asparagine synthetase [glutamine-hydrolyzing]

Overview
Nameasparagine synthetase [glutamine-hydrolyzing]
Smed IDSMED30028038
Length (bp)369
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028038

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30028038SMESG000051174.1 SmedASXL_014342SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30028038SMESG000051174.1 dd_Smed_v6_22615_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30028038SMESG000051174.1 OX_Smed_1.0.03136ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Human
Match: ASNS (asparagine synthetase (glutamine-hydrolyzing) [Source:HGNC Symbol;Acc:HGNC:753])

HSP 1 Score: 89.3521 bits (220), Expect = 2.067e-21
Identity = 45/123 (36.59%), Postives = 70/123 (56.91%), Query Frame = 1
Query:    1 LPISFLDHQFLAYYYSLDSKLKQPKFGVEKWLLRKSFDLNGFLPNEVLWRKKIPFGMGLESNNNDLLEVKLNNYYDSMISDEELEQGVLKYKFLPPKTKQEYQYRKYFEEYFPKQYSLCPQTW 369
            L + FLDH+F +YY SL  +++ PK G+EK LLR++F+ +  +P E+LWR K  F  G+ S  N   ++ L  Y +  + D  +     K+ F  PKTK+ Y YR+ FE ++P +       W
Sbjct:  333 LRVPFLDHRFSSYYLSLPPEMRIPKNGIEKHLLRETFEDSNLIPKEILWRPKEAFSDGITSVKNSWFKI-LQEYVEHQVDDAMMANAAQKFPFNTPKTKEGYYYRQVFERHYPGRADWLSHYW 454          
BLAST of asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Human
Match: ASNS (asparagine synthetase (glutamine-hydrolyzing) [Source:HGNC Symbol;Acc:HGNC:753])

HSP 1 Score: 89.3521 bits (220), Expect = 2.067e-21
Identity = 45/123 (36.59%), Postives = 70/123 (56.91%), Query Frame = 1
Query:    1 LPISFLDHQFLAYYYSLDSKLKQPKFGVEKWLLRKSFDLNGFLPNEVLWRKKIPFGMGLESNNNDLLEVKLNNYYDSMISDEELEQGVLKYKFLPPKTKQEYQYRKYFEEYFPKQYSLCPQTW 369
            L + FLDH+F +YY SL  +++ PK G+EK LLR++F+ +  +P E+LWR K  F  G+ S  N   ++ L  Y +  + D  +     K+ F  PKTK+ Y YR+ FE ++P +       W
Sbjct:  333 LRVPFLDHRFSSYYLSLPPEMRIPKNGIEKHLLRETFEDSNLIPKEILWRPKEAFSDGITSVKNSWFKI-LQEYVEHQVDDAMMANAAQKFPFNTPKTKEGYYYRQVFERHYPGRADWLSHYW 454          
BLAST of asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Human
Match: ASNS (asparagine synthetase (glutamine-hydrolyzing) [Source:HGNC Symbol;Acc:HGNC:753])

HSP 1 Score: 89.3521 bits (220), Expect = 2.442e-21
Identity = 45/123 (36.59%), Postives = 70/123 (56.91%), Query Frame = 1
Query:    1 LPISFLDHQFLAYYYSLDSKLKQPKFGVEKWLLRKSFDLNGFLPNEVLWRKKIPFGMGLESNNNDLLEVKLNNYYDSMISDEELEQGVLKYKFLPPKTKQEYQYRKYFEEYFPKQYSLCPQTW 369
            L + FLDH+F +YY SL  +++ PK G+EK LLR++F+ +  +P E+LWR K  F  G+ S  N   ++ L  Y +  + D  +     K+ F  PKTK+ Y YR+ FE ++P +       W
Sbjct:  416 LRVPFLDHRFSSYYLSLPPEMRIPKNGIEKHLLRETFEDSNLIPKEILWRPKEAFSDGITSVKNSWFKI-LQEYVEHQVDDAMMANAAQKFPFNTPKTKEGYYYRQVFERHYPGRADWLSHYW 537          
BLAST of asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Human
Match: ASNS (asparagine synthetase (glutamine-hydrolyzing) [Source:HGNC Symbol;Acc:HGNC:753])

HSP 1 Score: 89.3521 bits (220), Expect = 2.442e-21
Identity = 45/123 (36.59%), Postives = 70/123 (56.91%), Query Frame = 1
Query:    1 LPISFLDHQFLAYYYSLDSKLKQPKFGVEKWLLRKSFDLNGFLPNEVLWRKKIPFGMGLESNNNDLLEVKLNNYYDSMISDEELEQGVLKYKFLPPKTKQEYQYRKYFEEYFPKQYSLCPQTW 369
            L + FLDH+F +YY SL  +++ PK G+EK LLR++F+ +  +P E+LWR K  F  G+ S  N   ++ L  Y +  + D  +     K+ F  PKTK+ Y YR+ FE ++P +       W
Sbjct:  416 LRVPFLDHRFSSYYLSLPPEMRIPKNGIEKHLLRETFEDSNLIPKEILWRPKEAFSDGITSVKNSWFKI-LQEYVEHQVDDAMMANAAQKFPFNTPKTKEGYYYRQVFERHYPGRADWLSHYW 537          
BLAST of asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Human
Match: ASNS (asparagine synthetase (glutamine-hydrolyzing) [Source:HGNC Symbol;Acc:HGNC:753])

HSP 1 Score: 89.3521 bits (220), Expect = 2.442e-21
Identity = 45/123 (36.59%), Postives = 70/123 (56.91%), Query Frame = 1
Query:    1 LPISFLDHQFLAYYYSLDSKLKQPKFGVEKWLLRKSFDLNGFLPNEVLWRKKIPFGMGLESNNNDLLEVKLNNYYDSMISDEELEQGVLKYKFLPPKTKQEYQYRKYFEEYFPKQYSLCPQTW 369
            L + FLDH+F +YY SL  +++ PK G+EK LLR++F+ +  +P E+LWR K  F  G+ S  N   ++ L  Y +  + D  +     K+ F  PKTK+ Y YR+ FE ++P +       W
Sbjct:  416 LRVPFLDHRFSSYYLSLPPEMRIPKNGIEKHLLRETFEDSNLIPKEILWRPKEAFSDGITSVKNSWFKI-LQEYVEHQVDDAMMANAAQKFPFNTPKTKEGYYYRQVFERHYPGRADWLSHYW 537          
BLAST of asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Celegans
Match: asns-1 (Asparagine synthetase [Source:UniProtKB/TrEMBL;Acc:O16924])

HSP 1 Score: 60.077 bits (144), Expect = 1.542e-11
Identity = 38/110 (34.55%), Postives = 58/110 (52.73%), Query Frame = 1
Query:    7 ISFLDHQFLAYYYSLDSKLKQPKFGVEKWLLRKSFDLNGFLPNEVLWRKKIPFGMGLESNNNDLLEVKLNNYYDSMISDEELEQGVLKYKFLPPKTKQEYQYRKYFEEYF 336
            + FLD +F+     L    K     +EK +LR +F+  G+LP+EVLWR K  F   L     DL ++ L  + D +IS    E+   ++    P+T +EY YR+ FE+ F
Sbjct:  391 VPFLDKRFIDLVSRLPPSYKLMPMKLEKHVLRSAFE--GWLPDEVLWRSKEGFAEAL--GKTDLGDI-LAEHCDKLISKSLYERRAERFPDRTPETTEEYWYRQIFEDTF 495          
BLAST of asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Celegans
Match: asns-2 (Asparagine synthetase [Source:UniProtKB/TrEMBL;Acc:Q65ZI9])

HSP 1 Score: 58.5362 bits (140), Expect = 5.690e-11
Identity = 41/129 (31.78%), Postives = 66/129 (51.16%), Query Frame = 1
Query:    7 ISFLDHQFLAYYYSLDSKLKQPK-----FGVEKWLLRKSFDLNGF--LPNEVLWRKKIPFGMGLESNNNDLLEVKLNNYYDSMISDEELEQGVLKYKFLPPKTKQEYQYRKYFEEYFP-KQYSLCPQTW 369
            + FLD  F+    SLD   K+P+        EK++LR +F+ + +  LP+E+LWR+K  F  G+  +  D     L  Y  + I+D+E  Q    +    P +K+ +  RK F E FP +Q +L  + W
Sbjct:  395 VPFLDKAFVEAAVSLDPAFKRPQKLEDGRNCEKFVLRSAFNTDQYPYLPDEILWRQKEQFSDGVGYSWID----TLMKYCAAKITDKEFSQASKLFPHNTPHSKEAFYMRKIFHEQFPSEQAALTVRKW 519          
BLAST of asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Celegans
Match: asns-2 (Asparagine synthetase [Source:UniProtKB/TrEMBL;Acc:Q65ZI9])

HSP 1 Score: 58.5362 bits (140), Expect = 6.073e-11
Identity = 41/129 (31.78%), Postives = 66/129 (51.16%), Query Frame = 1
Query:    7 ISFLDHQFLAYYYSLDSKLKQPK-----FGVEKWLLRKSFDLNGF--LPNEVLWRKKIPFGMGLESNNNDLLEVKLNNYYDSMISDEELEQGVLKYKFLPPKTKQEYQYRKYFEEYFP-KQYSLCPQTW 369
            + FLD  F+    SLD   K+P+        EK++LR +F+ + +  LP+E+LWR+K  F  G+  +  D     L  Y  + I+D+E  Q    +    P +K+ +  RK F E FP +Q +L  + W
Sbjct:  395 VPFLDKAFVEAAVSLDPAFKRPQKLEDGRNCEKFVLRSAFNTDQYPYLPDEILWRQKEQFSDGVGYSWID----TLMKYCAAKITDKEFSQASKLFPHNTPHSKEAFYMRKIFHEQFPSEQAALTVRKW 519          
BLAST of asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Fly
Match: AsnS (gene:FBgn0270926 transcript:FBtr0089463)

HSP 1 Score: 62.3882 bits (150), Expect = 2.989e-12
Identity = 42/125 (33.60%), Postives = 64/125 (51.20%), Query Frame = 1
Query:    1 LPISFLDHQFLAYYYSLDSKLKQP----KFG------VEKWLLRKSFDLNGFLPNEVLWRKKIPFGMGLESNNNDLLEVKLNNYYDSMISDEELEQGVLKYKFLPPKTKQEYQYRKYFEEYFPKQ 345
            L + FLD  F+ +   +  + K P    KFG      +EK++LR +F  N +LP+EVLWR+K  F  G+  +  D     +     S +SD+E     L++ F  P TK+ + YR  F E FP +
Sbjct:  405 LRVPFLDTGFVNHVMQIRPEDKIPGPLNKFGEVQQKRLEKYVLRAAFADN-YLPDEVLWRQKEQFSDGVGYDWID----SIRRVATSHVSDQEFSAAALRFPFNTPTTKEAFYYRCIFAEQFPGE 524          
BLAST of asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Zebrafish
Match: asns (asparagine synthetase [Source:ZFIN;Acc:ZDB-GENE-040426-1091])

HSP 1 Score: 90.5077 bits (223), Expect = 6.649e-22
Identity = 49/123 (39.84%), Postives = 69/123 (56.10%), Query Frame = 1
Query:    1 LPISFLDHQFLAYYYSLDSKLKQPKFGVEKWLLRKSFDLNGFLPNEVLWRKKIPFGMGLESNNNDLLEVKLNNYYDSMISDEELEQGVLKYKFLPPKTKQEYQYRKYFEEYFPKQYSLCPQTW 369
            L + FLDH+F AYY SL  +++ PK GVEK LLR +FD    +P+E+LWR+K  F  GL S         L  + +S ++D +LE     Y   PP TK+    R+ FE+++P Q    P  W
Sbjct:  415 LRVPFLDHRFTAYYLSLPEEMRVPKNGVEKHLLRDAFDGMNLIPDEILWRRKEAFSDGLTSVKKSWY-TSLQEHIESELNDSQLENANKLYHINPPTTKEGLFIRQIFEKHYPGQGEWTPHYW 536          
BLAST of asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Xenopus
Match: asns (asparagine synthetase (glutamine-hydrolyzing) [Source:NCBI gene;Acc:448254])

HSP 1 Score: 90.1225 bits (222), Expect = 8.528e-22
Identity = 49/123 (39.84%), Postives = 71/123 (57.72%), Query Frame = 1
Query:    1 LPISFLDHQFLAYYYSLDSKLKQPKFGVEKWLLRKSFDLNGFLPNEVLWRKKIPFGMGLESNNNDLLEVKLNNYYDSMISDEELEQGVLKYKFLPPKTKQEYQYRKYFEEYFPKQYSLCPQTW 369
            L + FLDH+  AYY SL  +L+ PK G+EK+LLR+SF+ +  LP +VLWR K  F  GL S       + L  + +  + +  LE+    + F PPKTK+ Y YR+ FE+Y+P +       W
Sbjct:  277 LRVPFLDHRLTAYYLSLPPELRIPKNGIEKYLLRESFEDSNLLPKDVLWRPKEAFSDGLTSVKKSWFSM-LQEHIEQQVDNIVLEKAAENFPFNPPKTKEGYFYRQIFEKYYPGRAGWLTHYW 398          
BLAST of asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Xenopus
Match: asns (asparagine synthetase (glutamine-hydrolyzing) [Source:NCBI gene;Acc:448254])

HSP 1 Score: 89.7373 bits (221), Expect = 1.652e-21
Identity = 49/123 (39.84%), Postives = 71/123 (57.72%), Query Frame = 1
Query:    1 LPISFLDHQFLAYYYSLDSKLKQPKFGVEKWLLRKSFDLNGFLPNEVLWRKKIPFGMGLESNNNDLLEVKLNNYYDSMISDEELEQGVLKYKFLPPKTKQEYQYRKYFEEYFPKQYSLCPQTW 369
            L + FLDH+  AYY SL  +L+ PK G+EK+LLR+SF+ +  LP +VLWR K  F  GL S       + L  + +  + +  LE+    + F PPKTK+ Y YR+ FE+Y+P +       W
Sbjct:  416 LRVPFLDHRLTAYYLSLPPELRIPKNGIEKYLLRESFEDSNLLPKDVLWRPKEAFSDGLTSVKKSWFSM-LQEHIEQQVDNIVLEKAAENFPFNPPKTKEGYFYRQIFEKYYPGRAGWLTHYW 537          
BLAST of asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Xenopus
Match: asns (asparagine synthetase (glutamine-hydrolyzing) [Source:NCBI gene;Acc:448254])

HSP 1 Score: 53.5286 bits (127), Expect = 8.389e-9
Identity = 24/48 (50.00%), Postives = 34/48 (70.83%), Query Frame = 1
Query:    1 LPISFLDHQFLAYYYSLDSKLKQPKFGVEKWLLRKSFDLNGFLPNEVL 144
            L + FLDH+  AYY SL  +L+ PK G+EK+LLR+SF+ +  LP +V 
Sbjct:  416 LRVPFLDHRLTAYYLSLPPELRIPKNGIEKYLLRESFEDSNLLPKDVF 463          
BLAST of asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Mouse
Match: Asns (asparagine synthetase [Source:MGI Symbol;Acc:MGI:1350929])

HSP 1 Score: 89.7373 bits (221), Expect = 1.113e-21
Identity = 47/123 (38.21%), Postives = 70/123 (56.91%), Query Frame = 1
Query:    1 LPISFLDHQFLAYYYSLDSKLKQPKFGVEKWLLRKSFDLNGFLPNEVLWRKKIPFGMGLESNNNDLLEVKLNNYYDSMISDEELEQGVLKYKFLPPKTKQEYQYRKYFEEYFPKQYSLCPQTW 369
            L + FLDH+F +YY SL   ++ PK G+EK LLR++F+    LP E+LWR K  F  G+ S  N   ++ L +Y +  + DE +     K+ F  PKTK+ Y YR+ FE ++P +       W
Sbjct:  416 LRVPFLDHRFSSYYLSLPPDMRIPKNGIEKHLLRETFEDCNLLPKEILWRPKEAFSDGITSVKNSWFKI-LQDYVEHQVDDEMMSAASQKFPFNTPKTKEGYFYRQIFERHYPGRADWLTHYW 537          
BLAST of asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Mouse
Match: Asns (asparagine synthetase [Source:MGI Symbol;Acc:MGI:1350929])

HSP 1 Score: 89.7373 bits (221), Expect = 1.113e-21
Identity = 47/123 (38.21%), Postives = 70/123 (56.91%), Query Frame = 1
Query:    1 LPISFLDHQFLAYYYSLDSKLKQPKFGVEKWLLRKSFDLNGFLPNEVLWRKKIPFGMGLESNNNDLLEVKLNNYYDSMISDEELEQGVLKYKFLPPKTKQEYQYRKYFEEYFPKQYSLCPQTW 369
            L + FLDH+F +YY SL   ++ PK G+EK LLR++F+    LP E+LWR K  F  G+ S  N   ++ L +Y +  + DE +     K+ F  PKTK+ Y YR+ FE ++P +       W
Sbjct:  416 LRVPFLDHRFSSYYLSLPPDMRIPKNGIEKHLLRETFEDCNLLPKEILWRPKEAFSDGITSVKNSWFKI-LQDYVEHQVDDEMMSAASQKFPFNTPKTKEGYFYRQIFERHYPGRADWLTHYW 537          
BLAST of asparagine synthetase [glutamine-hydrolyzing] vs. UniProt/SwissProt
Match: sp|Q5ZJU3|ASNS_CHICK (Asparagine synthetase [glutamine-hydrolyzing] OS=Gallus gallus OX=9031 GN=ASNS PE=2 SV=3)

HSP 1 Score: 104.76 bits (260), Expect = 4.764e-26
Identity = 53/123 (43.09%), Postives = 77/123 (62.60%), Query Frame = 1
Query:    1 LPISFLDHQFLAYYYSLDSKLKQPKFGVEKWLLRKSFDLNGFLPNEVLWRKKIPFGMGLESNNNDLLEVKLNNYYDSMISDEELEQGVLKYKFLPPKTKQEYQYRKYFEEYFPKQYSLCPQTW 369
            L + FLDH+F +YY SL ++L+ PK G+EK+LLR+SF+ +  LP E+LWR K  F  G+ S       + L +Y D  + D  LE+   KY F PP+TK+ Y YR+ FE+++P + S  P  W
Sbjct:  416 LRVPFLDHRFTSYYLSLPAELRIPKNGIEKYLLRQSFEDSNLLPKEILWRPKEAFSDGIASVKKSWFSI-LQDYIDQQVDDLLLEKAAEKYPFNPPRTKESYYYRQIFEKHYPGRSSWLPHYW 537          
BLAST of asparagine synthetase [glutamine-hydrolyzing] vs. UniProt/SwissProt
Match: sp|P19891|ASNS_CRIGR (Asparagine synthetase [glutamine-hydrolyzing] OS=Cricetulus griseus OX=10029 GN=ASNS PE=2 SV=2)

HSP 1 Score: 92.4337 bits (228), Expect = 9.208e-22
Identity = 47/123 (38.21%), Postives = 72/123 (58.54%), Query Frame = 1
Query:    1 LPISFLDHQFLAYYYSLDSKLKQPKFGVEKWLLRKSFDLNGFLPNEVLWRKKIPFGMGLESNNNDLLEVKLNNYYDSMISDEELEQGVLKYKFLPPKTKQEYQYRKYFEEYFPKQYSLCPQTW 369
            L + FLDH+F +YY SL  +++ PK G+EK LLR++F+ +  LP E+LWR K  F  G+ S  N   ++ L +Y +  + DE +     K+ F  PKTK+ Y YR+ FE ++P +       W
Sbjct:  416 LRVPFLDHRFSSYYLSLPPEMRIPKNGIEKHLLRETFEDSNLLPKEILWRPKEAFSDGITSVKNSWFKI-LQDYVEHQVDDEMMATAAQKFPFNTPKTKEGYYYRQIFERHYPGRADWLTHYW 537          
BLAST of asparagine synthetase [glutamine-hydrolyzing] vs. UniProt/SwissProt
Match: sp|Q1LZA3|ASNS_BOVIN (Asparagine synthetase [glutamine-hydrolyzing] OS=Bos taurus OX=9913 GN=ASNS PE=2 SV=3)

HSP 1 Score: 91.2781 bits (225), Expect = 2.303e-21
Identity = 45/123 (36.59%), Postives = 69/123 (56.10%), Query Frame = 1
Query:    1 LPISFLDHQFLAYYYSLDSKLKQPKFGVEKWLLRKSFDLNGFLPNEVLWRKKIPFGMGLESNNNDLLEVKLNNYYDSMISDEELEQGVLKYKFLPPKTKQEYQYRKYFEEYFPKQYSLCPQTW 369
            L + FLDH+F +YY SL   ++ PK G+EK LLR++F+ +  +P E+LWR K  F  G+ S  N    + L +Y +  + D  +     K+    PKTK+ Y YR+ FE ++P +    P  W
Sbjct:  416 LRVPFLDHRFSSYYLSLPPDMRVPKNGIEKHLLRETFEDSNLIPKEILWRPKEAFSDGITSVKNSWFRI-LQDYIEHQVDDAAMASAAQKFPINTPKTKEGYYYRQIFENHYPGRADWLPHYW 537          
BLAST of asparagine synthetase [glutamine-hydrolyzing] vs. UniProt/SwissProt
Match: sp|P17714|ASNS_MESAU (Asparagine synthetase [glutamine-hydrolyzing] OS=Mesocricetus auratus OX=10036 GN=ASNS PE=1 SV=3)

HSP 1 Score: 90.5077 bits (223), Expect = 4.785e-21
Identity = 46/123 (37.40%), Postives = 71/123 (57.72%), Query Frame = 1
Query:    1 LPISFLDHQFLAYYYSLDSKLKQPKFGVEKWLLRKSFDLNGFLPNEVLWRKKIPFGMGLESNNNDLLEVKLNNYYDSMISDEELEQGVLKYKFLPPKTKQEYQYRKYFEEYFPKQYSLCPQTW 369
            L + FLDH+F +YY SL  +++ PK G+EK LLR++F+ +  LP E+LWR K  F  G+ S  N   ++ L +Y +  + D  +     K+ F  PKTK+ Y YR+ FE ++P +       W
Sbjct:  416 LRVPFLDHRFSSYYLSLPPEMRVPKNGIEKHLLRETFEDSNLLPKEILWRPKEAFSDGITSVKNSWFKI-LQDYVEHQVDDAMMATAAQKFPFNTPKTKEGYFYRQIFEHHYPGRADWLTHYW 537          
BLAST of asparagine synthetase [glutamine-hydrolyzing] vs. UniProt/SwissProt
Match: sp|Q61024|ASNS_MOUSE (Asparagine synthetase [glutamine-hydrolyzing] OS=Mus musculus OX=10090 GN=Asns PE=1 SV=3)

HSP 1 Score: 89.7373 bits (221), Expect = 7.788e-21
Identity = 47/123 (38.21%), Postives = 70/123 (56.91%), Query Frame = 1
Query:    1 LPISFLDHQFLAYYYSLDSKLKQPKFGVEKWLLRKSFDLNGFLPNEVLWRKKIPFGMGLESNNNDLLEVKLNNYYDSMISDEELEQGVLKYKFLPPKTKQEYQYRKYFEEYFPKQYSLCPQTW 369
            L + FLDH+F +YY SL   ++ PK G+EK LLR++F+    LP E+LWR K  F  G+ S  N   ++ L +Y +  + DE +     K+ F  PKTK+ Y YR+ FE ++P +       W
Sbjct:  416 LRVPFLDHRFSSYYLSLPPDMRIPKNGIEKHLLRETFEDCNLLPKEILWRPKEAFSDGITSVKNSWFKI-LQDYVEHQVDDEMMSAASQKFPFNTPKTKEGYFYRQIFERHYPGRADWLTHYW 537          
BLAST of asparagine synthetase [glutamine-hydrolyzing] vs. TrEMBL
Match: A0A210PVE5 (Asparagine synthetase [glutamine-hydrolyzing] OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT19003 PE=4 SV=1)

HSP 1 Score: 110.923 bits (276), Expect = 7.301e-26
Identity = 51/121 (42.15%), Postives = 75/121 (61.98%), Query Frame = 1
Query:    7 ISFLDHQFLAYYYSLDSKLKQPKFGVEKWLLRKSFDLNGFLPNEVLWRKKIPFGMGLESNNNDLLEVKLNNYYDSMISDEELEQGVLKYKFLPPKTKQEYQYRKYFEEYFPKQYSLCPQTW 369
            + FLDHQF +YY SL+ ++K PK+G+EK+LLR +FD  G LP E+LWR K  F  G+ S      EV + ++ D  I D ELE+   ++   PP++K+   YR+ FE+++  Q  L P  W
Sbjct:  414 VPFLDHQFSSYYISLEPEMKAPKYGIEKYLLRSAFDKTGLLPAEILWRPKEDFSDGVSSQTRSWYEV-IQDFVDEQIDDTELEESSHRFPHNPPRSKEALYYRRVFEKFYTGQGHLLPYYW 533          
BLAST of asparagine synthetase [glutamine-hydrolyzing] vs. TrEMBL
Match: A0A1S3INM5 (asparagine synthetase [glutamine-hydrolyzing] OS=Lingula unguis OX=7574 GN=LOC106165722 PE=4 SV=1)

HSP 1 Score: 110.153 bits (274), Expect = 1.480e-25
Identity = 55/123 (44.72%), Postives = 77/123 (62.60%), Query Frame = 1
Query:    1 LPISFLDHQFLAYYYSLDSKLKQPKFGVEKWLLRKSFDLNGFLPNEVLWRKKIPFGMGLESNNNDLLEVKLNNYYDSMISDEELEQGVLKYKFLPPKTKQEYQYRKYFEEYFPKQYSLCPQTW 369
            L + FLDHQF +YY S+D KL+QPK GVEK+LLR +FD    +PN++LWR K  F  G+ S       V +  Y  S I++E++E    KY F PP+TK+ Y +R+ FE+Y+P +    P  W
Sbjct:  409 LRVPFLDHQFTSYYLSIDPKLRQPKDGVEKYLLRSAFDQENLIPNDILWRPKEAFSDGVSSEKRSWHHV-IQEYVASRINNEDMENAPKKYPFNPPRTKEAYYFRQLFEQYYPGKAPWIPYYW 530          
BLAST of asparagine synthetase [glutamine-hydrolyzing] vs. TrEMBL
Match: A0A093C8X2 (Asparagine synthetase [glutamine-hydrolyzing] (Fragment) OS=Pterocles gutturalis OX=240206 GN=N339_07753 PE=4 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 3.439e-24
Identity = 54/123 (43.90%), Postives = 77/123 (62.60%), Query Frame = 1
Query:    1 LPISFLDHQFLAYYYSLDSKLKQPKFGVEKWLLRKSFDLNGFLPNEVLWRKKIPFGMGLESNNNDLLEVKLNNYYDSMISDEELEQGVLKYKFLPPKTKQEYQYRKYFEEYFPKQYSLCPQTW 369
            L + FLDH+F +YY SL ++L+ PK G+EK+LLR+SF+ +  LP E+LWR K  F  G+ S       + L +Y D  + D  LE+   KY F PPKTK+ Y YR+ FE+++P Q +  P  W
Sbjct:  333 LRVPFLDHRFTSYYLSLPAELRIPKNGIEKYLLRQSFEDSNLLPKEILWRPKEAFSDGIASVKKSWFSI-LQDYIDQQVDDLLLEKAAEKYPFNPPKTKESYYYRQIFEKHYPGQGNWLPHHW 454          
BLAST of asparagine synthetase [glutamine-hydrolyzing] vs. TrEMBL
Match: R7TGJ1 (Glutamine amidotransferase type-2 domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_218038 PE=4 SV=1)

HSP 1 Score: 106.301 bits (264), Expect = 4.037e-24
Identity = 52/123 (42.28%), Postives = 75/123 (60.98%), Query Frame = 1
Query:    1 LPISFLDHQFLAYYYSLDSKLKQPKFGVEKWLLRKSFDLNGFLPNEVLWRKKIPFGMGLESNNNDLLEVKLNNYYDSMISDEELEQGVLKYKFLPPKTKQEYQYRKYFEEYFPKQYSLCPQTW 369
            L + FLDH+F +Y  SL ++ ++P+ GVEK LLRKSFD    LP+++LWR+K  F  G+ S      E+ L  + +S +SDE+     L Y F PP +K+ Y YR+ FE +FP Q +  P  W
Sbjct:  410 LRVPFLDHRFTSYVLSLPAEERRPQKGVEKHLLRKSFDGMDLLPHDILWRRKEAFSDGVSSQKKAWFEI-LQEHVESQVSDEDFAAAPLAYPFNPPTSKEAYYYRQIFERHFPGQSAWIPYYW 531          
BLAST of asparagine synthetase [glutamine-hydrolyzing] vs. TrEMBL
Match: A0A091T1K5 (Asparagine synthetase [glutamine-hydrolyzing] OS=Nestor notabilis OX=176057 GN=N333_06713 PE=4 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 4.967e-24
Identity = 54/123 (43.90%), Postives = 76/123 (61.79%), Query Frame = 1
Query:    1 LPISFLDHQFLAYYYSLDSKLKQPKFGVEKWLLRKSFDLNGFLPNEVLWRKKIPFGMGLESNNNDLLEVKLNNYYDSMISDEELEQGVLKYKFLPPKTKQEYQYRKYFEEYFPKQYSLCPQTW 369
            L + FLDH+F  YY SL ++L+ PK G+EK+LLR++F+ +  LP E+LWR K  F  G+ S       + L +Y D  + D  LE+   KY F PPKTK+ Y YR+ FE+++P Q S  P  W
Sbjct:  416 LRVPFLDHRFTTYYLSLPAELRVPKNGIEKYLLRQAFEDSNLLPKEILWRPKEAFSDGIASVKKSWFSI-LQDYIDQQVDDLLLEKAAEKYPFNPPKTKESYYYRQIFEKHYPGQSSWLPHYW 537          
BLAST of asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Cavefish
Match: ENSAMXT00000038947.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02002184.1:138637:145656:-1 gene:ENSAMXG00000035392.1 transcript:ENSAMXT00000038947.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 82.4185 bits (202), Expect = 1.698e-19
Identity = 43/113 (38.05%), Postives = 68/113 (60.18%), Query Frame = 1
Query:    1 LPISFLDHQFLAYYYSLDSKLKQPKFGVEKWLLRKSFDLNGFLPNEVLWRKKIPFGMGLESNNNDLLEVKLNNYYDSMISDEELEQGVLKYKFLPPKTKQEYQYRKYFEEYFP 339
            L + FLDH+F AYY SL  +++ PK GVEK LLR++F     +P+E+LWR+K  F  G+ S         L    +S I+D +L++   ++ + PP TK+    R+ FE+++P
Sbjct:  192 LRVPFLDHRFTAYYLSLPEEMRAPKDGVEKHLLREAFSGLDLIPDEILWRRKEAFSDGMTSTKKSWYSY-LQENIESKINDSQLQKAKKQFPYNPPTTKEGLFIRQLFEKHYP 303          
BLAST of asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Cavefish
Match: asns (asparagine synthetase [glutamine-hydrolyzing]-like [Source:NCBI gene;Acc:111195517])

HSP 1 Score: 82.8037 bits (203), Expect = 2.882e-19
Identity = 45/123 (36.59%), Postives = 69/123 (56.10%), Query Frame = 1
Query:    1 LPISFLDHQFLAYYYSLDSKLKQPKFGVEKWLLRKSFDLNGFLPNEVLWRKKIPFGMGLESNNNDLLEVKLNNYYDSMISDEELEQGVLKYKFLPPKTKQEYQYRKYFEEYFPKQYSLCPQTW 369
            L + FLDH+F AYY SL  +++ PK GVEK LLR++F     +P+E+LWR+K  F  G+ S         L    +S I+D +L++    + + PP TK+    R+ FE+++P  Y      W
Sbjct:  416 LRVPFLDHRFTAYYLSLPEEMRAPKDGVEKHLLREAFSGLDLIPDEILWRRKEAFSDGMTSTKKSWYSF-LQENIESKINDSQLQKAKKLFPYNPPTTKEGLFMRQLFEKHYPGCYEWITHYW 537          
BLAST of asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Cavefish
Match: asns (asparagine synthetase [glutamine-hydrolyzing]-like [Source:NCBI gene;Acc:111195517])

HSP 1 Score: 82.8037 bits (203), Expect = 2.882e-19
Identity = 45/123 (36.59%), Postives = 69/123 (56.10%), Query Frame = 1
Query:    1 LPISFLDHQFLAYYYSLDSKLKQPKFGVEKWLLRKSFDLNGFLPNEVLWRKKIPFGMGLESNNNDLLEVKLNNYYDSMISDEELEQGVLKYKFLPPKTKQEYQYRKYFEEYFPKQYSLCPQTW 369
            L + FLDH+F AYY SL  +++ PK GVEK LLR++F     +P+E+LWR+K  F  G+ S         L    +S I+D +L++    + + PP TK+    R+ FE+++P  Y      W
Sbjct:  416 LRVPFLDHRFTAYYLSLPEEMRAPKDGVEKHLLREAFSGLDLIPDEILWRRKEAFSDGMTSTKKSWYSF-LQENIESKINDSQLQKAKKLFPYNPPTTKEGLFMRQLFEKHYPGCYEWITHYW 537          
BLAST of asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Cavefish
Match: asns (asparagine synthetase [glutamine-hydrolyzing]-like [Source:NCBI gene;Acc:111195517])

HSP 1 Score: 82.8037 bits (203), Expect = 2.882e-19
Identity = 45/123 (36.59%), Postives = 69/123 (56.10%), Query Frame = 1
Query:    1 LPISFLDHQFLAYYYSLDSKLKQPKFGVEKWLLRKSFDLNGFLPNEVLWRKKIPFGMGLESNNNDLLEVKLNNYYDSMISDEELEQGVLKYKFLPPKTKQEYQYRKYFEEYFPKQYSLCPQTW 369
            L + FLDH+F AYY SL  +++ PK GVEK LLR++F     +P+E+LWR+K  F  G+ S         L    +S I+D +L++    + + PP TK+    R+ FE+++P  Y      W
Sbjct:  416 LRVPFLDHRFTAYYLSLPEEMRAPKDGVEKHLLREAFSGLDLIPDEILWRRKEAFSDGMTSTKKSWYSF-LQENIESKINDSQLQKAKKLFPYNPPTTKEGLFMRQLFEKHYPGCYEWITHYW 537          
BLAST of asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Cavefish
Match: asns (asparagine synthetase [glutamine-hydrolyzing]-like [Source:NCBI gene;Acc:111195517])

HSP 1 Score: 82.8037 bits (203), Expect = 2.882e-19
Identity = 45/123 (36.59%), Postives = 69/123 (56.10%), Query Frame = 1
Query:    1 LPISFLDHQFLAYYYSLDSKLKQPKFGVEKWLLRKSFDLNGFLPNEVLWRKKIPFGMGLESNNNDLLEVKLNNYYDSMISDEELEQGVLKYKFLPPKTKQEYQYRKYFEEYFPKQYSLCPQTW 369
            L + FLDH+F AYY SL  +++ PK GVEK LLR++F     +P+E+LWR+K  F  G+ S         L    +S I+D +L++    + + PP TK+    R+ FE+++P  Y      W
Sbjct:  416 LRVPFLDHRFTAYYLSLPEEMRAPKDGVEKHLLREAFSGLDLIPDEILWRRKEAFSDGMTSTKKSWYSF-LQENIESKINDSQLQKAKKLFPYNPPTTKEGLFMRQLFEKHYPGCYEWITHYW 537          
BLAST of asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Yeast
Match: ASN1 (Asparagine synthetase; catalyzes the synthesis of L-asparagine from L-aspartate in the asparagine biosynthetic pathway; ASN1 has a paralog, ASN2, that arose from the whole genome duplication [Source:SGD;Acc:S000006349])

HSP 1 Score: 63.5438 bits (153), Expect = 1.862e-13
Identity = 41/122 (33.61%), Postives = 67/122 (54.92%), Query Frame = 1
Query:    7 ISFLDHQFLAYYYSLD--SKLKQPKFG-VEKWLLRKSFDLNG------FLPNEVLWRKKIPFGMGLESNNNDLLEVKLNNYYDSMISDEELEQGVLKYKFLPPKTKQEYQYRKYFEEYFPKQ 345
            + FLD +FL    ++D   K+ +PK G +EK++LRK+FD  G      +LP E+LWR+K  F  G+  +  D     L +  +++ISDE       ++    P TK+ + YR  F+  FP++
Sbjct:  421 VPFLDREFLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTTGEPDAKPYLPEEILWRQKEQFSDGVGYSWID----GLKDTAEAVISDEMFASPKAEWGSDIPTTKEAFWYRLKFDALFPQK 538          
BLAST of asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Yeast
Match: ASN2 (Asparagine synthetase; catalyzes the synthesis of L-asparagine from L-aspartate in the asparagine biosynthetic pathway; ASN2 has a paralog, ASN1, that arose from the whole genome duplication [Source:SGD;Acc:S000003356])

HSP 1 Score: 57.3806 bits (137), Expect = 2.304e-11
Identity = 40/122 (32.79%), Postives = 63/122 (51.64%), Query Frame = 1
Query:    7 ISFLDHQFLAYYYSLD--SKLKQPKFG-VEKWLLRKSFD------LNGFLPNEVLWRKKIPFGMGLESNNNDLLEVKLNNYYDSMISDEELEQGVLKYKFLPPKTKQEYQYRKYFEEYFPKQ 345
            + FLD  FL    ++D   K+ +PK G +EK++LRK+FD      +  +LP E+LWR+K  F  G+  +  D     L +  +  ISD         +    P TK+ Y YR  F+ +FP++
Sbjct:  420 VPFLDKDFLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQKEQFSDGVGYSWID----GLRDTAERAISDAMFANPKADWGDDIPTTKEAYWYRLKFDAWFPQK 537          
BLAST of asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Nematostella
Match: EDO43756 (Asparagine synthetase [Source:UniProtKB/TrEMBL;Acc:A7RXD3])

HSP 1 Score: 103.219 bits (256), Expect = 5.154e-27
Identity = 53/123 (43.09%), Postives = 70/123 (56.91%), Query Frame = 1
Query:    7 ISFLDHQFLAYYYSLDSKLKQPKFGVEKWLLRKSFDLNGFLPNEVLWRKKIPFGMGLESN--NNDLLEVKLNNYYDSMISDEELEQGVLKYKFLPPKTKQEYQYRKYFEEYFPKQYSLCPQTW 369
            + FLD  F +Y+ SL    +QPK GVEKWLLR +FD  G LP+E+LWR K  F  G+ SN       E+ L  Y +  ++DE L +    Y F  P+TK+ + YR  FEE FP  + L P  W
Sbjct:  415 VPFLDVAFTSYFLSLPPAERQPKEGVEKWLLRAAFDGTGLLPHEILWRPKEAFSDGVTSNAPGKSWFEI-LQCYVEDHVADEALAKASKLYPFNTPRTKESFYYRSVFEELFPGHHELIPYMW 536          
BLAST of asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Medaka
Match: asns (asparagine synthetase (glutamine-hydrolyzing) [Source:NCBI gene;Acc:101158956])

HSP 1 Score: 85.5001 bits (210), Expect = 3.033e-20
Identity = 44/123 (35.77%), Postives = 69/123 (56.10%), Query Frame = 1
Query:    1 LPISFLDHQFLAYYYSLDSKLKQPKFGVEKWLLRKSFDLNGFLPNEVLWRKKIPFGMGLESNNNDLLEVKLNNYYDSMISDEELEQGVLKYKFLPPKTKQEYQYRKYFEEYFPKQYSLCPQTW 369
            L + FLDH+F AYY SL   ++ PK GVEK LLR SF     +P E+LWR+K  F  G+ S         L  + +++++D+++E+    +   PP TK+ Y +R+ FE+ +P +       W
Sbjct:  416 LRVPFLDHRFTAYYLSLPENMRVPKDGVEKHLLRDSFKGLNLIPEEILWRRKEAFSDGMMSMKKSWYTC-LQEHLEAIVNDDQMEKASKTFPHNPPTTKEAYYFRQVFEKLYPGRAQWLSHYW 537          
BLAST of asparagine synthetase [glutamine-hydrolyzing] vs. Planmine SMEST
Match: SMESG000051174.1 (SMESG000051174.1)

HSP 1 Score: 249.98 bits (637), Expect = 5.496e-82
Identity = 119/121 (98.35%), Postives = 120/121 (99.17%), Query Frame = 1
Query:    7 ISFLDHQFLAYYYSLDSKLKQPKFGVEKWLLRKSFDLNGFLPNEVLWRKKIPFGMGLESNNNDLLEVKLNNYYDSMISDEELEQGVLKYKFLPPKTKQEYQYRKYFEEYFPKQYSLCPQTW 369
            + FLDHQFLAYYYSLDSKLKQPKFGVEKWLLRKSFDLNGFLPNEVLWRKKIPFGMGLESNNNDLLEVKLNNYYDSMISDEELEQGVLKYKFLPPKTKQEYQYRKYFEEYFPKQYSLCPQTW
Sbjct:  413 VPFLDHQFLAYYYSLDSKLKQPKFGVEKWLLRKSFDLNGFLPNEVLWRKKIPFGMGLESNNNDLLEVKLNNYYDSMISDEELEQGVLKYKFLPPKTKQEYQYRKYFEEYFPKQYSLCPQTW 533          
BLAST of asparagine synthetase [glutamine-hydrolyzing] vs. Planmine SMEST
Match: SMESG000068121.1 (SMESG000068121.1)

HSP 1 Score: 104.76 bits (260), Expect = 3.108e-27
Identity = 55/121 (45.45%), Postives = 73/121 (60.33%), Query Frame = 1
Query:    7 ISFLDHQFLAYYYSLDSKLKQPKFGVEKWLLRKSFDLNGFLPNEVLWRKKIPFGMGLESNNNDLLEVKLNNYYDSMISDEELEQGVLKYKFLPPKTKQEYQYRKYFEEYFPKQYSLCPQTW 369
            + FLD +F +YY SLD KL+QPK G+EKWLLRKSF     +P E+LWR K  F  G+         + L +Y++  ISDEE  +    Y  L P TK+ + YR+ FE+YFP Q +L P  W
Sbjct:  416 VPFLDAKFSSYYLSLDPKLRQPKDGIEKWLLRKSFSGLNLIPEEILWRPKEAFSDGVSQATKKPFYLLLQDYFNEKISDEEYSKSSELYPKLTPSTKEAFYYRQTFEKYFPNQVNLTPYYW 536          
The following BLAST results are available for this feature:
BLAST of asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ASNS2.067e-2136.59asparagine synthetase (glutamine-hydrolyzing) [Sou... [more]
ASNS2.067e-2136.59asparagine synthetase (glutamine-hydrolyzing) [Sou... [more]
ASNS2.442e-2136.59asparagine synthetase (glutamine-hydrolyzing) [Sou... [more]
ASNS2.442e-2136.59asparagine synthetase (glutamine-hydrolyzing) [Sou... [more]
ASNS2.442e-2136.59asparagine synthetase (glutamine-hydrolyzing) [Sou... [more]
back to top
BLAST of asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
asns-11.542e-1134.55Asparagine synthetase [Source:UniProtKB/TrEMBL;Ac... [more]
asns-25.690e-1131.78Asparagine synthetase [Source:UniProtKB/TrEMBL;Ac... [more]
asns-26.073e-1131.78Asparagine synthetase [Source:UniProtKB/TrEMBL;Ac... [more]
back to top
BLAST of asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
AsnS2.989e-1233.60gene:FBgn0270926 transcript:FBtr0089463[more]
back to top
BLAST of asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
asns6.649e-2239.84asparagine synthetase [Source:ZFIN;Acc:ZDB-GENE-04... [more]
back to top
BLAST of asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
asns8.528e-2239.84asparagine synthetase (glutamine-hydrolyzing) [Sou... [more]
asns1.652e-2139.84asparagine synthetase (glutamine-hydrolyzing) [Sou... [more]
asns8.389e-950.00asparagine synthetase (glutamine-hydrolyzing) [Sou... [more]
back to top
BLAST of asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Asns1.113e-2138.21asparagine synthetase [Source:MGI Symbol;Acc:MGI:1... [more]
Asns1.113e-2138.21asparagine synthetase [Source:MGI Symbol;Acc:MGI:1... [more]
back to top
BLAST of asparagine synthetase [glutamine-hydrolyzing] vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5ZJU3|ASNS_CHICK4.764e-2643.09Asparagine synthetase [glutamine-hydrolyzing] OS=G... [more]
sp|P19891|ASNS_CRIGR9.208e-2238.21Asparagine synthetase [glutamine-hydrolyzing] OS=C... [more]
sp|Q1LZA3|ASNS_BOVIN2.303e-2136.59Asparagine synthetase [glutamine-hydrolyzing] OS=B... [more]
sp|P17714|ASNS_MESAU4.785e-2137.40Asparagine synthetase [glutamine-hydrolyzing] OS=M... [more]
sp|Q61024|ASNS_MOUSE7.788e-2138.21Asparagine synthetase [glutamine-hydrolyzing] OS=M... [more]
back to top
BLAST of asparagine synthetase [glutamine-hydrolyzing] vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A210PVE57.301e-2642.15Asparagine synthetase [glutamine-hydrolyzing] OS=M... [more]
A0A1S3INM51.480e-2544.72asparagine synthetase [glutamine-hydrolyzing] OS=L... [more]
A0A093C8X23.439e-2443.90Asparagine synthetase [glutamine-hydrolyzing] (Fra... [more]
R7TGJ14.037e-2442.28Glutamine amidotransferase type-2 domain-containin... [more]
A0A091T1K54.967e-2443.90Asparagine synthetase [glutamine-hydrolyzing] OS=N... [more]
back to top
BLAST of asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000038947.11.698e-1938.05pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
asns2.882e-1936.59asparagine synthetase [glutamine-hydrolyzing]-like... [more]
asns2.882e-1936.59asparagine synthetase [glutamine-hydrolyzing]-like... [more]
asns2.882e-1936.59asparagine synthetase [glutamine-hydrolyzing]-like... [more]
asns2.882e-1936.59asparagine synthetase [glutamine-hydrolyzing]-like... [more]
back to top
BLAST of asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
ASN11.862e-1333.61Asparagine synthetase; catalyzes the synthesis of ... [more]
ASN22.304e-1132.79Asparagine synthetase; catalyzes the synthesis of ... [more]
back to top
BLAST of asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO437565.154e-2743.09Asparagine synthetase [Source:UniProtKB/TrEMBL;Ac... [more]
back to top
BLAST of asparagine synthetase [glutamine-hydrolyzing] vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
asns3.033e-2035.77asparagine synthetase (glutamine-hydrolyzing) [Sou... [more]
back to top
BLAST of asparagine synthetase [glutamine-hydrolyzing] vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000051174.15.496e-8298.35SMESG000051174.1[more]
SMESG000068121.13.108e-2745.45SMESG000068121.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028038 ID=SMED30028038|Name=asparagine synthetase [glutamine-hydrolyzing]|organism=Schmidtea mediterranea sexual|type=transcript|length=369bp
CTTCCGATCTCGTTCCTTGACCATCAATTTTTAGCTTATTATTATTCTCT
CGATTCGAAATTGAAACAACCAAAATTTGGAGTGGAAAAATGGTTGCTTC
GAAAATCATTTGATCTTAATGGGTTTCTTCCAAATGAAGTGTTGTGGCGC
AAAAAGATTCCATTTGGAATGGGTTTAGAGTCAAACAACAATGACTTGTT
AGAAGTTAAATTAAATAATTATTATGATTCTATGATCTCTGATGAGGAAT
TAGAACAAGGCGTATTGAAATACAAATTTCTTCCGCCCAAAACAAAACAA
GAATATCAATATAGAAAATATTTCGAAGAATATTTTCCCAAACAATATTC
ATTGTGCCCACAAACATGG
back to top

protein sequence of SMED30028038-orf-1

>SMED30028038-orf-1 ID=SMED30028038-orf-1|Name=SMED30028038-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=123bp
LPISFLDHQFLAYYYSLDSKLKQPKFGVEKWLLRKSFDLNGFLPNEVLWR
KKIPFGMGLESNNNDLLEVKLNNYYDSMISDEELEQGVLKYKFLPPKTKQ
EYQYRKYFEEYFPKQYSLCPQTW
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR001962Asn_synthase
IPR014729Rossmann-like_a/b/a_fold
Vocabulary: molecular function
TermDefinition
GO:0004066asparagine synthase (glutamine-hydrolyzing) activity
GO:0000166nucleotide binding
GO:0005524ATP binding
GO:0016874ligase activity
GO:0042803protein homodimerization activity
Vocabulary: biological process
TermDefinition
GO:0006529asparagine biosynthetic process
GO:0006541glutamine metabolic process
GO:0008652cellular amino acid biosynthetic process
GO:0070981L-asparagine biosynthetic process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001962Asparagine synthasePFAMPF00733Asn_synthasecoord: 1..113
e-value: 2.8E-14
score: 53.6
IPR014729Rossmann-like alpha/beta/alpha sandwich foldGENE3DG3DSA:3.40.50.620coord: 1..114
e-value: 9.0E-19
score: 70.1
NoneNo IPR availablePANTHERPTHR11772:SF23ASPARAGINE SYNTHETASE [GLUTAMINE-HYDROLYZING]coord: 1..119
NoneNo IPR availablePANTHERPTHR11772ASPARAGINE SYNTHETASEcoord: 1..119
NoneNo IPR availableSUPERFAMILYSSF52402Adenine nucleotide alpha hydrolases-likecoord: 1..81