIDGNFTNNNDKFTL-------AVNCTQ------KAYVKDNPMTVEVIIDILNGKGLLVKSPMFIGYYFNISYFNMTGSEFTRPLYNTPVAYCFAFWLCXXXXXXXXXXXXGTNYKLYKIDEDEFSGKFGLCLLTGFDYGVTKKNRILAMRNDLTKKLKIQYNQIEEFNYRSKLPKKSA-------IIKAFPKIVVNIIFIGFLCLIYFVIVEAQDVPIMLAQNKIVKSNAILVLLKDYVPSVTVAMINVVFQIINTKVVRFENYTKTVAVEVCFIRLILVQVISLLIFMVSLLDQ-TSQSNI----TDKVC---------QQTGAIKCWENFIGQQFYRYSLLLFFSSVFVKPLIQLLQSVIFNRFGKDPDSQNTKSKVVKLIGTAGFDLSEEGFVLINAQCVCWMGFWFCPXXXXXXXXXXXXXXYIRKAMFLRNLFETKMETATVAGGQKFLLGMLLNGLAFIMLPMGYILSNKSPSRGCSPFRIYDYPGDGYSFTTFLVEFVTSQSKIFSKICNFVTSLQFFLPVLGVLIIITYVKYAQAKTYSRSIQAIRKEILNEENNLLFYEKQMMNAK 1970
            L +G +D   ++    +  + K S   +K  I G      +W S+ K IE   G A +SYF+F  WLM +N+++F I + V+++P      ++F   +   N TN +D  T        AVNC+       + + KD   T+E +++   G G + K+ +F G YFN+++   T  E     +N  +AY  A  +  + SFI+ + +SG + K   ID++E +  +   + + +D+ +  +        +++ + K     +EE   R +   +SA        ++ F  I V ++    L LIY+   +      +L  NK       L L+ +++PS+T+ ++NV+  +I + +V  E+Y+    +++   R +L+++ SL + + SL  Q  S  N        VC            G+IKCWE +IGQQFY+ +LL F   + V  + +  +++I++++           K+++ IG   FDL +    ++ +Q +CW+G +FCP + ++ +L  F++FY++K   ++N   TK      +    F + +LL       +P+GY+L N  PS+ C PFR+Y  P   Y     + + + +     +++ +F+ ++ FF+P + +L ++ Y  +A A+ Y +     ++E+L E+  L   ++Q + A+
Sbjct:  484 LAEGLRDLDEEDGFKSVKHKFKQSWQRQKADIKGYFYQFELWASTFKEIEGKFGTATASYFRFTRWLMFLNIYIFLITVPVIVLPTFFSSNQNF---VGSYNVTNGDDNGTSVFFGIEEAVNCSHAYNDHIRNFEKD---TLEKVLNFFKGAGWMEKTHLFYGLYFNLTF---TTDENEVQHFNIGLAYLLAIGITFLISFILILKNSGKSVKEGVIDQEESNTLYCNKVFSAWDFCIFNEKAAKVKHANISYEFKA---DLEEQRLRLRRADRSARERYRLYAVRFFINIFVIVVLGACLYLIYWTTEK------LLELNKKEDLGEFLNLVIEFLPSLTITLLNVIIPLIFSYIVTPEDYSPVFELKITLFRTVLLRLASLGVLVFSLYFQLVSVENAKCIPETGVCCGNYQWTNTNDKGSIKCWETYIGQQFYKLALLDFAVVLIVTFVYEFPRTLIYSKY--------NHKKLLQQIGEQEFDLPKNVLDIVYSQTLCWLGMFFCPLIPLITMLKCFIIFYVKKLSLIKNCVPTK-RPYKASRSNSFFMTVLLISFILSAVPLGYMLGNIPPSQSCGPFRVYSAP--DYVMFNSITDEIGTWPNAANQVFSFMGTVGFFVPAMILLCLVMYYYWAAAQGYKK-----KQELLKEQLKLDGRDRQYLLAR 1122          
BLAST of Transmembrane channel protein vs. TrEMBL
Match: A0A210QF50 (Transmembrane channel-like protein 7 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT05865 PE=4 SV=1)

HSP 1 Score: 192.971 bits (489), Expect = 1.924e-47
Identity = 169/674 (25.07%), Postives = 327/674 (48.52%), Query Frame = 3
Query:   51 AGYLRDGFQDTLHKNEIIEIVEQSKLSLFYRKITGILEPLSIWYSSLKTIEKNCGCAVSSYFQFITWLMRINLWMFAIFLTVLLIPFLIKKPESFSDLIIDGNFTNNNDKFTLAVNCTQKAYVKDN------PMTVEVIIDILNGKGLLVKSPMFIGYYFNISYFNMTGSEFTRPLYNTPVAYCFAFWLCXXXXXXXXXXXXGTNYKLYKIDEDEFSGKFGLCLLTGFDYGVTKKNRILAMRNDLTKKLKIQYNQIEEFNYRSKLPKKSAIIKA---FPKIVVNIIFIGFLCLIYFVIVEAQDVPIMLAQNKIVKSNAILVLLKDYVPSVTVAMINVVFQIINTKVVRFENYTKTVAVEVCFIRLILVQVISLLIFMVSLLDQTSQSNITDKV--CQQT-----------GAIKCWENFIGQQFYRYSLLLFFSSVFVKPLIQLLQSVIFNRFGKDPDSQNTKSKVVKLIGTAGFDLSEEGFVLINAQCVCWMGFWFCPXXXXXXXXXXXXXXYIRKAMFLRNLFETKMETATVAGGQKFLLGMLLNGLAFIM--LPMGYILSNKSPSRGCSPFRIYDYPGDGYSFTTFLVEFVTSQSKIFSKICN----FVTSLQFFLPVLGVLIIITYVKYAQAKTYSRSIQAIRKEIL---NEENNLL--FYEKQMMNAKE 1973
            A  +RD   + ++++ +++  E        R+   +L+  +IW S  K IE + G A+ +YF+FI WLM +NL++  I   V+ +P L   P  F + +     +     +  +VNCT   Y+  N        T E ++D+L G G + +  +F G YFN +Y     +E    +YN  +AY  A     I SF++ + +S  N K+  +  ++   ++   +  G+DY + +       R +L   +K     ++E + + KL K++   K      ++V+NI+ +  L    ++I    +  + L +  +   + IL L   YVP +T+  +N++  I+  K+V+FE Y     +++   R IL+++ S ++ +  L  Q       + +  C  T           G++KCWE ++GQQ Y+  LL       +   + L + ++FNRF       ++ SK++K+IG   F +      +I +Q +CW+G +F P +  +  +  FL FYIRK     +L  +++E       +   L M +  L+FI+  LP+GY++   +PS+ C PFR+Y+      S  + + + +TS  + +  +      F+ +  F +P++ +L +I Y  +     Y R+ + ++++++    ++N LL    E Q++  +E
Sbjct:  965 ASLMRDSTLNKMNRSRMLKGTESKMWHKLKRQSKEVLQHFTIWLSVFKEIEGSYGTAIMTYFRFIKWLMFLNLYIMIIMFGVITVPHLALGPYEFQESV-----SPEVGGYLESVNCTLD-YIDYNINYTNSESTFEKVLDVLQGTGWMERKLLFYGVYFNKTYSVGDDTE----VYNMSLAYLLAVGASFIISFLLLVKNSAKNVKV-TLGIEKTVARYCNKVFGGWDYCIKEDRGANIKRANLKTDIKA---DLQEQSLKLKLSKQTMKDKCQLYMIRLVINILVLALLGGACYLIAFTTEKMLDLLKKDL---SDILALFVQYVPYITITALNLILPIVFQKLVQFERYFHENEIKITLTRSILLRLASPIVLIAILYQQLIGVGGEEDLGRCGNTRWSTSSGGTVKGSVKCWETYVGQQIYKLVLLDLIVETGIVIFVHLPRRLVFNRF-------SSTSKLIKIIGAQEFSVPINVVDIIYSQILCWLGLFFSPIIPFMTFVKCFLFFYIRKF----SLTNSRIEDRPFKTSRSNSLFMTVLLLSFILAALPIGYMIGTIAPSQSCGPFRVYN------STESVMFDTITSTVQRWPPVARDIFYFLGTAGFLVPLIIILCLIMYYYWLLGSGYKRTEKLLQQQLVLEGRDKNYLLGRVKEYQLLQPRE 1604          

HSP 2 Score: 167.548 bits (423), Expect = 3.809e-39
Identity = 151/601 (25.12%), Postives = 284/601 (47.25%), Query Frame = 3
Query:  159 LEPLSIWYSSLKTIEKNCGCAVSSYFQFITWLMRINLWMFAIFLTVLLIPF--LIKKPESFSDLIIDGNFTNNNDKFTLAVNCTQ--KAYVKD----NPMTVEVIIDILNGKGLLVKSPMFIGYYFNISYFNMTGSEFTRPLYNTPVAYCFAFWLCXXXXXXXXXXXXGTNYKLYKIDEDEFSGKFGLCLLTGFDYGVTKKNRILAMRNDLTKKLKIQYNQIEEFNYRSKLPKKSAIIKAFP-KIVVNIIFI----GFLCLIYFVIVEAQDVPIMLAQNKIVKSNAILVLLKDYVPSVTVAMINVVFQIINTKVVRFENYTKTVAVEVCFIRLILVQVISLLIFMVSLLD------------------QTSQSNITDKVCQQTGAIKCWENFIGQQFYRYSLLLFFSSVFVKPLIQLLQSVIFNRFGKDPDSQNTKSKVVKLIGTAGFDLSEEGFVLINAQCVCWMGFWFCPXXXXXXXXXXXXXXYIRKAMFLRNLFETKMETATVAGGQKFLLGMLLNGLAFIMLPMGYILSNKSPSRGCSPFRIYDYPGDGYSFTTFLVEFVTSQSKIFSKICNFVTSLQFFLPVLGVLIIITYVKYA 1868
            LEP   W  +LK +E   G A+  YF+F+ WLM +N+++  + + + L+P+  L K P +F+  +I  N T    +   AV+CT   K  + D     P     I+  L G G +  + +F G +FN +Y +    E  R  Y+  ++Y  A  +  I SF + + +S    K   +        +   +LTG+D+ +++        ++++ + K    +I+ F ++ +       IK +  + V+NI+ +    G L LIY    +     +++ Q +   +   LV +  Y+PSVT+ ++N++  I+  KVV  E+YT +  + +  +R IL+++ SL + ++S+                     +S ++ T         IKCWE ++GQQ Y+  +L F   + V  +++L + +++N F K       + K++ ++G    DL +    ++ AQ +CWMG +F P +  +  L  F++FY++K   L N         T      F +GML        +P+ Y++ N +PS+ C PFR+  Y  +   F   +   +    +    +  F+    FF+P + V+ +I Y  +A
Sbjct:  188 LEP---WSGALKEVEGQFGTAIMGYFRFVRWLMFLNMYICLVNICLTLVPYFALYKSPSNFTSSLIGLNTTFFQAE---AVDCTHGYKEELNDVRSAGPDVFSDILHFLQGTGWMEDTVLFYGAFFNKTYLSPIHGE--RETYHMGLSYLLATGVSFIISFFVIVKNSSKGLKDTAVIHGATMAMYSNKVLTGWDFCISQAKAAKTKHSNISGEFKKDL-EIQRFMWKMENRTTGDKIKLYLLRTVINILMVFLLGGSLYLIYLSFSQ-----LLVLQEQFNDTTPALVFVIQYIPSVTITLLNIIVPIVFKKVVLLEDYTPSFEMIMTLLRTILLRLSSLGVLLISIYQLLQSDDPQYEYMCGNKRWSSSLASNTSTNVSAGSIIKCWETYVGQQIYKLVILDFLVLIIVTFIVELPRRLVYNTFSK-------RFKLIDMVGLPEVDLPKVVLDIVYAQTLCWMGLFFSPLIPFMCFLKCFIVFYVKKFTLLNNYVAPTRPYRTTHSNSLF-IGMLFISFLMAAIPITYMVGNFNPSQSCGPFRV--YATNHTVFFDTVAHVILEWPQEAQDVFFFLGKTNFFIPAILVMCLIMYYYWA 764          
BLAST of Transmembrane channel protein vs. TrEMBL
Match: K1Q7L4 (Transmembrane channel-like protein 7 OS=Crassostrea gigas OX=29159 GN=CGI_10013960 PE=4 SV=1)

HSP 1 Score: 173.711 bits (439), Expect = 4.686e-41
Identity = 158/673 (23.48%), Postives = 321/673 (47.70%), Query Frame = 3
Query:   75 QDTLHKNEIIEIVEQSKL-SLFYRKITGILEPLSIWYSSLKTIEKNCGCAVSSYFQFITWLMRINLWMFAIFLTVLLIPFLIKKPESFSDLIIDGNFTNNNDKFTLAVNCTQKAYVKDNPMTV-----EVIIDILNGKGLLVKSPMFIGYYFNISYFNMTGSE-FTRPLYNTPVAYCFAFWLCXXXXXXXXXXXXGTNYKLYKIDEDEFSGKFGLCLLTGFDYGVTKKNRILAMRNDLTKKLKIQ-YNQIEEFNYRSKLPKKSAIIKAFPKIVVNIIFIGFLCLIYFVIVEAQDVPIMLAQNKIVKSNAILVLLKDYVPSVTVAMINVVFQIINTKVVRFENYTKTVAVEVCFIRLILVQVISLLIFMVSLLDQ----------------TSQSNITDKVCQQTGAIKCWENFIGQQFYRYSLLLFFSSVFVKPLIQLLQSVIFNRFGKDPDSQNTKSKVVKLIGTAGFDLSEEGFVLINAQCVCWMGFWFCPXXXXXXXXXXXXXXYIRKAMFLRNLFETKMETATVAGGQKFLLGMLLNGLAFIMLP--MGYILSNKSPSRGCSPFRIYDYPGDGYSF---TTFLVEFVTSQSKIFSKICNFVTSLQFFLPVLGVLIIITYVKYAQAKTYSRSIQAIRKEILNEENNLLFYEKQMMNAKEIDLNDQILLQS 2006
            + TL +   +    +SK    F  +    L+  +IW  +LK +E   G A  +YF+FI WLM +N+++  I   V+ +P+L   P +F+  + D N +     +  A+ CT +  +  + +T      + ++D+L G G + +  +F G Y+N +Y   +G E +T   YN  +AY  AF  C + SF++ + ++  N K+  +   E    +   + +G+D+ + ++      R ++   ++ + ++Q +E+  + +   ++  + A   ++  ++       +Y +   A+ +  +  Q  +   + I+ LL  Y+P VT+ ++N V  II  K+V+FE+Y      ++   R IL+++ S +  +  L  +                 ++  I+D      G I CWE + GQQ Y+  LL       +   +Q+ +  +  ++GK        SK+VKL+G   FDL +    +I  Q +CW+G +F P +  +  +   L F+++K   L+     +    T      F+L +L   L+FI+    +GY++ N  PS+ C P+R+Y        F   T  +  + T    +F     F+ ++ FF+PV+ +L+++ Y  + + + Y ++     +E+L E+  +   +K+ +    +D  +++L Q+
Sbjct: 1006 ESTLTRMHTLSGTTESKAWHKFQIRKKAFLDRFTIWAGTLKEVEGQYGTAAMTYFRFIKWLMFLNIYIMIIMFCVITVPYLALAPYTFNSSLTDANVSG----YREAIECTTEYEIYHSNLTETESIGQQVLDLLQGTGWMERRILFYGVYYNKTY--TSGDETYT---YNMGLAYMLAFGGCFLLSFLLIVKNASKNVKV-SLGSAETMAVYSNMIFSGWDFCINQRKAAKVKRKNIFTDIQAELHDQRKEWRRQKRSGVENVKLYAIRFLINLLVLALLGGALYLITFTAEQMIELQNQKNL---SEIVELLVQYIPFVTITVLNAVLPIIFQKLVQFEDYRYEFGFKLTLARAILLRLASPIALIAILYKELIERPDDDSSSSSGQCGNKQWISDS---SRGRIMCWETYFGQQLYKLVLLDLIVETGIIFFMQVPRWYLNKKYGK-------TSKLVKLVGPQEFDLPQSVVDIIYTQSICWLGMFFSPLIPFMTFVKCVLFFWVKKLAVLKINVPQERPIKTSGSNSLFMLVLL---LSFIIAAGLLGYMIGNIPPSQSCGPYRVYSNQTGAVMFNVVTNTVQNWPTEARDVFE----FLGTVGFFIPVVILLVLLMYYYWLRGQGYKKT-----EELLQEQLKMEGRDKKYL----LDRVNEVLTQN 1639          

HSP 2 Score: 121.324 bits (303), Expect = 2.241e-24
Identity = 103/385 (26.75%), Postives = 194/385 (50.39%), Query Frame = 3
Query:   57 YLRDGFQDTLHKNEIIEIVEQSKLSLFYRKITGILEPLSIWYSSLKTIEKNCGCAVSSYFQFITWLMRINLWMFAIFLTVLLIPFLIK--KPESFSDLIIDGNFTNN---NDKFTLAVNCTQKAYVK--DNPMTVE----VIIDILNGKGLLVKSPMFIGYYFNISY-FNMTGSEFTRPLYNTPVAYCFAFWLCXXXXXXXXXXXXGTNYKLYKIDEDEFSG---KFGLCLLTGFDYGVTKKNRILAMRNDLTKKLKIQY-NQIEEFNYRSKLPKKSAIIKAFPKIVVNIIFIGFLCLIYFVIVEAQDVPIMLAQNKIVKSNAILVLLKDYVPSVTVAMINVVFQIINTKVVRFENYTKTVAVEVCFIRLILVQVISLLIFMVSL 1163
            Y  +  Q+ + + +I +  ++     F ++   +L  L +W  + K IE   G +V +YF+F+ WL+ +N ++  + L + ++P++IK  +P SF D     N  +N   +D F  A+NCT K Y+   DN    E      +D L G G +  + +F G YFN +Y   +     T   YN  ++Y  A     + SF + + +S    K   +DE   SG   +F   +  G+D+ ++ +        +LT++L+    NQ   +   ++  ++ A + +  + VVN + +GFL    ++I  A +  I L Q +    + I+  L  ++PSVT+ ++N++  II  K+V FE+Y     +++  +R +++++ SLL+ M SL
Sbjct:  171 YRDEILQEPVQRTQIWKYQQKKAWQNFKQQAKNVLYQLELWSGAFKEIEGQFGTSVMTYFRFMRWLLFLNFYLMVVMLGLTMVPYMIKINRPWSFLDSPHPNNTGSNFTGDDFFEKALNCT-KNYIGFLDNQTNSEDWGSKALDTLQGTGWMEHTVLFYGTYFNKTYSLPLVEGRLT---YNMGLSYLLATGAAFLVSFFLLVKNSAKGVKSSVLDEG--SGQMTQFCNKVFGGWDFCISNQKAAKEKHKNLTQELRGDLDNQRLLWKIENRTTREKAKLYSI-RAVVNTVVLGFLGGSLYLIYYANNKLIDL-QREFGDVHPIVQTLIQFMPSVTITLLNIIVPIIFKKLVEFEDYMPAFQMQITLLRTVILRLASLLVLMGSL 547          
BLAST of Transmembrane channel protein vs. TrEMBL
Match: A0A1S3HSD2 (transmembrane channel-like protein 7 isoform X4 OS=Lingula unguis OX=7574 GN=LOC106157747 PE=4 SV=1)

HSP 1 Score: 171.4 bits (433), Expect = 5.471e-41
Identity = 149/630 (23.65%), Postives = 295/630 (46.83%), Query Frame = 3
Query:  120 SKLSLFYRKITGILEPLSIWYSSLKTIEKNCGCAVSSYFQFITWLMRINLWMFAIFLTVLLIPFLIKKPESFSDLIIDGNFTNNNDKFTLAVNCTQKAYVKDNPMTVEVIIDILNGKGLLVKSPMFIGYYFNISYFNMTGS-EFTRPLYNTPVAYCFAFWLCXXXXXXXXXXXXGTNYKLYKID-EDEFSGKFGLC--LLTGFDYGVTKKN----RILAMRNDLTKKLKIQYNQIEEFNYRSKLPKKSAIIKAFPKIVVNIIFIGFLCLIYFVIVEAQDVPIMLAQNKIVKSNAILVLLKDYVPSVTVAMINVVFQIINTKVVRFENYTKTVAVEVCFIRLILVQVISLLIFMVSLLDQTSQSNITDKVC----QQTGAIKCWENFIGQQFYRYSLLLFFSSVFVKPLIQLLQSVIFNRFGKDPDSQNTKSKVVKLIGTAGFDLSEEGFVLINAQCVCWMGFWFCPXXXXXXXXXXXXXXYIRKAMFLRNLFETKMETATVAGGQKFLLGMLLNGLAFIMLPMGYILSNKSPSRGCSPFRIYDYPGDGYSFTTFLVEFVTSQSKIFSKICNFVTSLQFFLPVLGVLIIITYVKYAQAKTYSRSIQAIRKEILNEENNLLFYEKQMMNAKE 1973
            +K  +  R+  G  E   +W SS K IE + G  + S+F F+ WL  +N+++  I  T + +P +I   +S       GN +N +    LA NC+++  V        +I+D L G G + K+ +F+G Y   S +   GS +     YN P+AY       +  S ++ ++ +G   +   ++ ED++   F  C  +  G+D+ +   N    R  ++  ++T  L+ + +     N          +++ F  + V  +  G   LIY+V V+  ++   L  N        + LL  + PS T+ ++NV+   +  KVV  E+Y+    V++  +R++ +++ SL + + ++  + + +  T   C        +I+CWE ++GQQ Y+  ++      F   LI+  + +I ++             + + IG   F +++    L+ +Q +CW+G +F P +  L ++  F+ FY++KA  L N+ E        +    F + +L+     I LP+G+ ++  +PS+GC PFRIY Y  D           +++      +   F++S  F +P   +L+I+ Y  +A A      ++ +++++  E  +  F  +Q+ +  E
Sbjct:  108 NKFKISAREFFGYFE---VWGSSFKKIEGHFGSGILSFFTFLKWLFFLNIYLAVIVFTFVTLPQVIFNTQS---AYFTGNSSNLDTAIALANNCSEQYTVNITTDWRYLILDFLQGTGWMEKTVLFMGNYTTTSLY--IGSFDAVSYSYNMPLAYLCVVGAYLGLSLLMLMHHTGKGLRESMVNSEDKY---FQHCNKVFGGWDFTLMDDNAAELRHKSLHFEITADLREERDAHRRQNRSGCKRFGLGLLRVFINLFVLAVLGGSGYLIYYVQVKVTELTQGLDYNTY---GTFIQLLIQFTPSTTITLLNVIVPFMFEKVVGGEDYSPMFEVQITLVRVVFLKLASLAVLIATIYIEVTCA--TKDTCNVGISPCPSIECWETYVGQQIYKLVIMDMIVVTFTTLLIEFPRKLIVSK---------CSCGLSERIGFQKFVITQNVLDLVYSQTLCWLGGFFSPLIPALYVIKYFIYFYLKKASLLVNM-EPPDRPYRASKSNSFFMVILMIAFGLICLPVGWCITKLTPSKGCGPFRIYSYMIDVIPLA------ISTWPTWLQEGLKFISSAGFTIPAFIILLIVIYYYHALASARKEMVKLMKEQLALEGRDKQFLLQQIKDGDE 705          
BLAST of Transmembrane channel protein vs. TrEMBL
Match: K1QXM3 (Transmembrane channel-like protein 7 OS=Crassostrea gigas OX=29159 GN=CGI_10022045 PE=4 SV=1)

HSP 1 Score: 171.785 bits (434), Expect = 5.929e-41
Identity = 167/654 (25.54%), Postives = 306/654 (46.79%), Query Frame = 3
Query:   96 EIIEIVEQSKLSLFYRKITGILEPLSIWYSSLKTIEKNCGCAVSSYFQFITWLMRINLWMFAIFLTVLLIPFLIKKPESFSDLIID------GNFTNNNDKFTL-AVNCTQKAYVKDNPMT-------VEVIIDILNGKGLLVKSPMFIGYYFNISYFNMTGSEFTRPLYNTPVAYCFAFWLCXXXXXXXXXXXXGTNYKLYKIDEDEFSGKFGLCLLTGFDYGVTKKNRILAMRNDLTKKLKIQYNQIEEFNYRSKLPKKSAIIKAFP-KIVVN----IIFIGFLCLIYFVIVEAQDVPIMLAQNKIVKSNAILVLLKDYVPSVTVAMINVVFQIINTKVVRFENYTKTVAVEVCFIRLILVQVISLLIFMVSLLDQ-TSQSNITDKVC--------QQTGAIKCWENFIGQQFYRYSLLLFFSSVFVKPLIQLLQSVIFNRFGKDPDSQNTKSKVVKLIGTAGFDLSEEGFVLINAQCVCWMGFWFCPXXXXXXXXXXXXXXYIRKAMFLRNLFETKMETATVAGGQKFLLGMLLNGLAFIMLPMGYILSNKSPSRGCSPFRIYDYPGDGYSFTTFLVEFVTSQSKIFSKICNFVTSLQFFLPVLGVLIIITYVKYAQAKTYSRSIQAIRKEILNEENNLLFYEKQMMNAKE 1973
            E IEI +  K   +  K   I + L++++ +L+ IE   G A+ +YF+F+ WLM +N ++  I   +L+IPF    P  F D++ +       N ++     TL AVNCTQ+ Y++              + +D++ G G + +S +F G Y N +Y      +  + +YN  VAY  + +   + SFI+ I +S  N K     E   + +F   +  G+DY + +       +  +   L     + +E + R  L      ++ +  +IV+N    I+  G L LI     +      M+ ++   KS+A   L   +VP +T+ +IN+V   +  K+V FE Y     +++   R IL+++ S +  MV L  +   + +   K+C            +++CWE ++GQQ Y+  L+     + V  L    +  I  ++         + K+V+L+G   FDL++    +I AQ +CW G  FCP +  + LL+  ++F+++K    +N         T      F+  +LL+     ++P GYI+    PS+ C PFR+Y      Y     LV +V S +K    +  F+ +  F +P+L +L+++ Y  +   + Y+   +   +++  E+ +  F  KQ+   KE
Sbjct:  154 ERIEI-QARKWHKWKMKFKDIRQSLTVFHGTLRGIEGRYGMAIMTYFRFVKWLMFLNFYIMLITFAILVIPFAALSPSKFDDILGNKSLPAAANVSSEVYNMTLQAVNCTQQ-YIRHTDQVHGSVHTGATLFVDLIQGTGYMERSMLFYGAYNNRTY----KEDGHQTVYNIGVAYLISVFSSFLLSFILIIKNSAKNMKASHGVEKSVA-QFTNKVFGGWDYCIKESRAANHKKKVIGGALAADLAE-QERSKRLGLRTWVDWLEVWGMRIVINTLVFILLCGSLALIGLTTSK------MIDESNGTKSSAGYTLFYQFVPHLTITLINLVVPRVFQKLVFFEEYKHETQIKITLFRSILLRLASPVALMVMLYHKLLLEDDEETKICGNLRWTADDDPSSVRCWETYVGQQVYKLLLIDIVVGILVVLLWHTPRRYINTKY-------RDRFKLVRLVGPQEFDLAKSVVDIIYAQNLCWFGLLFCPLIPAITLLHNIIVFFVKKIDLFKNCRPESRPYKTSKSTSLFMKVLLLS-FMLAVVPAGYIVGKIQPSQSCGPFRMYS--DHSYRMYHSLVNYVYSWNKAPQAVFFFIGTGIFVVPLLILLLLLMYYYWVIGRGYATKEEFALEDLKMEKMDTKFLLKQINKEKE 783          
BLAST of Transmembrane channel protein vs. Ensembl Cavefish
Match: ENSAMXT00000013385.2 (transmembrane channel-like protein 7 [Source:NCBI gene;Acc:103035818])

HSP 1 Score: 88.1965 bits (217), Expect = 5.942e-18
Identity = 89/352 (25.28%), Postives = 166/352 (47.16%), Query Frame = 3
Query:  156 ILEPLSIWYSSLKTIEKNCGCAVSSYFQFITWLMRINLWMFAIFLTVLLIPFLIKKPESFSDLIIDGNFTNNNDKFTLAVNCTQKAYVKDNPMTV--EVIIDILNGKGLLVKSPMFIGYYFNISYFNMTGSEFTRPLYNTPVAY--CFAFWLCXXXXXXXXXXXXGTNYKLYKIDEDEFSGKFGLCLLTGFDYGVTKKNRILAMRNDLTKKLKIQYNQIEEFNYRSKLPKKSAIIKAF---PKIVVNIIFIGFLCLIYFVIVEAQDVPIMLAQNKIVKSNAILVLLKDYVPSVTVAMINVVFQIINTKVVRFENYTKTVAVEVCFIRLILVQVISLLIFMVSLLDQ-TSQSN 1187
            +L  L +W + +  IE   G  + SYF F+ +L+ +N  MF +  + +++P +I    SF    ++  FT           C+         + V  + IID+L+G G L ++ +F GYY       +    F    YN P+AY  C   +L +   +I+   ++G   KL + DED F   F   +  G+D+ +T +N      + L  +LK     +EE   R K+ ++S   K+     ++ +N+  I  L   ++ I  A  +     Q +  +   I+ L+ +Y+PS+ + + N +  II + ++ FE+Y+    +    +R + +++ S+ + + SL  Q TS SN
Sbjct:  133 LLSALQLWRADIHMIEGMFGTGIQSYFSFLRFLVLLNFVMFLLMFSFVMLPIVISTHTSF----VNSTFTGGT-----GSECSVYPPTSRQGLVVFHQHIIDLLSGTGFLEQTYLFYGYY------KVNNIHFPSFSYNLPLAYLLCTITYLLLSLLWIVKRSATGFKRKLVQ-DEDRFQS-FCNKVFAGWDFCITNENAARLKHSSLLYELK---TDLEEERIRQKMAERSRKEKSRIYCLRVALNLFVIAVLVCCFYCIYSA-TIFSQQKQAQDQQYYFIVELIFEYLPSIVITLANFITPIIFSIIISFEDYSPAFEIRFTLMRCVFMRLASIGVLLFSLWSQITSCSN 463          
BLAST of Transmembrane channel protein vs. Ensembl Cavefish
Match: tmc4 (transmembrane channel-like 4 [Source:ZFIN;Acc:ZDB-GENE-030131-7489])

HSP 1 Score: 77.7962 bits (190), Expect = 1.130e-14
Identity = 93/420 (22.14%), Postives = 172/420 (40.95%), Query Frame = 3
Query:  486 SPMFIGYYFNISYFNMTGSEFTRPLYNTPVAY----CFAFWLCXXXXXXXXXXXXGTNYKLYKIDEDEFSGKFGLCLLTGFDYGVTKKNRILAMRNDLTKKLKIQYNQIEEFNYRSKLPKKSAIIKAFPKIVVNIIFIGFLCLIYFVIVEAQDVPIMLAQNKIVKSN--AILVLLKDYVPSVTVAMINVVFQIINTKVVRFENYTKTVAVEVCFIRLILVQVISLLIFMVSLLDQ-TSQSNITDKVCQQTGAI-------KCWENFIGQQFYRYSLLLFFSSVFVKPLIQLLQSVIFNRFGKDPDSQNTKSKVVKLIGTAGFDLSEEGFVLINAQCVCWMGFWFCPXXXXXXXXXXXXXXYIRKAMFLRNLFETKMETATVAGGQKFLLGMLLNGLAFIMLPMGYILSNKSPSRGCSPFR 1703
            S MF G+Y N     +  S F+   YN P+AY     F F  C+    +      G+  ++        +G +   + TG+DYG+  +      + +L  +L++   + E  N       K A      + V       FL L+   ++    + I  A            + LL +Y+PS+ +   N V  ++  KV  FE Y+ +  + +  +R + ++++SL + + +L +Q T   +++D+               +CWE  +GQ+ Y+ +L  F  ++ +         ++F  F   P        + + +G   F +      L+  Q V W G  FCP L ++  +   ++FY +K    +N     + T        F   +LL G     + + Y ++   PS GC PFR
Sbjct:    4 SYMFYGFYNNTM---VISSGFS---YNVPLAYLLTAAFYFLFCLTCIIVRM----GSVTQVMVAAGGAAAGGYSALIFTGWDYGLQGERATTLKQKNLRYQLQVDLEE-ERIN-------KMAASLTLTQTVGLYSLRTFLQLVVLAMIGGAFLGIAAATQFSQSQQQQGFVGLLLEYLPSIVITTSNFVVPMLCDKVALFEKYSPSTTIILALLRAVFLRLVSLGVLLYTLWNQITCNGDVSDRSTTDCATCSYNNLQYQCWETRVGQEMYKLTLFDFLITIAM---------LVFVEF---PRRSGQFCSLAQWVGRQEFLVPTNVLALVYGQTVVWTGALFCPLLPLINTVKFIIIFYCKKITLFQNC-RPALRTFRSTSSNFFFFLVLLFGWGLSSVVLVYSVATIHPSYGCGPFR 392          
BLAST of Transmembrane channel protein vs. Ensembl Cavefish
Match: tmc8 (transmembrane channel-like 8 [Source:ZFIN;Acc:ZDB-GENE-081114-2])

HSP 1 Score: 77.411 bits (189), Expect = 2.450e-14
Identity = 146/659 (22.15%), Postives = 280/659 (42.49%), Query Frame = 3
Query:   24 KLDLDTMLNAGYLRDGFQDTLHKNEII---EIVEQSKLSLFYRKITGILEPLSIWYSSLKTIEKNCGCAVSSYFQFITWLMRINLWMFAIF-LTVLLIPFLIKKPESFSDLIIDGNFTNNNDKFTLAVNCTQKAYVKDNPMTVEVIIDILNGKGLLVKSPMFIGYYFNISYFNMTGSEFTRPLYNTPVAYCFAFWLCXXXXXXXXXXXXGTNYKLYKIDEDEFSGKFGLCLLTGFDYGVTKKNRILAMRNDLTKKLKIQYNQIEEFNYRSKLPK---KSAIIKAFPKIVVNIIFIGFL----CLIYFVIVEAQDVPIMLAQNKIVKSNAILVLLKDYVPSVTVAMINVVFQIINTKVVRFENYTKTVAVEVCFIRLILVQVISLLIFMVSLLDQTSQSNITDKVCQQTGAIKCWENFIGQQFYR---YSLLLFFSSVFVKPLIQLLQSVIFNRFGKDPDSQNTKSKVVKLIGTAGFDLSEEGFVLINAQCVCWMGFWFCPXXXXXXXXXXXXXXYIRKAMFLRNLFETKMETATVAGGQKFLLGMLLNGLAFIMLPMGYILSNKSPSRGCSPFRIYDYPGDGYSFTTFLVEFVTSQSKIFSKICNFVTSLQF-FLPVLGVLIIITYVKYAQAKTYSRSIQAIRKEILNEENNLLFYEKQ 1955
            K ++   L+   L+ G  ++  +++ I    +VEQ K         G    L  W  +L  IE   G  V +YF F+ +L+ +NL    I  L+VLL    IKK     +L                         KDN      ++D+  G G L +SP+F  +Y              +   NT + +     L ++ SF++ +  +   YK   +  + FS      +  G+D+ +          + +  +LK+    +EE  +R ++ +   K  ++  F ++++NI  +  L     LIY+  ++        +QNK+   +  L LL +Y+P +T+ ++N V   +   +V FE+Y+ T  + +  +R I +++ SL I++  L            +   T +I+  E   G++ Y+   + LL  F + F   L+   ++ I +++          S + K IG   F +      L+ +Q V W+G ++CP L  + ++ L ++FY++    +R     +    T +    F   MLL GL    + +G  ++   P   C PF      GD   F     E V +  +      +++TS  F F  +L  +II+T +  ++     ++I+ ++  ++   ++  F  KQ
Sbjct:   60 KRNIRERLHQQKLKIGHWESWRRSQRIAWRRMVEQLK---------GFFSRLLPWKHTLHKIEGRFGVGVKAYFVFLRYLLGLNLLNCVIIALSVLLPSLYIKKGGPHCNLT-----------------------SKDN----GSVLDVFLGSGFLERSPVFYSFY--------KLKNIDKQCLNTSLLFFAGMVLILLLSFLMIVRRTVVGYKHTWMTGNHFSMNMSYKVFCGWDFCIQDPQAAFLKHSFIKNELKM---DLEEQRFRLRVSQRTLKQKVVLFFLRLILNISVLALLGGSFALIYYATIK--------SQNKLDNVHWTLKLLWEYLPPITITVVNFVLPQMFCVIVTFEDYSLTTQLNLTLVRSIFLKLASLGIYLFFL------------ITYLTTSIQNPETEFGKEMYKLTIFHLLACFCNAF---LVSFPRAWIVDKY--------PSSMLAKKIGKPEFVIPLNILDLVYSQTVTWVGVFYCPLLPAISIVKLLVIFYMKMFTVIRCCAPAQRMFRTTSSSVLFNF-MLLLGLIMSAVTLGVNINMFVPG-TCGPFM-----GDSSVFNV-TSECVQTLPRPVRNGISYITSEAFAFALILAEVIILTSL-VSRGGANRKTIERLKDMLVMCSSDKRFLVKQ 631          
BLAST of Transmembrane channel protein vs. Ensembl Cavefish
Match: tmc6a (transmembrane channel-like protein 6 [Source:NCBI gene;Acc:103036133])

HSP 1 Score: 70.4774 bits (171), Expect = 4.046e-12
Identity = 135/639 (21.13%), Postives = 246/639 (38.50%), Query Frame = 3
Query:  123 KLSLFYRKITGILEPLSIWYSSLKTIEKNCGCAVSSYFQFITWLMRINLWMFAIFLTVLLIPFLIKKPESFSDLIIDGNFTNNNDKFTLAVNCTQKAYVKDNPMTVEVIIDILNGKGLLVKSPMFIGYYFNISYFNMTGSE-FTRPLYNTPVAYCF----AFWLCXXXXXXXXXXXXGTNYKLYKIDEDEFSGKFGLCLLTGFDYGVTKKNRILAMRNDLTKKLKIQYNQIEEFNYRSKLPKKSAIIK--------AFPKIVVNIIFIGFLCLIYFVIVEAQDVPIMLAQNKIVKSNAILVLLKDYVPSVTVAMINVVFQIINTKVVRFENYTK-TVAVEVCFIRLILVQVISLLIFMVSLLDQTSQSNITDKVCQQTGAIKCWENFIGQQFYRYSLLLFFSSVFVKPLIQLLQSVIFNRFGKDPDSQNTKSKVVKLIGTAGFDLSEEGFVLINAQCVCWMGFWFCPXXXXXXXXXXXXXXYIRKAMFLRNLFETKMETATVAGGQKFLLGML-----LNGLAFIMLPMGYILSNKSPSRGCSPFRIYD---YPGDGYSFTTFLVEFVTSQSKIFSKICNFVTSLQFFLPVLGVLIIITYVKYAQAKTYSRSIQAIRKEILNEENNLLFYEKQMMNAKE 1973
            +LS   + +  +L  + +W+ +LK +    G  V SYF F+  L+     ++   L+++ IPFL+        +    + ++N   FT                     ++IL G G+L  S MF GYY     +    +E + +  YN  +AY        ++  I        + GT+  +         G   L + + +D+ ++KK  +  +  ++   LK+   ++      S +PK+  + +            I +  IF   L +  F     Q      + N I + +   ++L   V  V   +I  VF ++       E+Y    + + +  IR + ++V  L +     LD  +               +CWE F+GQ+ YR+ L+ F  SV        L SV F R            K+++      FD++     LI  Q + W+G  F P L  L ++ LFLLFY+++A  + N ++  ++           + +L     L   A I     Y +    PS  C PFR        G  +  +   +E         S I   + +  F   V G+ +++ Y+         R    ++K+I NE  +  F   ++    E
Sbjct:  176 RLSGAQQGVQSLLNSVQLWHEALKQVSGRFGTGVLSYFLFLRTLL-----LYNFILSMITIPFLV-----LPQVTRPSHGSSNKISFT--------------------GLEILTGTGVLTNSLMFYGYYNYTDGWRPGKTEAYIKGTYNIRLAYILTIGIGLFVTCIMLIYSVFKTLGTSSPM-----SVSHGNLALKVFSSWDFKISKKVYVQQLSENICTHLKVMLCELH-----SGIPKRRLMTRLIWLVLHCTAWAICLTCIFCCVLGIYRFSHDRKQ-----FSMNLISEGDTHWLILPLLVCGVN-HLIPCVFNML----AWMESYDSFNLRIYIAIIRNLFLKVSMLGVLCYHWLDSIAAGKYGTNN-------ECWETFVGQELYRFLLMDFLFSVLDTIFGNFLWSV-FTR------------KILRRKRKPVFDIALNVLELIYGQTLAWLGILFSPLLPTLQIVKLFLLFYLKRASLMMN-YQGPLKPWRATQMTTIFISILCFPSFLGATACIT----YTMWRLKPSATCGPFRTLSSMFLAGKEWRKS---LEISNPGLAWVSWIYMLLGNHIFLFIVAGIFLLVIYIHIQVGDGQRRVTTLLQKQIENEVEDKKFLISKLQTLHE 736          
BLAST of Transmembrane channel protein vs. Ensembl Cavefish
Match: tmc6a (transmembrane channel-like protein 6 [Source:NCBI gene;Acc:103036133])

HSP 1 Score: 68.1662 bits (165), Expect = 1.844e-11
Identity = 120/546 (21.98%), Postives = 215/546 (39.38%), Query Frame = 3
Query:  123 KLSLFYRKITGILEPLSIWYSSLKTIEKNCGCAVSSYFQFITWLMRINLWMFAIFLTVLLIPFLIKKPESFSDLIIDGNFTNNNDKFTLAVNCTQKAYVKDNPMTVEVIIDILNGKGLLVKSPMFIGYYFNISYFNMTGSE-FTRPLYNTPVAYCF----AFWLCXXXXXXXXXXXXGTNYKLYKIDEDEFSGKFGLCLLTGFDYGVTKKNRILAMRNDLTKKLKIQYNQIEEFNYRSKLPKKSAIIK--------AFPKIVVNIIFIGFLCLIYFVIVEAQDVPIMLAQNKIVKSNAILVLLKDYVPSVTVAMINVVFQIINTKVVRFENYTK-TVAVEVCFIRLILVQVISLLIFMVSLLDQTSQSNITDKVCQQTGAIKCWENFIGQQFYRYSLLLFFSSVFVKPLIQLLQSVIFNRFGKDPDSQNTKSKVVKLIGTAGFDLSEEGFVLINAQCVCWMGFWFCPXXXXXXXXXXXXXXYIRKAMFLRNLFETKMETATVAGGQKFLLGML-----LNGLAFIMLPMGYILSNKSPSRGCSPFR 1703
            +LS   + +  +L  + +W+ +LK +    G  V SYF F+  L+     ++   L+++ IPFL+        +    + ++N   FT                     ++IL G G+L  S MF GYY     +    +E + +  YN  +AY        ++  I        + GT+  +         G   L + + +D+ ++KK  +  +  ++   LK+   ++      S +PK+  + +            I +  IF   L +  F     Q      + N I + +   ++L   V  V   +I  VF ++       E+Y    + + +  IR + ++V  L +     LD  +               +CWE F+GQ+ YR+ L+ F  SV        L SV F R            K+++      FD++     LI  Q + W+G  F P L  L ++ LFLLFY+++A  + N ++  ++           + +L     L   A I     Y +    PS  C PFR
Sbjct:  176 RLSGAQQGVQSLLNSVQLWHEALKQVSGRFGTGVLSYFLFLRTLL-----LYNFILSMITIPFLV-----LPQVTRPSHGSSNKISFT--------------------GLEILTGTGVLTNSLMFYGYYNYTDGWRPGKTEAYIKGTYNIRLAYILTIGIGLFVTCIMLIYSVFKTLGTSSPM-----SVSHGNLALKVFSSWDFKISKKVYVQQLSENICTHLKVMLCELH-----SGIPKRRLMTRLIWLVLHCTAWAICLTCIFCCVLGIYRFSHDRKQ-----FSMNLISEGDTHWLILPLLVCGVN-HLIPCVFNML----AWMESYDSFNLRIYIAIIRNLFLKVSMLGVLCYHWLDSIAAGKYGTNN-------ECWETFVGQELYRFLLMDFLFSVLDTIFGNFLWSV-FTR------------KILRRKRKPVFDIALNVLELIYGQTLAWLGILFSPLLPTLQIVKLFLLFYLKRASLMMN-YQGPLKPWRATQMTTIFISILCFPSFLGATACIT----YTMWRLKPSATCGPFR 646          
BLAST of Transmembrane channel protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005484.1 (pep scaffold:Pmarinus_7.0:GL494392:220:3524:1 gene:ENSPMAG00000004966.1 transcript:ENSPMAT00000005484.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 67.0106 bits (162), Expect = 3.250e-12
Identity = 71/336 (21.13%), Postives = 143/336 (42.56%), Query Frame = 3
Query:  990 LKDYVPSVTVAMINVVFQIINTKVVRFENYTKTVAVEVCFIRLILVQVISLLIFMVSLLDQTSQSNITDKV---------CQQTG---AIKCWENFIGQQFYRYSLLLFFSSVFVKPLIQLLQSVIFNRFGKDPDSQNTKSKVVKLIGTAGFDLSEEGFVLINAQCVCWMGFWFCPXXXXXXXXXXXXXXYIRKAMFLRNLF-ETKMETATVAGGQKFLLGMLLNGLAFIMLPMGYILSNKSPSRGCSPFRIYDYPGDGYSFTTFLVEFVTSQSKIFSKICNFVTSLQFFLPVLGVLIIITYVKYAQAKTYSRSIQAIRKEILNEENNLLFYEKQM 1958
            L  Y+PS+ + + N +  +I    + +E+Y+    + +  +R + +++ S+ + +V+L  + + +N              CQQ G      CWE  +GQ+ Y+ ++           LI  L SV+   F +     +    + + +G   F + ++   ++  Q VCW+G  +CP L +L  +   + FY +K   + N    T+   A+ +    F++ +L   L+++  P  Y +    PS+ C PF     P         LV  V +       I  F  SL F + ++ +  +  +        ++R I  ++ E+     +  F  KQ+
Sbjct:    3 LVQYLPSIVITLANFLLPLIFGMTIVWEDYSPGFEIRLSLLRYVSLRLASVAVLLVTLWSRITCNNNNSISITSNSSISDCQQCGYNINYPCWETRVGQEMYKLTIF---------DLITSLVSVLLVEFPRKMIVTHCGCGLARWMGEQEFSIPDQVLHIVYGQTVCWVGTIYCPLLPLLAAIKYTIFFYSKKLSLMLNCRPATRPYRASSSMFFFFIVLLLGLLLSWV--PAIYTIGGIRPSQACGPFTGQRLPW------AVLVTAVQALPHWLDSILEFFASLLFAIILVVLSSLFLFYMTTLNNAHARVINQLKDELAMVGRDRAFLAKQV 321          
BLAST of Transmembrane channel protein vs. Ensembl Sea Lamprey
Match: si:dkey-15b23.3 (si:dkey-15b23.3 [Source:ZFIN;Acc:ZDB-GENE-141216-304])

HSP 1 Score: 51.2174 bits (121), Expect = 4.745e-7
Identity = 69/252 (27.38%), Postives = 116/252 (46.03%), Query Frame = 3
Query: 1182 SNITDKVC--QQTGAIKCWENFIGQQFYRYSLLLFFSSVFVKPLIQLLQSVIFNRFGKDPDSQNTKSKVVKLIGTAGFDLSEEGFVLINAQCVCWMGFWFCPXXXXXXXXXXXXXXYIRK-AMFLRNLFETKMETATVAGGQKFLLGMLLNGLAFIMLPMGYILSNKSPSRGCSPF----RIYDYPGDGYSFTTFLVEFVTSQSKIFSKICNFVTSLQFFLPVLGVLIIITYVKYAQAKTYSRSIQAIRKEI 1916
            SN T ++    ++   +CWE ++GQ+  + S++    +V    LI   +  +F RF  D    + +SK  +      F ++E    L+  Q + WMG +F P L    +L L  L Y+R  A+   N+   ++  A+ +    F L MLL  L   MLP  + +    PS GC PF    +IYD   D     T   EF       F+ + ++VT+    LP L +L+    + Y Q+   +RS++    ++
Sbjct:  111 SNTTTEMSYSSKSSENQCWETYVGQEMLKLSIIDMIFTVASVLLIDFFRG-LFVRFCSDCWCWDLESKFPEY---GEFKIAENVLHLVYNQGMIWMGAFFSPILPTFNVLKLIGLMYLRSWAVLTCNVPHQQVFRASRSNN--FYLAMLLFMLFLCMLPTIFSIVRYRPSSGCGPFSGQEKIYDIVSD-----TIKTEF----PSWFNSVVSYVTTPVVILPALLLLVSTMLIYYLQS--IARSLKVTNNDL 345          
BLAST of Transmembrane channel protein vs. Ensembl Nematostella
Match: EDO47396 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLV1])

HSP 1 Score: 100.523 bits (249), Expect = 1.368e-22
Identity = 103/431 (23.90%), Postives = 198/431 (45.94%), Query Frame = 3
Query:  684 GKFGLCLLTGFDYGVTKKNRILAMRNDLTKKLKIQYNQIEEFNYRSKLPK-KSAIIKAFPKIVVNIIFIGFLCLIYFVIVEAQDVPIMLAQNKI-VKSNAILVLLKDYVPSVTVAMINVVFQIINTKVVRFENYTKTVAVEVCFI-RLILVQVISLLIFMVSLLDQTSQSNITDKVCQQTGAIK--CWENFIGQQFYRYSLLLFFSSVFVKPLIQLLQSVIFNRFGKDPDSQNTKSKVVKLIGTAGFDLSEEGFVLINAQCVCWMGFWFCPXXXXXXXXXXXXXXYIRKAMFLRNLFETKMETATVAGGQKFLLGMLLNGLAFI-MLPMGYILSNKSPSRGCSPFRIYDYPGDGYSFTTFLVEFVTSQSKIFSKICNFVTSLQFFLPVLGVLIIITYVKYAQAKTYSRSIQAIRKEILNEENNLLFYEKQM 1958
            G + +C++      +  +  ++ +  DL + L++          R++L K ++  I+A    ++N++ IG   +  +VI EA  + +  +          ++ LLK Y  S+T++++N V   +   +   E++   V + +  + R +L+++ S+ + M+SL ++ +    TDK       IK  CWEN I  + Y+   + F  SV V  L    +    +  GK    +         IG   F + +    L+ AQC+ W+G WF P L ++  +  F+LFY +K     N      + A  AG   +   +LL G  F+ +  + Y ++  +PS    PFR  D+  D       ++  + +    F  +   ++S  F + V+ ++ +  Y  YA AK YSR I+ +R+E+  E  +  +  KQ+
Sbjct:    7 GSWDMCIVDDQAAELKMRTFLMEVEADLAEDLRLA-----SLAKRTRLEKCQTYSIRA----LINLVVIGLSAVAGYVIYEAAQLSLKSSSQLSPTNQKEMIELLKGYASSLTLSILNAVLPALFFYLAHLEDWNPRVRINILVLFRTVLLKLASVAVLMISLFEKIN----TDKCIVYPSDIKWSCWENAIAAEMYKLIWMDFIMSVLVVLLFHTPRRYAADHLGKGIGQK---------IGRPVFSIPQNVLELVYAQCLIWIGMWFSPLLPLMGCVKFFILFYTKKVNLKYNC--RTEDKAYRAGRSNYFFMVLLLGTFFLCVAAVAYGVTQITPSVLYGPFRGLDHMYD------IIILTIRTLPMEFQDVYVVISSPFFLIVVVLIICLGLYFFYATAKIYSRMIRGLREELSMESRDKRYLLKQI 407          
BLAST of Transmembrane channel protein vs. Ensembl Nematostella
Match: EDO48330 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJT8])

HSP 1 Score: 85.8853 bits (211), Expect = 2.138e-17
Identity = 104/495 (21.01%), Postives = 221/495 (44.65%), Query Frame = 3
Query:  123 KLSLFYRKITG----ILEPLSIWYSSLKTIEKNCGCAVSSYFQFITWLMRINLWMFAIFLTVLLIPFLIKKPESFSDLIIDGNFTNNNDKFTLAVNCTQKAYVKDNPMTVEVIIDILNGKGLLVKSPMFIGYYFNISYFNMTGSEFTRPLYNTPVAYCFAFWLCXXXXXXXXXXXXGTNYKLYKIDEDEFSGKF-GLC--LLTGFDYGVTKKNRILAMRNDLTKKLK---IQYNQIEEFNYRSKLPK-KSAIIKAFPKIVVNIIFIGFLCLIYFVIVEAQDVPIMLAQNKIVKSNAILVLLKDYVPSVTVAMINVVFQIINTKVVRFENYTKTVAVEVCFIRLILVQVISLLIFMVSL-LDQTSQSNITDKVCQQTGAIKCWENFIGQQFYRYSLLLFF----SSVFVKPLIQLL--QSVIFNRFGKDPDSQNTKSKVVKLIGTAGFDLSEEGFVLINAQCVCWMGFWFCPXXXXXXXXXXXXXXYIRKAMFLRN 1553
            K+++ + ++TG     L  L +W  S+K IE   G  V SYF F+ WLM +NL++F +      +P L+ +P +           NN +  T + +     Y   +P   ++++D + G G +  + +F   Y + +  ++ G  +  PL    V   + F+  ++    +T        K ++    E  G F   C      +DY +  +N       ++ + +K    +  ++E+   R++  K +   I+A   ++V  +  G +  IY  +  + D  +   +      +A +V+L     S+T+  +N++       V  FE+++    V +   R +L+++ S+ + +++L +D   + +  +K C Q      WEN I  Q Y    + FF    +++ ++ +++LL   + +F +    P+                F + +    L+  QC+ W+G +F P +  + ++ LF++FY++K   + N
Sbjct:  114 KIAMGWHRLTGRIGDALRDLELWKGSMKEIEGRFGNGVLSYFVFLKWLMFVNLFIFLLTFGFTSVPALVSEPVAAP---------NNTNSCTYSTD----TYTDKSP--PDLVLDFITGVGWINTTLLFYSSYPSETIKSVLGHTYNLPLAYLLVGGAYFFFSLLLMVNNLT--------KSFQESYIEGGGTFYSYCNKAFASWDYCIDDENTARVKSQNIVQDIKAGLAEEARLEKVRNRTRGQKCRLYTIRATCTLLVMGLLGGAVYAIYLAVEVSTDPKVQEGK------SAFMVILIRSASSLTITGLNLLLPPFFILVSNFEDWSPRFQVNISLWRTVLLRLASIAVLIITLYVDVGKKCDDGEKSCCQ----NSWENQIASQMYMLIWIDFFVVIATTLGMETILRLLFKHTRLFRKLNVMPE----------------FQIPKNVLDLVYGQCLLWIGTFFSPAIPAMGVVKLFIVFYVKKLSLMYN 559          
BLAST of Transmembrane channel protein vs. Ensembl Nematostella
Match: EDO32630 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUG1])

HSP 1 Score: 63.1586 bits (152), Expect = 2.316e-10
Identity = 143/636 (22.48%), Postives = 276/636 (43.40%), Query Frame = 3
Query:  105 EIVEQSKLSLFYRKITGILE---PLSIWYSSLKTIEKNCGCAVSSYFQFITWLMRINLWMFAIFLTVLLIPFLI----KKPESFSDLIIDGNFTNNNDKFTLAVNCTQKAYVKDNPMTVEVIIDILNGKGLLVKSPMFIGYYFNISYFNMTGSEFTRPLYNTPVAYCFAFWLCXXXXXXXXXXXXGTNYKLYKIDEDEFSGKFGLCLLTGFDYGVTK------KNRILAMRNDLTKKLKIQYNQIEEFNYRSKLPKKSAIIKAFPKIVVNIIFIGFLCLIYF-VIVEAQDVPIMLAQNKIVKSNAILVLLKDYVPSVTVAMI----NVVFQIINTKVVRFENYTKTVAVEVCFIRLILVQVISLLIFMVSL---LDQTSQSNITDKVCQQTGAIKCWENFIGQQFYRYSLLLFFSSVFVKPLIQLLQSVIFNRFGKDPDSQNTKSKVVKLIGTAGFDLSEEGFVLINAQCVCWMGFWFCPXXXXXXXXXXXXXXYIRKAMFLRNLFETKMETATVAGGQKFLLGMLLNGLAFIMLP--MGYILSNKSPSRGCSPFRIYDYPGD-GYSFTTFLVEFVTSQSKIFSKICNFVTSLQFFLPV-LGVLIIITYVKYAQAKTYSRSIQAIRKEILNEENNL 1937
            ++++   LS +   +TG+ E    + +W   LK +E   G  V SYF F+ WL+ +NL +FA+    +++P ++       ES  + I   ++          V+  Q   + D P     ++    G+G +  + MF   Y +    +  G       YN P+AY       +I  F + I +   N K   I+ +     +   +   +DY +++      K+RI+    D+   +  +  +    N   K  +K A+  +  +I VN I +  L  + F VI++A   P  L      +SN +  +L  Y  S+ +A+     N++  ++   +  FE+++  V + +   R + V++ S+   M+ L   +D+ ++    ++  +     +CWE+ +  Q Y    + FF  +     ++ L+ V +N+F              + IG   FD+      L+  QC+  +G +F P L  L ++ LFLLFY++K   + N     +      G +   +  LL    F M    +G+ ++   PS  C PFR  +   D   S  + L   V+   +   +   ++++  F LP+ L VL+ + Y + + AK + R +  + K+ L  E  +
Sbjct:   11 KVMKLGALSWWRSFVTGLREWKYAMELWRGHLKQVEGQFGSGVVSYFSFLRWLLFLNLLIFALEFGFVVLPTVVICTSWNQESHMNNITGCSYQK-------PVSTNQSLQLGDVP---NAVLQFFTGQGWIGTTLMFYSNYPSKRLISEEGVT-----YNLPLAYLLTGGCTLILCFFLMITNLMGNLKDSYIESEGMFNSYANKVFAVWDYCISEEIAARHKHRIIV--QDINSDIAEEQRKRRVQNRTRK--QKCALYSS--RIAVNFIVVPALWYVSFVVIIQAIFNPEDLDFTDKGQSN-MERILASYGSSLLIALAITIPNLLLPLLFEFLSIFEDWSAEVELALNLWRRVFVKLPSVAALMILLYINIDKKTKKKSRNQHYRLEACEQCWEDELAAQMYMLVWMDFFVVILTTLGLETLRKVFYNKF-----------SCFRRIGMQQFDIPRNVLDLVYGQCLILLGGFFSPLLPALGVIKLFLLFYVKKVSLMYN---NTLPDRPYQGAKSTYIFTLLLLFTFFMTCGLVGWGVTRVPPSL-CGPFR--NANCDLSTSILSILSAEVSKWPEWLHQAVFYMSTAAFILPITLLVLVCLHYFR-SVAKAH-RCVIGMLKDHLAFETKI 605          
BLAST of Transmembrane channel protein vs. Ensembl Medaka
Match: TMC7 (transmembrane channel like 7 [Source:HGNC Symbol;Acc:HGNC:23000])

HSP 1 Score: 139.813 bits (351), Expect = 4.767e-34
Identity = 138/612 (22.55%), Postives = 271/612 (44.28%), Query Frame = 3
Query:  159 LEPLSIWYSSLKTIEKNCGCAVSSYFQFITWLMRINLWMFAIFLTVLLIPFLIKKPESFSDLIIDGNFTNNNDKFTLAVNCTQKAYVKDNPMTVEVIIDILNGKGLLVKSPMFIGYY--FNISYFNMTGSEFTRPLYNTPVAYCFA--FWLCXXXXXXXXXXXXGTNYKLYKIDEDEFSGKFGLCLLTGFDYGVTKKNRILAMRNDLTKKLKIQYNQIEEFNYRSKLPKKSAIIKAFPKIVVNIIFIGFLCLIYFVIVEAQDVPIMLAQNKIVKSNAILVLLKDYVPSVTVAMINVVFQIINTKVVRFENYTKTVAVEVCFIRLILVQVISLLIFMVSLLDQTSQSNITDKVCQQTGAI-KCWENFIGQQFYRYSLLLFFSSVFVKPLIQLLQSVIFNRFGKDPDSQNTKSKVVKLIGTAGFDLSEEGFVLINAQCVCWMGFWFCPXXXXXXXXXXXXXXYIRKAMFLRNLFETKMETATVAGGQKFLLGMLLNGLAFIMLPMGYILSNKSPSRGCSPFRIYDYPGDGYSFTTFLVEFVTSQSKIFSKICNFVTSLQFFLPVLGVLIIITYVKYAQAKTYSRSIQAIRKEILNEENNLLFYEKQMMNAKEID 1979
            L  L +W S ++ IE   G  + SYF F+ +L+ +NL +F +    +++P +I    S        N T N+       +    +      +  E I D+L+G G L ++ +F G+Y    I Y N T        YN  +AY  A   +L +   +I+   ++G    L K DED F   F   +  G+D+ +T +      R+ L  +L+    +      ++K  +K        ++V+N+  +  L   ++ I  A        Q K VK N I+ L+ +Y+PS+ + + N +  ++ + ++ FE+Y+    +    IR + +++ S+ + + SL  Q +       +C    A+  CWE  +GQ+ Y+ ++  F   V V  L++  + +I   +         KS +    G   F + +    ++  Q +CW+G ++CP L  +  +  FL+FY++K   ++N           +    F LG+LL GL+   +P+   ++  + SR C PF   +Y     + T  ++E           + +   ++ FF+    V  +  +   A A  + R I  ++ +++    +  F   +++ A+ + 
Sbjct:  127 LSSLKLWRSDIRQIEARFGTGILSYFSFLRFLVVLNLVIFLLMFCFIMLPIIIIPYTS-------ANITQNDQDHGSVCSVYPSSTRLGLVIFHEHITDLLSGGGFLEQTYLFYGFYKVDKIQYPNGT--------YNLALAYLLATIAYLLVSLIWIVKRSATGFKQNLVK-DEDSFQC-FCNKIFAGWDFCITNEKVADLKRSSLLYELRTDLEEERIKQEKAKRTRKDKCQIYSLRLVLNVFVMVVLAACFYSIYLATTFS-QEQQRKQVKVNFIMDLIHEYLPSIVITLANFLTPLLFSVIINFEDYSPAFEIRFTLIRCVFMRLTSIGVLLFSLWSQITNCGEEPCLCGYNTALYSCWETRVGQEMYKLTVFDFIIIVAVTILVEFPRKLIVTYW---------KSGLSDWWGEQEFAIPQNVLEIVYGQTICWIGAFYCPVLPAICTIKYFLIFYVKKLSLIQNC-RPSTRPFRASSSNFFFLGVLLIGLSLACVPVTVSVAQINSSRACGPF--VNYNTSWEALTASVMELPHGAQTFLYALSSEAFAVSFFV----VSCLAMFYVIALAGAHKRVISQLKDQLVMGGRDKHFLILKLLQAQRLS 704          
BLAST of Transmembrane channel protein vs. Ensembl Medaka
Match: tmc4 (transmembrane channel like 4 [Source:NCBI gene;Acc:101161747])

HSP 1 Score: 134.806 bits (338), Expect = 1.866e-32
Identity = 155/651 (23.81%), Postives = 277/651 (42.55%), Query Frame = 3
Query:   84 LHKNEIIEIVEQSKLSLFYRKITGILEPLSIWYSSLKTIEKNCGCAVSSYFQFITWLMRINLWMFAIFLTVLLIPFLIKKPESFSDLIIDGNFTNNNDKFTLAVNCTQKAYVKDNPMTV---EVIIDILNGKGLLVKSPMFIGYYFNISYFNMTGSEFTRPLYNTPVAYCFAFWLCXXXXXXXXXXXXGTNYKLYKIDEDEFSGKFGLCLLTGFDYGVTKKNRILAMRNDLTKKLKIQYNQIEEFNYRSKLPKKSAIIKAFPKIVVNIIF-----------IGFLCLIYFVIVEAQDVPIMLAQNKIV--KSNAILVLLKDYVPSVTVAMINVVFQIINTKVVRFENYTKTVAVEVCFIRLILVQVISLLIFMVSLLDQ-TSQSNITDKVCQQT----GAIKCWENFIGQQFYRYSLLLFFSSVFVKPLIQLLQSVIFNRFGKDPDSQNTKSKVVKLIGTAGFDLSEEGFVLINAQCVCWMGFWFCPXXXXXXXXXXXXXXYIRKAMFLRNLFETKMETATVAGGQKFLLGMLLNGLAFIMLPMGYILSNKSPSRGCSPFRIYD-----YPGDGYSFTTFLVEFVTSQSKIFSKICNFVTSLQFFLPVLGVLIIITYVKYAQAKTYSRSIQAIRKEILNEENNLLFYEKQM 1958
            L K E+ +  +  KL  F  K    L  L +W  +++ I  N G  V SYF F+ +L+ +N   F +    ++IP L+ +    S +   GN             CT   Y  + P  V      +D+L+G G +  S MF GYY N    N + S      Y  P+AY F          I  I   GT  ++           + + +  G+++G   +      + +L  +L++    +EE      L K++A +    K  ++ +            I     I +    +Q+      QNK V  +S+ I  L  +Y+PS+ +++ N +  ++  ++ + E+Y+ ++ V V  +R ++++ + L + + +L DQ T   N+ D  C++      +  CWE  +GQ+ Y+ +L     ++ V  L++  + ++ +         N  SKV +L+G   F +S     L+ +Q V W G  FCP L ++  +   +LFY +K     N      +T        F L +LL G     + M Y ++   PSRGC PFR  D      P   Y+ +    EF+            F+ S  F +P+  +  ++     A    Y +S+  +R ++  E  +  F  KQ+
Sbjct:   91 LSKVELWKQEKLKKLRKFQTKAREFLYFLVLWGKTIQKIGGNFGGGVKSYFLFLRFLVVLNFVSFLLIAGFVIIPSLVFRQVGTSFMNSTGN-----------ERCT--IYEPNPPGLVVFYNFFLDLLSGTGFMEYSFMFYGYYKNTMVENNSFS------YKIPLAYLFTAVFYFAFCLICIIARMGTAARVAVATGGSTVVNYSMTVFNGWNFGCLGETATKLKQKNLLYRLQVD---LEE----ESLKKRAASLTLLKKFGLHSLRLLMALLVLGLNIAAFYGISYATTYSQE-----QQNKRVNKESDRIQDLFFEYLPSIVISVANFLVPLLCDQIAKVEHYSPSITVIVALLRAVVLRFVGLGVLLFTLWDQITCTGNMDDAKCKECSYNYASYACWETRVGQEMYKLTLFDLLINIAVLVLVEFPRRMVVD---------NWSSKVSQLVGRQEFVVSSNVLGLVYSQTVVWTGALFCPLLPLINTVKFVILFYCKKITLFSNC-RPPQKTFRSTTSAFFFLVVLLLGWMLASVVMIYSIAVIHPSRGCGPFRFSDNMWLIIPTSFYNLSAATQEFLF-----------FIGSQAFTIPLFSLSGLVMCYVIALFSIYGKSVGLLRLQLKRESRDKQFLVKQI 689          
BLAST of Transmembrane channel protein vs. Ensembl Medaka
Match: tmc8 (transmembrane channel-like protein 7 [Source:NCBI gene;Acc:101172389])

HSP 1 Score: 77.0258 bits (188), Expect = 3.335e-14
Identity = 126/579 (21.76%), Postives = 237/579 (40.93%), Query Frame = 3
Query:  177 WYSSLKTIEKNCGCAVSSYFQFITWLMRINLWMFAIFLTVLLIPFLIKKPESFSDLIIDGNFTNNNDKFTLAVNCTQKAYVKDNPMTVEVIIDILNGKGLLVKSPMFIGYYFNISYFNMTGSEFTRPLYNTPVAYCFAFWLCXXXXXXXXXXXXGTNYKLYKIDEDEFSGKFGLCLLTGFDYGVTKKNRILAMRNDLTKKLKIQYNQIEEFNYRSKLPKKSAIIKAFP-KIVVNIIFIGFLCLIYFVIVEAQDVPIMLAQNKIVKSNAILVLLKDYVPSVTVAMINVVFQIINTKVVRFENYTKTVAVEVCFIRLILVQVISLLIFMVSLLDQTSQSNITDKVCQQTGAIKCWENFIGQQFYRYSLLLFFSSVFVKPLIQLLQSVIFNRFGKDPDSQNTKSKVVKLIGTAGFDLSEEGFVLINAQCVCWMGFWFCPXXXXXXXXXXXXXXYIRKAMFLR-NLFETKMETATVAGGQKFLLGMLLNGLAFIMLPMGYILSNKS-----PSRGCSPFRIYDYPGDGYSFTTFLV--EFVTSQSKIFSKICNFVTSLQFFLPVL--GVLIIITYVKYAQAKT 1880
            W  +L  IE   G  V SYF F+ +L+ +NL      L   L+   I  P +F          ++ ++ T  +N  +              +D+  G G L  SP+F G+Y +        S       NTP+ Y       ++ S I+ I  +   YK   +    +S      +   +D+ +          + +   LK+ + Q + F+ R  +      ++ +  + ++N+I +  L   +++I  +  V    +Q K    + ++ LL  Y+P +T+  +N+V   +  K+  FE+Y+ T  V    +R I +++ SL I++     + S++              C EN  G++ Y+  +  F ++     L+   + ++  +F          S + +L G   F +      L+  Q V W+G + CP L ++ +  L   FYI+K   LR  + E +M  A+ +      + +L   +A + L  GY    +       S  C PF        G   T F V  E V +          +++S  F LP++   ++I+ +YV   +A T
Sbjct:  140 WKHTLHKIEGRVGVGVKSYFVFLRYLIWLNL------LHCALVGGFIVGPTAF----------HSGNRKTELLNMVKNFSA----------LDVFLGTGFLENSPLFFGFYKH--------SSLRFSCLNTPLLYFAGIISILLLSLIMVIRRTTVGYKHTWMVGKRYSTNVSFKIFCSWDFTIQDPTAATLKHSFIRNDLKL-FLQEQSFSLRKAMRTFGQKLRLYLLRFILNLIVLCLLGGAFYLIYFSTHV----SQQKTDDLSWLVNLLYQYLPPITITFVNLVLPHMFRKISSFEDYSFTTQVNATLVRSIFLKLASLGIYLFFFFRKLSEA--------------CRENRFGREMYKLCIFNFLATFCNTFLLSYPRKLLKEKF--------PTSLLARLSGKQRFLIPFNVLDLVYVQTVSWVGVYSCPLLPLIGIFTLTATFYIKKFSVLRCCMAEQRMFRASSSSVLFHFMLLLGLLMAAVTL--GYDFHKQQYPSSSTSSSCGPF--------GSEETVFNVTGECVKNLPAAAQTTIRYLSSEAFALPLILAEIIILTSYVSRGRANT 647          
BLAST of Transmembrane channel protein vs. Ensembl Medaka
Match: tmc8 (transmembrane channel-like protein 7 [Source:NCBI gene;Acc:101172389])

HSP 1 Score: 76.2554 bits (186), Expect = 5.541e-14
Identity = 126/579 (21.76%), Postives = 237/579 (40.93%), Query Frame = 3
Query:  177 WYSSLKTIEKNCGCAVSSYFQFITWLMRINLWMFAIFLTVLLIPFLIKKPESFSDLIIDGNFTNNNDKFTLAVNCTQKAYVKDNPMTVEVIIDILNGKGLLVKSPMFIGYYFNISYFNMTGSEFTRPLYNTPVAYCFAFWLCXXXXXXXXXXXXGTNYKLYKIDEDEFSGKFGLCLLTGFDYGVTKKNRILAMRNDLTKKLKIQYNQIEEFNYRSKLPKKSAIIKAFP-KIVVNIIFIGFLCLIYFVIVEAQDVPIMLAQNKIVKSNAILVLLKDYVPSVTVAMINVVFQIINTKVVRFENYTKTVAVEVCFIRLILVQVISLLIFMVSLLDQTSQSNITDKVCQQTGAIKCWENFIGQQFYRYSLLLFFSSVFVKPLIQLLQSVIFNRFGKDPDSQNTKSKVVKLIGTAGFDLSEEGFVLINAQCVCWMGFWFCPXXXXXXXXXXXXXXYIRKAMFLR-NLFETKMETATVAGGQKFLLGMLLNGLAFIMLPMGYILSNKS-----PSRGCSPFRIYDYPGDGYSFTTFLV--EFVTSQSKIFSKICNFVTSLQFFLPVL--GVLIIITYVKYAQAKT 1880
            W  +L  IE   G  V SYF F+ +L+ +NL      L   L+   I  P +F          ++ ++ T  +N  +              +D+  G G L  SP+F G+Y +        S       NTP+ Y       ++ S I+ I  +   YK   +    +S      +   +D+ +          + +   LK+ + Q + F+ R  +      ++ +  + ++N+I +  L   +++I  +  V    +Q K    + ++ LL  Y+P +T+  +N+V   +  K+  FE+Y+ T  V    +R I +++ SL I++     + S++              C EN  G++ Y+  +  F ++     L+   + ++  +F          S + +L G   F +      L+  Q V W+G + CP L ++ +  L   FYI+K   LR  + E +M  A+ +      + +L   +A + L  GY    +       S  C PF        G   T F V  E V +          +++S  F LP++   ++I+ +YV   +A T
Sbjct:  140 WKHTLHKIEGRVGVGVKSYFVFLRYLIWLNL------LHCALVGGFIVGPTAF----------HSGNRKTELLNMVKNFSA----------LDVFLGTGFLENSPLFFGFYKH--------SSLRFSCLNTPLLYFAGIISILLLSLIMVIRRTTVGYKHTWMVGKRYSTNVSFKIFCSWDFTIQDPTAATLKHSFIRNDLKL-FLQEQSFSLRKAMRTFGQKLRLYLLRFILNLIVLCLLGGAFYLIYFSTHV----SQQKTDDLSWLVNLLYQYLPPITITFVNLVLPHMFRKISSFEDYSFTTQVNATLVRSIFLKLASLGIYLFFFFRKLSEA--------------CRENRFGREMYKLCIFNFLATFCNTFLLSYPRKLLKEKF--------PTSLLARLSGKQRFLIPFNVLDLVYVQTVSWVGVYSCPLLPLIGIFTLTATFYIKKFSVLRCCMAEQRMFRASSSSVLFHFMLLLGLLMAAVTL--GYDFHKQQYPSSSTSSSCGPF--------GSEETVFNVTGECVKNLPAAAQTTIRYLSSEAFALPLILAEIIILTSYVSRGRANT 647          
BLAST of Transmembrane channel protein vs. Ensembl Medaka
Match: tmc5 (transmembrane channel like 5 [Source:NCBI gene;Acc:101157036])

HSP 1 Score: 65.0846 bits (157), Expect = 1.426e-10
Identity = 116/529 (21.93%), Postives = 212/529 (40.08%), Query Frame = 3
Query:  450 IDILNGKGLLVKSPMFIGYYFNISYFNMTGSEFTRPLYNTPVAYCFA----FWLCXXXXXXXXXXXXGTNYKLYKIDEDEFSGKFGLCLLTGFDYGVTKKNRILAMRNDLTKKLKIQYNQIEEFNYRSKLPKKSAIIKAFPKIVVNIIFIGFLCLIYFVIVEAQDVPIMLAQNKIVKSNAILVLLKDYVPSVTVAMINVVFQIINTKVVRFENYTKTVA-VEVCFIRLILVQVISLLIFMVSLLDQTSQSNITDKVCQQTGAIKCWENFIGQQFYRYSLLLFFSSVFVKPLIQLLQSVIFNRFGKDPDSQNTKSKVVKLIGTAGFDLSEEGFVLINAQCVCWMGFWFCPXXXXXXXXXXXXXXYIRKAMFLRNLFETKMETATVAGGQKFLLGMLLNGLAFIMLPM-GYILSNKSPSRGCSPFRIYD---------------YPGDGYSFTTFLVEFVTSQSKIFSKICNFVTSLQFFLPVLGVLIIITYVKYAQAKTYSRSIQAIRKEILNEENNLLFYEKQMMNAKE 1973
            +++L G G    + M+ G Y N +  +  G E     YN  +AY F       LC I+       S   N+ L  +D    S    LC    +D+ +T +  +   +N+L + L  +  Q +    R KL  K + I     +V   +  G  C   F + +  +                  LL  +V S+   +I + F + N    +FE+Y+   + +    +R +L+++  L +     +++ SQ            +  CWE+ +GQ  YR  ++ F   +      + L++VI              +K+ + +G   FD++     LI AQ + W+G +F P L  + +L  F+LFY++K    +N  +    T   A  Q   + +L        + + GY   + +PS+ C PFR  D                PG G++   F                N + S  F+  +  +++ ITYV Y   +     I  +++ I+NE  +  F   ++ N ++
Sbjct:  134 LELLTGAGYFTHTVMYYGAYSNETLRH--GVE-----YNLQLAYFFTIVVYMVLCGIALTFSMASSFKKNFVL--VDPASTSAWQLLC---SWDFSLTGEKTVTQRKNNLRESLSEKAQQ-KLLTLREKL--KHSGIHLGSWLVSTALVAG--CASSFSLQQEAET-----------------LLVPFVVSLMNLVIPLFFSLFN----KFEHYSNNRSQIYSQVVRNVLLRMSILGVLCYHWMNEVSQRE----------SFLCWESMVGQALYRLVIVDFLFLMLGSFFGEFLRNVI-------------GTKLHRRLGPPEFDVARNVLDLIYAQTLAWIGLYFSPLLPSIQILKFFILFYLKKVSLTQNC-QPPCRTGRAAQMQTIFIFLLFIPFYVGAISIVGYTAWSLNPSQNCGPFRGLDRSFSVVELWMAGLQTLPGSGWAVWIFE---------------NIIKSEIFYFLITLIILAITYVFYQLIQGRKMLIDLLKQRIVNEGKDKSFLLDKLQNLQK 585          
BLAST of Transmembrane channel protein vs. Planmine SMEST
Match: SMESG000013576.1 (SMESG000013576.1)

HSP 1 Score: 1264.98 bits (3272), Expect = 0.000e+0
Identity = 654/656 (99.70%), Postives = 654/656 (99.70%), Query Frame = 3
Query:   42 MLNAGYLRDGFQDTLHKNEIIEIVEQSKLSLFYRKITGILEPLSIWYSSLKTIEKNCGCAVSSYFQFITWLMRINLWMFAIFLTVLLIPFLIKKPESFSDLIIDGNFTNNNDKFTLAVNCTQKAYVKDNPMTVEVIIDILNGKGLLVKSPMFIGYYFNISYFNMTGSEFTRPLYNTPVAYCFAFWLCXXXXXXXXXXXXGTNYKLYKIDEDEFSGKFGLCLLTGFDYGVTKKNRILAMRNDLTKKLKIQYNQIEEFNYRSKLPKKSAIIKAFPKIVVNIIFIGFLCLIYFVIVEAQDVPIMLAQNKIVKSNAILVLLKDYVPSVTVAMINVVFQIINTKVVRFENYTKTVAVEVCFIRLILVQVISLLIFMVSLLDQTSQSNITDKVCQQTGAIKCWENFIGQQFYRYSLLLFFSSVFVKPLIQLLQSVIFNRFGKDPDSQNTKSKVVKLIGTAGFDLSEEGFVLINAQCVCWMGFWFCPXXXXXXXXXXXXXXYIRKAMFLRNLFETKMETATVAGGQKFLLGMLLNGLAFIMLPMGYILSNKSPSRGCSPFRIYDYPGDGYSFTTFLVEFVTSQSKIFSKICNFVTSLQFFLPVLGVLIIITYVKYAQAKTYSRSIQAIRKEILNEENNLLFYEKQMMNAKEIDLNDQILLQSR 2009
            MLNAGYLRDGFQDTLHKNEIIEIVEQSKLSLFYRKITGILEPLSIWYSSLKTIEKNCGCAVSSYFQFITWLMRINLWMFAIFLTVLLIPFLIKKPESFSDLIIDGNFTNNNDKFTLAVNCTQKAYVKDNPMTVEVIIDILNGKGLLVKSPMFIGYYFNISYFNMTGSEFTRPLYNTPVAYCFAFWLCIISSFIITIYSSGTNYKLYKIDEDEFSGKFGLCLLTGFDYGVTKKNRILAMRNDLTKKLKIQYNQIEEFNYRSKLPKKSAIIKAFPKIVVNIIFIGFLCLIYFVIVEAQDVPIMLAQNKIVKSNAILVLLKDYVPSVTVAMINVVFQIINTKVVRFENYTKTVAVEVCFIRLILVQVISLLIFMVSLLDQTSQSNITDKVCQQTGAIKCWENFIGQQFYRYSLLLFFSSVFVKPLIQLLQSVIFNRFGKDPDSQNTKSKVVKLIGTAGFDLSEEGFVLINAQCVCWMGFWFCPFLLVLMLLNLFLLFYIRKAMFLRNLFETKMETATVAGGQKFLLGMLLNGLAFIMLPMGYILSNKSPSRGCSPFRIYDYPGDGYSFTTFLVEFVTSQSKIFSKI NFVTSLQFFLPVLGVLIIITYVKYAQAKTYSRSIQAIRKEILNEENNLLFYEKQMMNAKEIDLNDQILLQ R
Sbjct:    1 MLNAGYLRDGFQDTLHKNEIIEIVEQSKLSLFYRKITGILEPLSIWYSSLKTIEKNCGCAVSSYFQFITWLMRINLWMFAIFLTVLLIPFLIKKPESFSDLIIDGNFTNNNDKFTLAVNCTQKAYVKDNPMTVEVIIDILNGKGLLVKSPMFIGYYFNISYFNMTGSEFTRPLYNTPVAYCFAFWLCIISSFIITIYSSGTNYKLYKIDEDEFSGKFGLCLLTGFDYGVTKKNRILAMRNDLTKKLKIQYNQIEEFNYRSKLPKKSAIIKAFPKIVVNIIFIGFLCLIYFVIVEAQDVPIMLAQNKIVKSNAILVLLKDYVPSVTVAMINVVFQIINTKVVRFENYTKTVAVEVCFIRLILVQVISLLIFMVSLLDQTSQSNITDKVCQQTGAIKCWENFIGQQFYRYSLLLFFSSVFVKPLIQLLQSVIFNRFGKDPDSQNTKSKVVKLIGTAGFDLSEEGFVLINAQCVCWMGFWFCPFLLVLMLLNLFLLFYIRKAMFLRNLFETKMETATVAGGQKFLLGMLLNGLAFIMLPMGYILSNKSPSRGCSPFRIYDYPGDGYSFTTFLVEFVTSQSKIFSKIWNFVTSLQFFLPVLGVLIIITYVKYAQAKTYSRSIQAIRKEILNEENNLLFYEKQMMNAKEIDLNDQILLQPR 656          
The following BLAST results are available for this feature:
BLAST of Transmembrane channel protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TMC78.191e-2720.76transmembrane channel like 7 [Source:HGNC Symbol;A... [more]
TMC72.843e-2620.76transmembrane channel like 7 [Source:HGNC Symbol;A... [more]
TMC72.442e-2521.24transmembrane channel like 7 [Source:HGNC Symbol;A... [more]
TMC51.407e-1722.19transmembrane channel like 5 [Source:HGNC Symbol;A... [more]
TMC52.551e-1722.19transmembrane channel like 5 [Source:HGNC Symbol;A... [more]
back to top
BLAST of Transmembrane channel protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tmc-16.037e-923.37Transmembrane channel-like protein 1 [Source:UniP... [more]
back to top
BLAST of Transmembrane channel protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Tmc8.457e-723.30gene:FBgn0267796 transcript:FBtr0347574[more]
Tmc9.502e-723.30gene:FBgn0267796 transcript:FBtr0347573[more]
back to top
BLAST of Transmembrane channel protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tmc41.121e-2623.23transmembrane channel-like 4 [Source:ZFIN;Acc:ZDB-... [more]
tmc88.038e-1922.80transmembrane channel-like 8 [Source:ZFIN;Acc:ZDB-... [more]
tmc88.306e-1722.20transmembrane channel-like 8 [Source:ZFIN;Acc:ZDB-... [more]
tmc53.657e-1622.10transmembrane channel like 5 [Source:ZFIN;Acc:ZDB-... [more]
tmc6b4.911e-1122.68transmembrane channel-like 6b [Source:ZFIN;Acc:ZDB... [more]
back to top
BLAST of Transmembrane channel protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TMC72.443e-3123.19transmembrane channel like 7 [Source:NCBI gene;Acc... [more]
TMC73.938e-3022.76transmembrane channel like 7 [Source:NCBI gene;Acc... [more]
TMC42.342e-2923.81transmembrane channel like 4 [Source:NCBI gene;Acc... [more]
TMC78.332e-2923.82transmembrane channel like 7 [Source:NCBI gene;Acc... [more]
TMC71.249e-2823.93transmembrane channel like 7 [Source:NCBI gene;Acc... [more]
back to top
BLAST of Transmembrane channel protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tmc74.778e-2620.83transmembrane channel-like gene family 7 [Source:M... [more]
Tmc42.636e-2224.71transmembrane channel-like gene family 4 [Source:M... [more]
Tmc45.089e-2224.61transmembrane channel-like gene family 4 [Source:M... [more]
Tmc54.516e-1520.09transmembrane channel-like gene family 5 [Source:M... [more]
Tmc59.983e-1420.50transmembrane channel-like gene family 5 [Source:M... [more]
back to top
BLAST of Transmembrane channel protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5YCC5|TMC7_CHICK4.994e-3323.15Transmembrane channel-like protein 7 OS=Gallus gal... [more]
sp|Q7Z402|TMC7_HUMAN1.365e-2520.76Transmembrane channel-like protein 7 OS=Homo sapie... [more]
sp|Q4R7U0|TMC7_MACFA2.082e-2521.26Transmembrane channel-like protein 7 OS=Macaca fas... [more]
sp|Q8C428|TMC7_MOUSE3.342e-2520.83Transmembrane channel-like protein 7 OS=Mus muscul... [more]
sp|Q7TQ65|TMC4_MOUSE2.886e-2124.17Transmembrane channel-like protein 4 OS=Mus muscul... [more]
back to top
BLAST of Transmembrane channel protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
V3ZD292.698e-5125.71TMC domain-containing protein OS=Lottia gigantea O... [more]
A0A210QF501.924e-4725.07Transmembrane channel-like protein 7 OS=Mizuhopect... [more]
K1Q7L44.686e-4123.48Transmembrane channel-like protein 7 OS=Crassostre... [more]
A0A1S3HSD25.471e-4123.65transmembrane channel-like protein 7 isoform X4 OS... [more]
K1QXM35.929e-4125.54Transmembrane channel-like protein 7 OS=Crassostre... [more]
back to top
BLAST of Transmembrane channel protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000013385.25.942e-1825.28transmembrane channel-like protein 7 [Source:NCBI ... [more]
tmc41.130e-1422.14transmembrane channel-like 4 [Source:ZFIN;Acc:ZDB-... [more]
tmc82.450e-1422.15transmembrane channel-like 8 [Source:ZFIN;Acc:ZDB-... [more]
tmc6a4.046e-1221.13transmembrane channel-like protein 6 [Source:NCBI ... [more]
tmc6a1.844e-1121.98transmembrane channel-like protein 6 [Source:NCBI ... [more]
back to top
BLAST of Transmembrane channel protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000005484.13.250e-1221.13pep scaffold:Pmarinus_7.0:GL494392:220:3524:1 gene... [more]
si:dkey-15b23.34.745e-727.38si:dkey-15b23.3 [Source:ZFIN;Acc:ZDB-GENE-141216-3... [more]
back to top
BLAST of Transmembrane channel protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transmembrane channel protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO473961.368e-2223.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO483302.138e-1721.01Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO326302.316e-1022.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Transmembrane channel protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TMC74.767e-3422.55transmembrane channel like 7 [Source:HGNC Symbol;A... [more]
tmc41.866e-3223.81transmembrane channel like 4 [Source:NCBI gene;Acc... [more]
tmc83.335e-1421.76transmembrane channel-like protein 7 [Source:NCBI ... [more]
tmc85.541e-1421.76transmembrane channel-like protein 7 [Source:NCBI ... [more]
tmc51.426e-1021.93transmembrane channel like 5 [Source:NCBI gene;Acc... [more]
back to top
BLAST of Transmembrane channel protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000013576.10.000e+099.70SMESG000013576.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028041 ID=SMED30028041|Name=Transmembrane channel protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2145bp
TAAATTTGTAATTTATATTTTATAAATTGGACTTAGATACAATGTTAAAT
GCGGGCTATTTGAGAGATGGATTCCAAGATACCTTACACAAGAATGAAAT
CATAGAAATTGTTGAACAGTCTAAGTTATCCCTATTTTATCGAAAAATCA
CTGGAATTTTAGAGCCATTGTCGATTTGGTATTCTAGCCTAAAAACAATA
GAAAAAAATTGTGGCTGTGCTGTGTCATCATATTTTCAGTTTATTACATG
GCTTATGAGGATAAACCTTTGGATGTTTGCAATATTTCTAACTGTTTTGT
TGATTCCTTTTTTGATCAAGAAACCAGAATCATTCAGCGATTTGATAATA
GATGGAAATTTTACAAACAATAATGACAAATTTACACTGGCAGTGAATTG
CACTCAAAAAGCCTATGTGAAAGACAACCCGATGACCGTGGAGGTTATAA
TTGACATTTTGAATGGGAAGGGATTATTAGTAAAATCCCCAATGTTTATA
GGATATTATTTTAATATATCCTATTTCAACATGACTGGTAGCGAATTCAC
CAGACCGCTGTACAATACCCCTGTTGCTTATTGCTTTGCATTCTGGTTAT
GTATTATATCCAGCTTTATTATCACGATATACAGTTCCGGTACAAACTAC
AAACTATATAAAATAGATGAAGATGAATTTAGCGGAAAATTTGGGCTTTG
TTTATTAACAGGGTTTGATTATGGAGTCACGAAAAAGAACAGAATATTAG
CAATGAGAAATGATTTAACAAAAAAATTAAAAATCCAATACAATCAAATT
GAAGAATTCAACTACAGATCTAAATTACCGAAAAAGTCAGCAATTATTAA
AGCTTTTCCTAAAATAGTTGTTAATATTATATTCATTGGATTCTTATGTT
TGATCTACTTTGTAATTGTTGAAGCTCAGGATGTACCAATTATGTTGGCA
CAAAATAAAATTGTCAAATCCAATGCAATTTTGGTTCTTTTGAAAGATTA
TGTACCTTCAGTGACGGTTGCTATGATTAACGTAGTGTTCCAAATCATCA
ACACAAAGGTTGTTAGATTCGAGAATTATACGAAAACAGTTGCAGTTGAA
GTTTGCTTTATAAGATTGATCTTAGTGCAAGTGATTTCATTGTTGATCTT
CATGGTGAGTCTGCTGGACCAGACCAGCCAATCTAATATCACTGACAAAG
TCTGTCAGCAAACAGGTGCTATAAAATGTTGGGAAAACTTTATTGGTCAG
CAATTTTATCGTTACTCTCTTTTGCTATTTTTCTCGTCTGTGTTTGTCAA
ACCTTTGATTCAATTATTGCAATCGGTAATTTTTAATCGATTTGGAAAAG
ATCCAGATTCACAGAATACGAAATCGAAAGTAGTGAAATTAATTGGTACT
GCAGGGTTTGATTTGTCTGAAGAAGGATTTGTTTTAATTAATGCCCAATG
TGTTTGTTGGATGGGATTTTGGTTTTGTCCATTTCTACTAGTACTCATGC
TGCTGAACTTATTTTTGCTATTTTACATTCGGAAAGCAATGTTTCTCAGA
AACTTATTCGAAACTAAAATGGAAACAGCTACTGTTGCGGGTGGTCAAAA
GTTCTTGTTGGGAATGTTACTAAACGGATTAGCCTTTATCATGTTGCCGA
TGGGTTATATACTGTCAAACAAATCTCCATCAAGAGGTTGCTCACCGTTT
CGAATATACGATTACCCAGGAGACGGCTACTCATTCACAACGTTTTTAGT
AGAATTTGTTACTTCGCAATCTAAAATATTCAGTAAAATTTGCAATTTTG
TTACTTCATTGCAATTCTTTCTTCCAGTACTTGGTGTGTTAATCATTATC
ACGTACGTAAAATATGCGCAAGCAAAGACATATTCTCGATCAATTCAAGC
TATAAGAAAGGAAATATTAAATGAAGAAAACAATCTATTGTTTTATGAGA
AACAAATGATGAATGCAAAGGAAATTGACTTGAATGACCAGATTTTATTG
CAATCTCGATGAGAAAACTGTGAAATATAATGCAAATTTGACTCATTTAA
ATTATGAAATTGTTAATTAAGATTTTTAATATTATATATATATATAGAGA
GTGAGAGAGAGAGAGAGAGATAGAGAGAGAGAGAAAGAGAGAAAG
back to top

protein sequence of SMED30028041-orf-1

>SMED30028041-orf-1 ID=SMED30028041-orf-1|Name=SMED30028041-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=657bp
MLNAGYLRDGFQDTLHKNEIIEIVEQSKLSLFYRKITGILEPLSIWYSSL
KTIEKNCGCAVSSYFQFITWLMRINLWMFAIFLTVLLIPFLIKKPESFSD
LIIDGNFTNNNDKFTLAVNCTQKAYVKDNPMTVEVIIDILNGKGLLVKSP
MFIGYYFNISYFNMTGSEFTRPLYNTPVAYCFAFWLCIISSFIITIYSSG
TNYKLYKIDEDEFSGKFGLCLLTGFDYGVTKKNRILAMRNDLTKKLKIQY
NQIEEFNYRSKLPKKSAIIKAFPKIVVNIIFIGFLCLIYFVIVEAQDVPI
MLAQNKIVKSNAILVLLKDYVPSVTVAMINVVFQIINTKVVRFENYTKTV
AVEVCFIRLILVQVISLLIFMVSLLDQTSQSNITDKVCQQTGAIKCWENF
IGQQFYRYSLLLFFSSVFVKPLIQLLQSVIFNRFGKDPDSQNTKSKVVKL
IGTAGFDLSEEGFVLINAQCVCWMGFWFCPFLLVLMLLNLFLLFYIRKAM
FLRNLFETKMETATVAGGQKFLLGMLLNGLAFIMLPMGYILSNKSPSRGC
SPFRIYDYPGDGYSFTTFLVEFVTSQSKIFSKICNFVTSLQFFLPVLGVL
IIITYVKYAQAKTYSRSIQAIRKEILNEENNLLFYEKQMMNAKEIDLNDQ
ILLQSR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005887integral component of plasma membrane
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
Vocabulary: INTERPRO
TermDefinition
IPR038900TMC
IPR012496TMC_dom
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 611..645
NoneNo IPR availableTMHMMTMhelixcoord: 584..606
NoneNo IPR availableTMHMMTMhelixcoord: 178..200
NoneNo IPR availableTMHMMTMhelixcoord: 271..293
NoneNo IPR availableTMHMMTMhelixcoord: 521..543
NoneNo IPR availableTMHMMTMhelixcoord: 135..157
NoneNo IPR availableTMHMMTMhelixcoord: 314..336
NoneNo IPR availableTMHMMTMhelixcoord: 473..495
NoneNo IPR availableTMHMMTMhelixcoord: 409..431
NoneNo IPR availableTMHMMTMhelixcoord: 356..375
NoneNo IPR availableTMHMMTMhelixcoord: 70..92
IPR012496TMC domainPFAMPF07810TMCcoord: 396..504
e-value: 3.2E-18
score: 66.3
IPR038900Transmembrane channel-like proteinPANTHERPTHR23302TRANSMEMBRANE CHANNEL-RELATEDcoord: 28..643