Deoxynucleoside triphosphate triphosphohydrolase SAMHD1

Overview
NameDeoxynucleoside triphosphate triphosphohydrolase SAMHD1
Smed IDSMED30028036
Length (bp)1678
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 (SMED30028036) t-SNE clustered cells

Violin plots show distribution of expression levels for Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 (SMED30028036) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 (SMED30028036) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 (SMED30028036) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028036

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermal cellSMED30028036SMESG000079633.1 SMESG000079627.1 dd_Smed_v4_6142_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30028036SMESG000079633.1 SMESG000079627.1 dd_Smed_v4_6142_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30028036SMESG000079633.1 SMESG000079627.1 dd_Smed_v4_6142_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 vs. Ensembl Human
Match: SAMHD1 (SAM and HD domain containing deoxynucleoside triphosphate triphosphohydrolase 1 [Source:HGNC Symbol;Acc:HGNC:15925])

HSP 1 Score: 187.578 bits (475), Expect = 1.538e-51
Identity = 142/457 (31.07%), Postives = 228/457 (49.89%), Query Frame = 1
Query:  109 MVNDIVYGTITLPEYVKEIIDTQEFQRLRYISQTGLTWYVNPSATCSRFEHSLGTFYLASKLIKQLKDQLESEDKLIITSEEVKCVELAALCHDLGHGPHSHFWEHAFDPSLKIKTR-KHEDVSVEIFRELVDQXXXXXXXXXXXXXGLTEEMIDQICRMITGEFE----------REKDGEKKFLFQIVANKDSGLDVDKLDYLCRDSFYLGWSNNKIHDFKRLIYFFRVVKDESTNDWHLAMRDRELFKVNEVFSFRHILHRYGCKHRVVKSIECMFRNGIKQVIENTVARDEFLETVLEQKVPYN-SEIWFSKQFISKVNDYHLWHVLK------KYAKEMFKNIQERNLYKLLHQS----QIQITSGNNFDSLDNDISDLQT-FLQRTSGHSNXXXXXXXXXXQTENKGDPLMLMKFYSKENPNKSFNYDKDSLPNSLSLKEDEIILMVFVER 1410
            ++ND ++G I L   +  IIDT +FQRLRYI Q G  +YV P A+ +RFEHSLG  YLA  L+  L    E + +L I+  +V CV++A LCHDLGHGP SH ++  F P  + + +  HE  SV +F  L++            +  + EE I  I   I G  E          + +   K FL++IV+NK +G+DVDK DY  RD  +LG  NN   D+KR I F RV   E  N+  +  RD+E+  + ++F  R+ LHR   +H+V   I+ M  +         +  D+++E        Y  S      +  +K+ D     +L       K A+E+ K I+ RNL+K + ++    QI+I    +++SL  +++  +   L      +  ++   I       + +P+  + FY K  PN++    K+ +   L  K  E ++ V+ ++
Sbjct:  117 VINDPIHGHIELHPLLVRIIDTPQFQRLRYIKQLGGGYYVFPGASHNRFEHSLGVGYLAGCLVHALG---EKQPELQISERDVLCVQIAGLCHDLGHGPFSHMFDGRFIPLARPEVKWTHEQGSVMMFEHLINSNGIKPVMEQYGL--IPEEDICFIKEQIVGPLESPVEDSLWPYKGRPENKSFLYEIVSNKRNGIDVDKWDYFARDCHHLGIQNN--FDYKRFIKFARVC--EVDNELRICARDKEVGNLYDMFHTRNSLHRRAYQHKVGNIIDTMITDAF-------LKADDYIEITGAGGKKYRISTAIDDMEAYTKLTDNIFLEILYSTDPKLKDAREILKQIEYRNLFKYVGETQPTGQIKIKR-EDYESLPKEVASAKPKVLLDVKLKAEDFIVDVINMDYGMQEKNPIDHVSFYCKTAPNRAIRITKNQVSQLLPEKFAEQLIRVYCKK 556          
BLAST of Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 vs. Ensembl Human
Match: SAMHD1 (SAM and HD domain containing deoxynucleoside triphosphate triphosphohydrolase 1 [Source:HGNC Symbol;Acc:HGNC:15925])

HSP 1 Score: 187.193 bits (474), Expect = 3.045e-51
Identity = 142/457 (31.07%), Postives = 228/457 (49.89%), Query Frame = 1
Query:  109 MVNDIVYGTITLPEYVKEIIDTQEFQRLRYISQTGLTWYVNPSATCSRFEHSLGTFYLASKLIKQLKDQLESEDKLIITSEEVKCVELAALCHDLGHGPHSHFWEHAFDPSLKIKTR-KHEDVSVEIFRELVDQXXXXXXXXXXXXXGLTEEMIDQICRMITGEFE----------REKDGEKKFLFQIVANKDSGLDVDKLDYLCRDSFYLGWSNNKIHDFKRLIYFFRVVKDESTNDWHLAMRDRELFKVNEVFSFRHILHRYGCKHRVVKSIECMFRNGIKQVIENTVARDEFLETVLEQKVPYN-SEIWFSKQFISKVNDYHLWHVLK------KYAKEMFKNIQERNLYKLLHQS----QIQITSGNNFDSLDNDISDLQT-FLQRTSGHSNXXXXXXXXXXQTENKGDPLMLMKFYSKENPNKSFNYDKDSLPNSLSLKEDEIILMVFVER 1410
            ++ND ++G I L   +  IIDT +FQRLRYI Q G  +YV P A+ +RFEHSLG  YLA  L+  L    E + +L I+  +V CV++A LCHDLGHGP SH ++  F P  + + +  HE  SV +F  L++            +  + EE I  I   I G  E          + +   K FL++IV+NK +G+DVDK DY  RD  +LG  NN   D+KR I F RV   E  N+  +  RD+E+  + ++F  R+ LHR   +H+V   I+ M  +         +  D+++E        Y  S      +  +K+ D     +L       K A+E+ K I+ RNL+K + ++    QI+I    +++SL  +++  +   L      +  ++   I       + +P+  + FY K  PN++    K+ +   L  K  E ++ V+ ++
Sbjct:  117 VINDPIHGHIELHPLLVRIIDTPQFQRLRYIKQLGGGYYVFPGASHNRFEHSLGVGYLAGCLVHALG---EKQPELQISERDVLCVQIAGLCHDLGHGPFSHMFDGRFIPLARPEVKWTHEQGSVMMFEHLINSNGIKPVMEQYGL--IPEEDICFIKEQIVGPLESPVEDSLWPYKGRPENKSFLYEIVSNKRNGIDVDKWDYFARDCHHLGIQNN--FDYKRFIKFARVC--EVDNELRICARDKEVGNLYDMFHTRNSLHRRAYQHKVGNIIDTMITDAF-------LKADDYIEITGAGGKKYRISTAIDDMEAYTKLTDNIFLEILYSTDPKLKDAREILKQIEYRNLFKYVGETQPTGQIKIKR-EDYESLPKEVASAKPKVLLDVKLKAEDFIVDVINMDYGMQEKNPIDHVSFYCKTAPNRAIRITKNQVSQLLPEKFAEQLIRVYCKK 556          
BLAST of Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 vs. Ensembl Human
Match: SAMHD1 (SAM and HD domain containing deoxynucleoside triphosphate triphosphohydrolase 1 [Source:HGNC Symbol;Acc:HGNC:15925])

HSP 1 Score: 187.193 bits (474), Expect = 3.045e-51
Identity = 142/457 (31.07%), Postives = 228/457 (49.89%), Query Frame = 1
Query:  109 MVNDIVYGTITLPEYVKEIIDTQEFQRLRYISQTGLTWYVNPSATCSRFEHSLGTFYLASKLIKQLKDQLESEDKLIITSEEVKCVELAALCHDLGHGPHSHFWEHAFDPSLKIKTR-KHEDVSVEIFRELVDQXXXXXXXXXXXXXGLTEEMIDQICRMITGEFE----------REKDGEKKFLFQIVANKDSGLDVDKLDYLCRDSFYLGWSNNKIHDFKRLIYFFRVVKDESTNDWHLAMRDRELFKVNEVFSFRHILHRYGCKHRVVKSIECMFRNGIKQVIENTVARDEFLETVLEQKVPYN-SEIWFSKQFISKVNDYHLWHVLK------KYAKEMFKNIQERNLYKLLHQS----QIQITSGNNFDSLDNDISDLQT-FLQRTSGHSNXXXXXXXXXXQTENKGDPLMLMKFYSKENPNKSFNYDKDSLPNSLSLKEDEIILMVFVER 1410
            ++ND ++G I L   +  IIDT +FQRLRYI Q G  +YV P A+ +RFEHSLG  YLA  L+  L    E + +L I+  +V CV++A LCHDLGHGP SH ++  F P  + + +  HE  SV +F  L++            +  + EE I  I   I G  E          + +   K FL++IV+NK +G+DVDK DY  RD  +LG  NN   D+KR I F RV   E  N+  +  RD+E+  + ++F  R+ LHR   +H+V   I+ M  +         +  D+++E        Y  S      +  +K+ D     +L       K A+E+ K I+ RNL+K + ++    QI+I    +++SL  +++  +   L      +  ++   I       + +P+  + FY K  PN++    K+ +   L  K  E ++ V+ ++
Sbjct:  117 VINDPIHGHIELHPLLVRIIDTPQFQRLRYIKQLGGGYYVFPGASHNRFEHSLGVGYLAGCLVHALG---EKQPELQISERDVLCVQIAGLCHDLGHGPFSHMFDGRFIPLARPEVKWTHEQGSVMMFEHLINSNGIKPVMEQYGL--IPEEDICFIKEQIVGPLESPVEDSLWPYKGRPENKSFLYEIVSNKRNGIDVDKWDYFARDCHHLGIQNN--FDYKRFIKFARVC--EVDNELRICARDKEVGNLYDMFHTRNSLHRRAYQHKVGNIIDTMITDAF-------LKADDYIEITGAGGKKYRISTAIDDMEAYTKLTDNIFLEILYSTDPKLKDAREILKQIEYRNLFKYVGETQPTGQIKIKR-EDYESLPKEVASAKPKVLLDVKLKAEDFIVDVINMDYGMQEKNPIDHVSFYCKTAPNRAIRITKNQVSQLLPEKFAEQLIRVYCKK 556          
BLAST of Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 vs. Ensembl Human
Match: SAMHD1 (SAM and HD domain containing deoxynucleoside triphosphate triphosphohydrolase 1 [Source:HGNC Symbol;Acc:HGNC:15925])

HSP 1 Score: 182.956 bits (463), Expect = 7.457e-50
Identity = 125/361 (34.63%), Postives = 187/361 (51.80%), Query Frame = 1
Query:  109 MVNDIVYGTITLPEYVKEIIDTQEFQRLRYISQTGLTWYVNPSATCSRFEHSLGTFYLASKLIKQLKDQLESEDKLIITSEEVKCVELAALCHDLGHGPHSHFWEHAFDPSLKIKTR-KHEDVSVEIFRELVDQXXXXXXXXXXXXXGLTEEMIDQICRMITGEFE----------REKDGEKKFLFQIVANKDSGLDVDKLDYLCRDSFYLGWSNNKIHDFKRLIYFFRVVKDESTNDWHLAMRDRELFKVNEVFSFRHILHRYGCKHRVVKSIECMFRNGIKQVIENTVARDEFLETVLEQKVPYN-SEIWFSKQFISKVNDYHLWHVLK------KYAKEMFKNIQERNLYKLLHQSQ 1137
            ++ND ++G I L   +  IIDT +FQRLRYI Q G  +YV P A+ +RFEHSLG  YLA  L+  L    E + +L I+  +V CV++A LCHDLGHGP SH ++  F P  + + +  HE  SV +F  L++            +  + EE I  I   I G  E          + +   K FL++IV+NK +G+DVDK DY  RD  +LG  NN   D+KR I F RV   E  N+  +  RD+E+  + ++F  R+ LHR   +H+V   I+ M  +         +  D+++E        Y  S      +  +K+ D     +L       K A+E+ K I+ RNL+K + ++Q
Sbjct:  117 VINDPIHGHIELHPLLVRIIDTPQFQRLRYIKQLGGGYYVFPGASHNRFEHSLGVGYLAGCLVHALG---EKQPELQISERDVLCVQIAGLCHDLGHGPFSHMFDGRFIPLARPEVKWTHEQGSVMMFEHLINSNGIKPVMEQYGL--IPEEDICFIKEQIVGPLESPVEDSLWPYKGRPENKSFLYEIVSNKRNGIDVDKWDYFARDCHHLGIQNN--FDYKRFIKFARVC--EVDNELRICARDKEVGNLYDMFHTRNSLHRRAYQHKVGNIIDTMITDAF-------LKADDYIEITGAGGKKYRISTAIDDMEAYTKLTDNIFLEILYSTDPKLKDAREILKQIEYRNLFKYVGETQ 461          
BLAST of Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 vs. Ensembl Human
Match: SAMHD1 (SAM and HD domain containing deoxynucleoside triphosphate triphosphohydrolase 1 [Source:HGNC Symbol;Acc:HGNC:15925])

HSP 1 Score: 175.637 bits (444), Expect = 1.175e-48
Identity = 108/279 (38.71%), Postives = 154/279 (55.20%), Query Frame = 1
Query:  109 MVNDIVYGTITLPEYVKEIIDTQEFQRLRYISQTGLTWYVNPSATCSRFEHSLGTFYLASKLIKQLKDQLESEDKLIITSEEVKCVELAALCHDLGHGPHSHFWEHAFDPSLKIKTR-KHEDVSVEIFRELVDQXXXXXXXXXXXXXGLTEEMIDQICRMITGEFE----------REKDGEKKFLFQIVANKDSGLDVDKLDYLCRDSFYLGWSNNKIHDFKRLIYFFRVVKDESTNDWHLAMRDRELFKVNEVFSFRHILHRYGCKHRVVKSIECMF 912
            ++ND ++G I L   +  IIDT +FQRLRYI Q G  +YV P A+ +RFEHSLG  YLA  L+  L    E + +L I+  +V CV++A LCHDLGHGP SH ++  F P  + + +  HE  SV +F  L++            +  + EE I  I   I G  E          + +   K FL++IV+NK +G+DVDK DY  RD  +LG  NN   D+KR I F RV   E  N+  +  RD+E+  + ++F  R+ LHR   +H+V   I+ M 
Sbjct:   93 VINDPIHGHIELHPLLVRIIDTPQFQRLRYIKQLGGGYYVFPGASHNRFEHSLGVGYLAGCLVHALG---EKQPELQISERDVLCVQIAGLCHDLGHGPFSHMFDGRFIPLARPEVKWTHEQGSVMMFEHLINSNGIKPVMEQYGL--IPEEDICFIKEQIVGPLESPVEDSLWPYKGRPENKSFLYEIVSNKRNGIDVDKWDYFARDCHHLGIQNN--FDYKRFIKFARVC--EVDNELRICARDKEVGNLYDMFHTRNSLHRRAYQHKVGNIIDTMI 362          
BLAST of Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 vs. Ensembl Celegans
Match: ZK177.8 (pep chromosome:WBcel235:II:5509032:5513775:-1 gene:WBGene00022673.1 transcript:ZK177.8b.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:ZK177.8)

HSP 1 Score: 140.584 bits (353), Expect = 1.341e-35
Identity = 101/304 (33.22%), Postives = 161/304 (52.96%), Query Frame = 1
Query:  109 MVNDIVYGTITLPEYVKEIIDTQEFQRLRYISQTGLTWYVNPSATCSRFEHSLGTFYLASKLIKQLKDQLESEDKLIITSEEVKCVELAALCHDLGHGPHSHFWEHAFDPSLKIKTR-KHEDVSVEIFRELVDQXXXXXXXXXXXXXGLTEE----MIDQICRMITGE-FE-REKDG------------------------EKKFLFQIVANKDSGLDVDKLDYLCRDSFYLGWSNN-KIHDFKRLIYFFRVVKDESTNDWHLAMRDRELFKVNEVFSFRHILHRYGCKHRVVKSIECMFRNGI 924
            ++ND VYGT+ +P  + ++IDT EFQRLR++ QTGL + V P+   SRF HSLGTF LA  L+ +L+    S+  L IT  ++ C  +AAL HD+GHGP SH ++  F  + +  +R KHED+S+ I ++++++           I+G T+E     +  I  +I+G+ F+ ++ DG                        EK FLF +V+N  +G DVDK+DYL RDS   G          +RL    RVV D ++    +A   + +  +  +   R  LH    +H+ V+ +E +  + +
Sbjct:   11 IINDNVYGTVKVPRPIDKLIDTVEFQRLRHLKQTGLVYLVYPNCEHSRFVHSLGTFSLAYALVDKLR---HSQPSLNITESDLICTSVAALLHDVGHGPFSHLFDGEF--AKRNGSRFKHEDMSILIIKKIMNK--PEIKSEFACILGETDEEYAKSVTLITELISGKPFDFQDMDGFKDLPADVREETVKNEWAIIGCGPEKSFLFDVVSNSYNGHDVDKMDYLLRDSKASGVGITFSESTLERLFNHVRVVIDPNSGLKRIAYSIKCIGDLKAIGDSRQELHSKVYQHKAVRFMETLMVDAL 307          
BLAST of Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 vs. Ensembl Celegans
Match: ZK177.8 (pep chromosome:WBcel235:II:5509028:5511208:-1 gene:WBGene00022673.1 transcript:ZK177.8b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:ZK177.8)

HSP 1 Score: 140.584 bits (353), Expect = 1.341e-35
Identity = 101/304 (33.22%), Postives = 161/304 (52.96%), Query Frame = 1
Query:  109 MVNDIVYGTITLPEYVKEIIDTQEFQRLRYISQTGLTWYVNPSATCSRFEHSLGTFYLASKLIKQLKDQLESEDKLIITSEEVKCVELAALCHDLGHGPHSHFWEHAFDPSLKIKTR-KHEDVSVEIFRELVDQXXXXXXXXXXXXXGLTEE----MIDQICRMITGE-FE-REKDG------------------------EKKFLFQIVANKDSGLDVDKLDYLCRDSFYLGWSNN-KIHDFKRLIYFFRVVKDESTNDWHLAMRDRELFKVNEVFSFRHILHRYGCKHRVVKSIECMFRNGI 924
            ++ND VYGT+ +P  + ++IDT EFQRLR++ QTGL + V P+   SRF HSLGTF LA  L+ +L+    S+  L IT  ++ C  +AAL HD+GHGP SH ++  F  + +  +R KHED+S+ I ++++++           I+G T+E     +  I  +I+G+ F+ ++ DG                        EK FLF +V+N  +G DVDK+DYL RDS   G          +RL    RVV D ++    +A   + +  +  +   R  LH    +H+ V+ +E +  + +
Sbjct:   11 IINDNVYGTVKVPRPIDKLIDTVEFQRLRHLKQTGLVYLVYPNCEHSRFVHSLGTFSLAYALVDKLR---HSQPSLNITESDLICTSVAALLHDVGHGPFSHLFDGEF--AKRNGSRFKHEDMSILIIKKIMNK--PEIKSEFACILGETDEEYAKSVTLITELISGKPFDFQDMDGFKDLPADVREETVKNEWAIIGCGPEKSFLFDVVSNSYNGHDVDKMDYLLRDSKASGVGITFSESTLERLFNHVRVVIDPNSGLKRIAYSIKCIGDLKAIGDSRQELHSKVYQHKAVRFMETLMVDAL 307          
BLAST of Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 vs. Ensembl Celegans
Match: ZK177.8 (pep chromosome:WBcel235:II:5509032:5513748:-1 gene:WBGene00022673.1 transcript:ZK177.8a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:ZK177.8)

HSP 1 Score: 140.198 bits (352), Expect = 2.562e-35
Identity = 101/304 (33.22%), Postives = 161/304 (52.96%), Query Frame = 1
Query:  109 MVNDIVYGTITLPEYVKEIIDTQEFQRLRYISQTGLTWYVNPSATCSRFEHSLGTFYLASKLIKQLKDQLESEDKLIITSEEVKCVELAALCHDLGHGPHSHFWEHAFDPSLKIKTR-KHEDVSVEIFRELVDQXXXXXXXXXXXXXGLTEE----MIDQICRMITGE-FE-REKDG------------------------EKKFLFQIVANKDSGLDVDKLDYLCRDSFYLGWSNN-KIHDFKRLIYFFRVVKDESTNDWHLAMRDRELFKVNEVFSFRHILHRYGCKHRVVKSIECMFRNGI 924
            ++ND VYGT+ +P  + ++IDT EFQRLR++ QTGL + V P+   SRF HSLGTF LA  L+ +L+    S+  L IT  ++ C  +AAL HD+GHGP SH ++  F  + +  +R KHED+S+ I ++++++           I+G T+E     +  I  +I+G+ F+ ++ DG                        EK FLF +V+N  +G DVDK+DYL RDS   G          +RL    RVV D ++    +A   + +  +  +   R  LH    +H+ V+ +E +  + +
Sbjct:   45 IINDNVYGTVKVPRPIDKLIDTVEFQRLRHLKQTGLVYLVYPNCEHSRFVHSLGTFSLAYALVDKLR---HSQPSLNITESDLICTSVAALLHDVGHGPFSHLFDGEF--AKRNGSRFKHEDMSILIIKKIMNK--PEIKSEFACILGETDEEYAKSVTLITELISGKPFDFQDMDGFKDLPADVREETVKNEWAIIGCGPEKSFLFDVVSNSYNGHDVDKMDYLLRDSKASGVGITFSESTLERLFNHVRVVIDPNSGLKRIAYSIKCIGDLKAIGDSRQELHSKVYQHKAVRFMETLMVDAL 341          
BLAST of Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 vs. Ensembl Fly
Match: fal (gene:FBgn0028380 transcript:FBtr0347258)

HSP 1 Score: 98.9821 bits (245), Expect = 4.073e-22
Identity = 77/284 (27.11%), Postives = 138/284 (48.59%), Query Frame = 1
Query:  109 MVNDIVYGTITLPEYVKEIIDTQEFQRLRYISQTGL-TWYVNPSATCSRFEHSLGTFYLASKLIKQLKDQLESEDKLIITSEEVKCVELAALCHDLGHGPHSHFWE----HAFDPSLKIKTRKHEDVSV----EIFRELVDQXXXXXXXXXXXXXGLTEEMIDQICRMITGEFEREKDGEKKFLFQIVANKDSGLDVDKLDYLCRDSFYLGWSNNKIHDFKRLIYFFRVVKDESTNDWHLAMRDRELFKVNEVFSFRHILHRYGCKHRVVKSIECMFRNGIKQV 933
            ++ D V+G I L  +++EI++   FQRL+++ Q GL  W ++  A   R++H LG +  A   ++ ++     E KL     +   VE+AAL HD+GHGP SH WE    H FD         HE+ ++    +IF++ ++Q             G   ++I  +    +        G   ++F IV N+  GLDVDK DYL RD+  L   ++   DF  +    R+  D    ++  A    +  +V  +F  R +LH    ++ +  +++ +F + ++++
Sbjct:    2 LIEDEVHGVIELSSHIQEIVEHPLFQRLKHVHQLGLLPWAIDKKADHKRYDHCLGAYKSAQDHLRAIERNSHYEPKLPDWCRQ--AVEIAALLHDIGHGPMSHAWELVTHHEFD---------HEENAMACVDKIFKDALNQ---ELVSLRDDGGGRGVQLIKALILGSSENLPFPMLGH-TYIFDIVHNRRCGLDVDKWDYLRRDNKRLKILSSAEMDFDDVFLQARISPDGQRIEYRYA----DYHRVYRLFEARSLLHVKAYQYPLTCAMDVIFVSVVQRI 266          
BLAST of Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 vs. Ensembl Fly
Match: fal (gene:FBgn0028380 transcript:FBtr0290284)

HSP 1 Score: 98.9821 bits (245), Expect = 4.073e-22
Identity = 77/284 (27.11%), Postives = 138/284 (48.59%), Query Frame = 1
Query:  109 MVNDIVYGTITLPEYVKEIIDTQEFQRLRYISQTGL-TWYVNPSATCSRFEHSLGTFYLASKLIKQLKDQLESEDKLIITSEEVKCVELAALCHDLGHGPHSHFWE----HAFDPSLKIKTRKHEDVSV----EIFRELVDQXXXXXXXXXXXXXGLTEEMIDQICRMITGEFEREKDGEKKFLFQIVANKDSGLDVDKLDYLCRDSFYLGWSNNKIHDFKRLIYFFRVVKDESTNDWHLAMRDRELFKVNEVFSFRHILHRYGCKHRVVKSIECMFRNGIKQV 933
            ++ D V+G I L  +++EI++   FQRL+++ Q GL  W ++  A   R++H LG +  A   ++ ++     E KL     +   VE+AAL HD+GHGP SH WE    H FD         HE+ ++    +IF++ ++Q             G   ++I  +    +        G   ++F IV N+  GLDVDK DYL RD+  L   ++   DF  +    R+  D    ++  A    +  +V  +F  R +LH    ++ +  +++ +F + ++++
Sbjct:    2 LIEDEVHGVIELSSHIQEIVEHPLFQRLKHVHQLGLLPWAIDKKADHKRYDHCLGAYKSAQDHLRAIERNSHYEPKLPDWCRQ--AVEIAALLHDIGHGPMSHAWELVTHHEFD---------HEENAMACVDKIFKDALNQ---ELVSLRDDGGGRGVQLIKALILGSSENLPFPMLGH-TYIFDIVHNRRCGLDVDKWDYLRRDNKRLKILSSAEMDFDDVFLQARISPDGQRIEYRYA----DYHRVYRLFEARSLLHVKAYQYPLTCAMDVIFVSVVQRI 266          
BLAST of Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 vs. Ensembl Fly
Match: fal (gene:FBgn0028380 transcript:FBtr0321324)

HSP 1 Score: 98.9821 bits (245), Expect = 4.073e-22
Identity = 77/284 (27.11%), Postives = 138/284 (48.59%), Query Frame = 1
Query:  109 MVNDIVYGTITLPEYVKEIIDTQEFQRLRYISQTGL-TWYVNPSATCSRFEHSLGTFYLASKLIKQLKDQLESEDKLIITSEEVKCVELAALCHDLGHGPHSHFWE----HAFDPSLKIKTRKHEDVSV----EIFRELVDQXXXXXXXXXXXXXGLTEEMIDQICRMITGEFEREKDGEKKFLFQIVANKDSGLDVDKLDYLCRDSFYLGWSNNKIHDFKRLIYFFRVVKDESTNDWHLAMRDRELFKVNEVFSFRHILHRYGCKHRVVKSIECMFRNGIKQV 933
            ++ D V+G I L  +++EI++   FQRL+++ Q GL  W ++  A   R++H LG +  A   ++ ++     E KL     +   VE+AAL HD+GHGP SH WE    H FD         HE+ ++    +IF++ ++Q             G   ++I  +    +        G   ++F IV N+  GLDVDK DYL RD+  L   ++   DF  +    R+  D    ++  A    +  +V  +F  R +LH    ++ +  +++ +F + ++++
Sbjct:    2 LIEDEVHGVIELSSHIQEIVEHPLFQRLKHVHQLGLLPWAIDKKADHKRYDHCLGAYKSAQDHLRAIERNSHYEPKLPDWCRQ--AVEIAALLHDIGHGPMSHAWELVTHHEFD---------HEENAMACVDKIFKDALNQ---ELVSLRDDGGGRGVQLIKALILGSSENLPFPMLGH-TYIFDIVHNRRCGLDVDKWDYLRRDNKRLKILSSAEMDFDDVFLQARISPDGQRIEYRYA----DYHRVYRLFEARSLLHVKAYQYPLTCAMDVIFVSVVQRI 266          
BLAST of Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 vs. Ensembl Zebrafish
Match: samhd1 (SAM domain and HD domain 1 [Source:NCBI gene;Acc:553453])

HSP 1 Score: 188.734 bits (478), Expect = 5.379e-52
Identity = 148/475 (31.16%), Postives = 228/475 (48.00%), Query Frame = 1
Query:  115 NDIVYGTITLPEYVKEIIDTQEFQRLRYISQTGLTWYVNPSATCSRFEHSLGTFYLASKLIKQLKDQLESEDKLIITSEEVKCVELAALCHDLGHGPHSHFWEHAFDPSLKIKTR-KHEDVSVEIFRELVDQXXXXXXXXXXXXXGLTEEMIDQICRMITGEFE-----------REKDGEKKFLFQIVANKDSGLDVDKLDYLCRDSFYLGWSNNKIHDFKRLIYFFRVVKDESTNDWHLAMRDRELFKVNEVFSFRHILHRYGCKHRVVKSIECMFRNGIKQV-----IENTVARDEFLETVLEQKVPYNSEIWFSKQFISKVNDYHLWHVLKKYAKEM------FKNIQERNLYKLLHQSQIQITSGNNFDSLDNDISDLQTFLQR---TSGHSNXXXXXXXXXXQTENKG----DPLMLMKFYSKENPNKSFNYDKDSLPNSLSLKEDEIILMVFVERRIFDELEGVLEVF 1449
            ND ++G I L   +   IDT +FQRLR+I Q G T+ V P A+ +RFEHS+G  YLA  L+K L    E + +L IT +++ CV++A LCHDLGHGP SH ++  F P  +   + KHE  SV++F  LV+     +      +  L E++I  I   I G  E           + +  EK FL+++VANK +G+DVDK DY  RD ++LG  NN   D++R + F RV   E     H+  RD+E+  + ++F  R+ LHR   +H+V   IE M      +      I+ +  R   + + +E    Y           SK+ D+    +L     E+       +NI  R LYK + Q+    TS  N D     + D    L R   T    N+     + S+   + G    +P+  + FY K +P K+    K  +   L  +  E ++ V+ ++     LE   + F
Sbjct:   98 NDPIHGHIELHPLLLHFIDTPQFQRLRHIKQLGGTYLVFPGASHNRFEHSIGVGYLAGCLVKALN---ERQPELFITKQDILCVQIAGLCHDLGHGPFSHMFDGMFIPKARPADKWKHEIASVQMFDHLVEVNGLEAVMLHHGMR-LPEDLI-FIKEQIAGPLESAVLDQSQWPYKGRPVEKSFLYEVVANKRNGIDVDKWDYFARDCYHLGIQNN--FDYQRFLRFARVC--EVKGRKHICTRDKEVGNLYDMFHTRNCLHRRAYQHKVGNIIETMITEAFLKADPHIQIQGSSGRIFTISSAIEDMEAY-----------SKLTDHIFEQILYSSGPELSEARAILQNIICRRLYKCVGQT----TSETNVDVSQEKLLDWAKELARSKPTGTEGNLIAEDFVVSVIHMDYGMKEKNPINNVHFYCKNDPTKAIKIHKKQVSKLLPERFAEQLIRVYCKKTDDKSLEAAKKYF 548          
BLAST of Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 vs. Ensembl Zebrafish
Match: si:ch73-236c18.9 (si:ch73-236c18.9 [Source:ZFIN;Acc:ZDB-GENE-121214-125])

HSP 1 Score: 172.94 bits (437), Expect = 7.411e-47
Identity = 111/291 (38.14%), Postives = 162/291 (55.67%), Query Frame = 1
Query:  109 MVNDIVYGTITLPEYVKEIIDTQEFQRLRYISQTGLTWYVNPSATCSRFEHSLGTFYLASKLIKQLKDQLESEDKLIITSEEVKCVELAALCHDLGHGPHSHFWEHAFDP-SLKIKTR-----------KHEDVSVEIFRELVDQXXXXXXXXXXXXXGLTEEMIDQICRMITGEFE-------REKDGEKKFLFQIVANKDSGLDVDKLDYLCRDSFYLGWSNNKIHDFKRLIYFFRVVKDESTNDWHLAMRDRELFKVNEVFSFRHILHRYGCKHRVVKSIECMFRNGI 924
            + ND ++G I L   + +I DT +FQRLR++ Q G T+ V P A+ +RFEHS+G  YLA +L+K L D   ++ +L IT ++  CV++A LCHDLGHGP SH ++    P + KIKTR           KHE +SV +F  +V     +  E +    GLT+  +  I  +I G          + ++ EK FL++IVANK +G+DVDK DY  RD  +LG  N+   D  RL+ F RV         H+  RD+E   V ++F  R+ LHR   +H++   IE MF   +
Sbjct:   62 IFNDPIHGHIALHPLLVKITDTPQFQRLRHLKQLGGTYLVYPGASHNRFEHSIGVAYLAGRLVKSLHD---NQPELKITKQDFLCVQIAGLCHDLGHGPLSHVFDALVIPEAKKIKTRKGLPDDIPESWKHEQMSVLMFDSIV----KSLNEEVLREHGLTDNDVIFIKELIEGAKASDNEWPYKGRNVEKSFLYEIVANKQNGIDVDKWDYFARDCHHLGIRNS--FDHLRLLKFARVCVVNGRK--HICFRDKEADNVYDMFRTRYTLHRQAYQHKIGNIIEDMFAEAL 341          
BLAST of Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 vs. Ensembl Zebrafish
Match: si:ch73-236c18.8 (si:ch73-236c18.8 [Source:ZFIN;Acc:ZDB-GENE-121214-113])

HSP 1 Score: 169.474 bits (428), Expect = 1.282e-45
Identity = 141/464 (30.39%), Postives = 225/464 (48.49%), Query Frame = 1
Query:  109 MVNDIVYGTITLPEYVKEIIDTQEFQRLRYISQTGLTWYVNPSATCSRFEHSLGTFYLASKLIKQLKDQLESEDKLIITSEEVKCVELAALCHDLGHGPHSHFWEHAFDPSLK------------IKTRKHEDVSVEIFRELVDQXXXXXXXXXXXXXGLTEEMIDQICRMITGEFERE-------KDGEKKFLFQIVANKDSGLDVDKLDYLCRDSFYLGWSNNKIHDFKRLIYFFRVVKDESTNDWHLAMRDRELFKVNEVFSFRHILHRYGCKHRVVKSIECMFRNGIKQVIENTVARDEFLETVLEQKVPYN----SEIWFSKQFISKVNDYHLWHVLK------KYAKEMFKNIQERNLYKLLHQSQIQITSGNNFDSLDNDISDLQTFLQRTSGHSNXXXXXXXXXXQTENKG----DPLMLMKFYSKENPNKSFNYDKDSLPNSLSLKEDEIILMVF 1401
            + ND ++G I L   + +I DT +FQRLR++ Q G T+ V P A+ +RFEHS+G  YLA +L+K L D   ++ +L IT ++  CV++A LCHDLGHGP SH ++    P +K             ++ KHE +SV +F  +V     +  E +    GLT+  +  I  +I G    +       ++ EK FL++IVANK +G+DVDK DY  RD  +LG  N+   D  RL+ F RV         H+  RD+E   V ++F  R+ LHR   +H++   IE MF   +         RD      L +K P +    SE   S +  SK+ D     +L       K +K++   I  R L K + + ++ + + +  + L N         + T     +        +   + G    +P+  + FYSK  PN++   +   L + L  K +E ++ V+
Sbjct:   62 IFNDPIHGHIALHPLLVKITDTPQFQRLRHLKQLGGTYLVYPGASHNRFEHSIGVAYLAGRLVKSLHD---NQPELKITKQDFLCVQIAGLCHDLGHGPLSHVFDVLVIPEVKKIKKLKGLPDDIPESWKHEQMSVLMFDSIV----KSLNEEVLREHGLTDNDVIFIKELIEGAKASDNEWPYQGRNVEKSFLYEIVANKQNGIDVDKWDYFARDCHHLGIRNS--FDHLRLLKFARVCVVNGRK--HICFRDKEADNVYDMFRTRYTLHRQAYQHKIANIIEDMFAEALL-----LADRD------LHEKKPADMLKISEAIKSVEDYSKLTDEIFEQILSSTSPNLKESKDILDKIMRRKLPKFIREVRLTVKNMSK-EELKNSWKAAVKTYKPTDPTVTLTAEELPVYVVDLDHGMKDKNPIERVYFYSKRKPNEASTIEDYQLSSFLPKKFNEELVRVY 502          
BLAST of Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 vs. Ensembl Xenopus
Match: SAMHD1 (SAM domain and HD domain 1 [Source:NCBI gene;Acc:100498574])

HSP 1 Score: 199.519 bits (506), Expect = 2.064e-56
Identity = 148/469 (31.56%), Postives = 234/469 (49.89%), Query Frame = 1
Query:  115 NDIVYGTITLPEYVKEIIDTQEFQRLRYISQTGLTWYVNPSATCSRFEHSLGTFYLASKLIKQLKDQLESEDKLIITSEEVKCVELAALCHDLGHGPHSHFWEHAFDPSLKIKTR-KHEDVSVEIFRELVDQXXXXXXXXXXXXXGLTEEMI---DQICRMITGE----FEREKDGEKKFLFQIVANKDSGLDVDKLDYLCRDSFYLGWSNNKIHDFKRLIYFFRVVKDESTNDWHLAMRDRELFKVNEVFSFRHILHRYGCKHRVVKSIECMFRNGIKQV-----IENTVARDEFLETVLEQKVPYNSEIWFSKQFISKVNDYHLWHVLK------KYAKEMFKNIQERNLYKLLHQSQIQITSGNNFDSLDNDISDLQTFLQRTSG-----HSNXXXXXXXXXXQTENKGDPLMLMKFYSKENPNKSFNYDKDSLPNSLSLKEDEIILMVFVERRIFDELEGVLEVF 1449
            ND ++G I L   +  IIDT EFQRLRYI Q G ++YV P A+ +RFEHS+G  YLA  L++ L    E + +L I   ++ CV++A LCHDLGHGP SH ++  F P    K + KHE  SV +F  L+ +         +  + L +++    +QI   ++ E    F   +  EK FL++IVANK +G+DVDK DY  RD  +LG  NN   D+KR + F RV   E  +  H+  RD+E+  + ++F  R+ LHR   +H+V   IE M  +   +      I+ +      +   ++  V Y           +K+ D    H+L       K A+E+ + ++ R LYK + Q+   I S    D  D   +DL   + +TS      ++  ++   I+      + +P+  ++FY K +P K+    +D +   L  K  E I+ V+ ++     LE     F
Sbjct:   30 NDPIHGHIELHPLLVRIIDTPEFQRLRYIKQLGGSYYVFPGASHNRFEHSIGVGYLAGCLVQALH---ERQPELQINHRDMLCVQIAGLCHDLGHGPFSHMFDGRFMPLACPKRKFKHESASVAMFDHLI-KSNGLEEVMKEYGLCLPDDLTFIKEQIAGPLSSEDEQQFNSSRTEEKSFLYEIVANKRNGIDVDKWDYFARDCHHLGIQNN--FDYKRFLKFARVC--EVGSKKHICTRDKEVGNLYDMFHTRNCLHRRAYQHKVGNIIETMITDAFIKADPHIRIKGSDGNYYTISGSVDDMVAY-----------TKLTDNIYHHILYSDNPDLKEAREILRKVERRQLYKFVGQTHPSINSRIEPDEYDTLPADLAKSVPQTSTTDVELNTEDFIVDVIHMDYGMKEQNPINNVRFYCKSDPRKAIKIRRDQVSQLLPEKFAEQIIRVYCKKTDERSLEAAKRYF 479          
BLAST of Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 vs. Ensembl Xenopus
Match: SAMHD1 (SAM domain and HD domain 1 [Source:NCBI gene;Acc:100498574])

HSP 1 Score: 197.208 bits (500), Expect = 3.577e-56
Identity = 152/485 (31.34%), Postives = 229/485 (47.22%), Query Frame = 1
Query:  115 NDIVYGTITLPEYVKEIIDTQEFQRLRYISQTGLTWYVNPSATCSRFEHSLGTFYLASKLIKQLKDQLESEDKLIITSEEVKCVELAALCHDLGHGPHSHFWEHAFDPSLKIKTR-KHEDVSVEIFRELVDQXXXXXXXXXXXXXGLTEEM----------IDQICRMITGEFEREKDG-------------EKKFLFQIVANKDSGLDVDKLDYLCRDSFYLGWSNNKIHDFKRLIYFFRVVKDESTNDWHLAMRDRELFKVNEVFSFRHILHRYGCKHRVVKSIECMFRNGIKQV-----IENTVARDEFLETVLEQKVPYNSEIWFSKQFISKVNDYHLWHVLK------KYAKEMFKNIQERNLYKLLHQSQIQITSGNNFDSLDNDISDLQTFLQRTSG-----HSNXXXXXXXXXXQTENKGDPLMLMKFYSKENPNKSFNYDKDSLPNSLSLKEDEIILMVFVERRIFDELEGVLEVF 1449
            ND ++G I L   +  IIDT EFQRLRYI Q G ++YV P A+ +RFEHS+G  YLA  L++ L    E + +L I   ++ CV++A LCHDLGHGP SH ++  F P    K + KHE  SV +F  L+               GL E M          +  I   I G    E D              EK FL++IVANK +G+DVDK DY  RD  +LG  NN   D+KR + F RV   E  +  H+  RD+E+  + ++F  R+ LHR   +H+V   IE M  +   +      I+ +      +   ++  V Y           +K+ D    H+L       K A+E+ + ++ R LYK + Q+   I S    D  D   +DL   + +TS      ++  ++   I+      + +P+  ++FY K +P K+    +D +   L  K  E I+ V+ ++     LE     F
Sbjct:    5 NDPIHGHIELHPLLVRIIDTPEFQRLRYIKQLGGSYYVFPGASHNRFEHSIGVGYLAGCLVQALH---ERQPELQINHRDMLCVQIAGLCHDLGHGPFSHMFDGRFMPLACPKRKFKHESASVAMFDHLI------------KSNGLEEVMKEYGLCLPDDLTFIKEQIAGPLSSEDDAASFSTWYIFCRTEEKSFLYEIVANKRNGIDVDKWDYFARDCHHLGIQNN--FDYKRFLKFARVC--EVGSKKHICTRDKEVGNLYDMFHTRNCLHRRAYQHKVGNIIETMITDAFIKADPHIRIKGSDGNYYTISGSVDDMVAY-----------TKLTDNIYHHILYSDNPDLKEAREILRKVERRQLYKFVGQTHPSINSRIEPDEYDTLPADLAKSVPQTSTTDVELNTEDFIVDVIHMDYGMKEQNPINNVRFYCKSDPRKAIKIRRDQVSQLLPEKFAEQIIRVYCKKTDERSLEAAKRYF 459          
BLAST of Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 vs. Ensembl Xenopus
Match: SAMHD1 (SAM domain and HD domain 1 [Source:NCBI gene;Acc:100498574])

HSP 1 Score: 197.593 bits (501), Expect = 1.762e-55
Identity = 150/473 (31.71%), Postives = 232/473 (49.05%), Query Frame = 1
Query:  106 TMVNDIVYGTITLPEYVKEIIDTQEFQRLRYISQTGLTWYVNPSATCSRFEHSLGTFYLASKLIKQLKDQLESEDKLIITSEEVKCVELAALCHDLGHGPHSHFWEHAFDPSLKIKTR-KHEDVSVEIFRELVDQXXXXXXXXXXXXXGLTEEMID-QICRMITGEFERE-------KDGEKKFLFQIVANKDSGLDVDKLDYLCRDSFYLGWSNNKIHDFKRLIYFFRVVKDESTNDWHLAMRDRELFKVNEVFSFRHILHRYGCKHRVVKSIECMFRNGIKQV-----IENTVARDEFLETVLEQKVPYNSEIWFSKQFISKVNDYHLWHVLK------KYAKEMFKNIQERNLYKLLHQSQIQITSGNNFDSLDNDISDLQTFLQRTSG-----HSNXXXXXXXXXXQTENKGDPLMLMKFYSKENPNKSFNYDKDSLPNSLSLKEDEIILMVFVERRIFDELEGVLEVF 1449
            ++ ND ++G I L   +  IIDT EFQRLRYI Q G ++YV P A+ +RFEHS+G  YLA  L++ L    E + +L I   ++ CV++A LCHDLGHGP SH ++  F P    K + KHE  SV +F  L+               GL E M +  +C      F +E       +  EK FL++IVANK +G+DVDK DY  RD  +LG  NN   D+KR + F RV   E  +  H+  RD+E+  + ++F  R+ LHR   +H+V   IE M  +   +      I+ +      +   ++  V Y           +K+ D    H+L       K A+E+ + ++ R LYK + Q+   I S    D  D   +DL   + +TS      ++  ++   I+      + +P+  ++FY K +P K+    +D +   L  K  E I+ V+ ++     LE     F
Sbjct:   50 SVFNDPIHGHIELHPLLVRIIDTPEFQRLRYIKQLGGSYYVFPGASHNRFEHSIGVGYLAGCLVQALH---ERQPELQINHRDMLCVQIAGLCHDLGHGPFSHMFDGRFMPLACPKRKFKHESASVAMFDHLIKS------------NGLEEVMKEYGLCLPDDLTFIKEQIWPYRGRTEEKSFLYEIVANKRNGIDVDKWDYFARDCHHLGIQNN--FDYKRFLKFARVC--EVGSKKHICTRDKEVGNLYDMFHTRNCLHRRAYQHKVGNIIETMITDAFIKADPHIRIKGSDGNYYTISGSVDDMVAY-----------TKLTDNIYHHILYSDNPDLKEAREILRKVERRQLYKFVGQTHPSINSRIEPDEYDTLPADLAKSVPQTSTTDVELNTEDFIVDVIHMDYGMKEQNPINNVRFYCKSDPRKAIKIRRDQVSQLLPEKFAEQIIRVYCKKTDERSLEAAKRYF 492          
BLAST of Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 vs. Ensembl Xenopus
Match: SAMHD1 (SAM domain and HD domain 1 [Source:NCBI gene;Acc:100498574])

HSP 1 Score: 195.667 bits (496), Expect = 3.260e-55
Identity = 149/480 (31.04%), Postives = 235/480 (48.96%), Query Frame = 1
Query:  115 NDIVYGTITLPEYVKEIIDTQEFQRLRYISQTGLTWYVNPSATCSRFEHSLGTFYLASKLIKQLKDQLESEDKLIITSEEVKCVELAALCHDLGHGPHSHFWEHAFDPSLKIKTR-KHEDVSVEIFRELVDQXXXXXXXXXXXXXGLTEEMI---DQICRMITGEFE---------------REKDGEKKFLFQIVANKDSGLDVDKLDYLCRDSFYLGWSNNKIHDFKRLIYFFRVVKDESTNDWHLAMRDRELFKVNEVFSFRHILHRYGCKHRVVKSIECMFRNGIKQV-----IENTVARDEFLETVLEQKVPYNSEIWFSKQFISKVNDYHLWHVLK------KYAKEMFKNIQERNLYKLLHQSQIQITSGNNFDSLDNDISDLQTFLQRTSG-----HSNXXXXXXXXXXQTENKGDPLMLMKFYSKENPNKSFNYDKDSLPNSLSLKEDEIILMVFVERRIFDELEGVLEVF 1449
            ND ++G I L   +  IIDT EFQRLRYI Q G ++YV P A+ +RFEHS+G  YLA  L++ L    E + +L I   ++ CV++A LCHDLGHGP SH ++  F P    K + KHE  SV +F  L+ +         +  + L +++    +QI   ++ E E               R +  EK FL++IVANK +G+DVDK DY  RD  +LG  NN   D+KR + F RV   E  +  H+  RD+E+  + ++F  R+ LHR   +H+V   IE M  +   +      I+ +      +   ++  V Y           +K+ D    H+L       K A+E+ + ++ R LYK + Q+   I S    D  D   +DL   + +TS      ++  ++   I+      + +P+  ++FY K +P K+    +D +   L  K  E I+ V+ ++     LE     F
Sbjct:    5 NDPIHGHIELHPLLVRIIDTPEFQRLRYIKQLGGSYYVFPGASHNRFEHSIGVGYLAGCLVQALH---ERQPELQINHRDMLCVQIAGLCHDLGHGPFSHMFDGRFMPLACPKRKFKHESASVAMFDHLI-KSNGLEEVMKEYGLCLPDDLTFIKEQIAGPLSSEDEQQFNSMDPIYKNWPYRGRTEEKSFLYEIVANKRNGIDVDKWDYFARDCHHLGIQNN--FDYKRFLKFARVC--EVGSKKHICTRDKEVGNLYDMFHTRNCLHRRAYQHKVGNIIETMITDAFIKADPHIRIKGSDGNYYTISGSVDDMVAY-----------TKLTDNIYHHILYSDNPDLKEAREILRKVERRQLYKFVGQTHPSINSRIEPDEYDTLPADLAKSVPQTSTTDVELNTEDFIVDVIHMDYGMKEQNPINNVRFYCKSDPRKAIKIRRDQVSQLLPEKFAEQIIRVYCKKTDERSLEAAKRYF 465          
BLAST of Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 vs. Ensembl Xenopus
Match: SAMHD1 (SAM domain and HD domain 1 [Source:NCBI gene;Acc:100498574])

HSP 1 Score: 195.667 bits (496), Expect = 5.369e-55
Identity = 149/481 (30.98%), Postives = 236/481 (49.06%), Query Frame = 1
Query:  109 MVNDIVYGTITLPEYVKEIIDTQEFQRLRYISQTGLTWYVNPSATCSRFEHSLGTFYLASKLIKQLKDQLESEDKLIITSEEVKCVELAALCHDLGHGPHSHFWEHAFDPSLKIKTR-KHEDVSVEIFRELVDQXXXXXXXXXXXXXGLTEEMI---DQICRMITGEFE--------------REKDGEKKFLFQIVANKDSGLDVDKLDYLCRDSFYLGWSNNKIHDFKRLIYFFRVVKDESTNDWHLAMRDRELFKVNEVFSFRHILHRYGCKHRVVKSIECMFRNGIKQV-----IENTVARDEFLETVLEQKVPYNSEIWFSKQFISKVNDYHLWHVLK------KYAKEMFKNIQERNLYKLLHQSQIQITSGNNFDSLDNDISDLQTFLQRTSG-----HSNXXXXXXXXXXQTENKGDPLMLMKFYSKENPNKSFNYDKDSLPNSLSLKEDEIILMVFVERRIFDELEGVLEVF 1449
            + ND ++G I L   +  IIDT EFQRLRYI Q G ++YV P A+ +RFEHS+G  YLA  L++ L    E + +L I   ++ CV++A LCHDLGHGP SH ++  F P    K + KHE  SV +F  L+ +         +  + L +++    +QI   ++ E E              R +  EK FL++IVANK +G+DVDK DY  RD  +LG  NN   D+KR + F RV   E  +  H+  RD+E+  + ++F  R+ LHR   +H+V   IE M  +   +      I+ +      +   ++  V Y           +K+ D    H+L       K A+E+ + ++ R LYK + Q+   I S    D  D   +DL   + +TS      ++  ++   I+      + +P+  ++FY K +P K+    +D +   L  K  E I+ V+ ++     LE     F
Sbjct:    3 VFNDPIHGHIELHPLLVRIIDTPEFQRLRYIKQLGGSYYVFPGASHNRFEHSIGVGYLAGCLVQALH---ERQPELQINHRDMLCVQIAGLCHDLGHGPFSHMFDGRFMPLACPKRKFKHESASVAMFDHLI-KSNGLEEVMKEYGLCLPDDLTFIKEQIAGPLSSEDEQQFNSSQNSSSWPYRGRTEEKSFLYEIVANKRNGIDVDKWDYFARDCHHLGIQNN--FDYKRFLKFARVC--EVGSKKHICTRDKEVGNLYDMFHTRNCLHRRAYQHKVGNIIETMITDAFIKADPHIRIKGSDGNYYTISGSVDDMVAY-----------TKLTDNIYHHILYSDNPDLKEAREILRKVERRQLYKFVGQTHPSINSRIEPDEYDTLPADLAKSVPQTSTTDVELNTEDFIVDVIHMDYGMKEQNPINNVRFYCKSDPRKAIKIRRDQVSQLLPEKFAEQIIRVYCKKTDERSLEAAKRYF 464          
BLAST of Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 vs. Ensembl Mouse
Match: Samhd1 (SAM domain and HD domain, 1 [Source:MGI Symbol;Acc:MGI:1927468])

HSP 1 Score: 177.948 bits (450), Expect = 2.500e-48
Identity = 124/377 (32.89%), Postives = 191/377 (50.66%), Query Frame = 1
Query:  100 LETMVNDIVYGTITLPEYVKEIIDTQEFQRLRYISQTGLTWYVNPSATCSRFEHSLGTFYLASKLIKQLKDQLESEDKLIITSEEVKCVELAALCHDLGHGPHSHFWEHAFDPSLKIKTR-KHEDVSVEIFRELVDQXXXXXXXXXXXXXGLTEEMIDQICRMITGE----------FEREKDGEKKFLFQIVANKDSGLDVDKLDYLCRDSFYLGWSNNKIHDFKRLIYFFRV------VKDEST---NDWHLAMRDRELFKVNEVFSFRHILHRYGCKHRVVKSIECMFRNGIKQV-----IENTVARDEFLETVLEQKVPYNSEIWFSKQFISKVNDYHLWHVLKKY------AKEMFKNIQERNLYKLLHQSQ 1137
            L  + ND ++G I     +  IIDT +FQRLRYI Q G  +YV P A+ +RFEHSLG  YLA  L++ L    E + +L I+  ++ CV++A LCHDLGHGP SH ++  F P  + + + KHE  S+E+F  LV+  +         +  + EE I  I   I G             + +   K FL++IV+NK +G+DVDK DY  RD  +LG  NN   D+KR I F R+      VK++ T      H+  R++E+  + ++F  R+ LHR   +H++   I+ M  +   +      I  T  +   + T ++             +  +K+ D     VL         A+ + +NI+ RNLYK L ++Q
Sbjct:  146 LMKVFNDPIHGHIEFHPLLIRIIDTPQFQRLRYIKQLGGGYYVFPGASHNRFEHSLGVGYLAGCLVRALA---EKQPELQISERDILCVQIAGLCHDLGHGPFSHMFDGRFIPRARPEKKWKHEQGSIEMFEHLVNSNELKLVMKNYGL--VPEEDITFIKEQIMGPPITPVKDSLWPYKGRPATKSFLYEIVSNKRNGIDVDKWDYFARDCHHLGIQNN--FDYKRFIKFARICEVEYKVKEDKTYIRKVKHICSREKEVGNLYDMFHTRNCLHRRAYQHKISNLIDIMITDAFLKADPYVEITGTAGKKFRISTAID-----------DMEAFTKLTDNIFLEVLHSTDPQLSEAQSILRNIECRNLYKYLGETQ 504          
BLAST of Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 vs. Ensembl Mouse
Match: Samhd1 (SAM domain and HD domain, 1 [Source:MGI Symbol;Acc:MGI:1927468])

HSP 1 Score: 177.563 bits (449), Expect = 6.790e-48
Identity = 124/377 (32.89%), Postives = 191/377 (50.66%), Query Frame = 1
Query:  100 LETMVNDIVYGTITLPEYVKEIIDTQEFQRLRYISQTGLTWYVNPSATCSRFEHSLGTFYLASKLIKQLKDQLESEDKLIITSEEVKCVELAALCHDLGHGPHSHFWEHAFDPSLKIKTR-KHEDVSVEIFRELVDQXXXXXXXXXXXXXGLTEEMIDQICRMITGE----------FEREKDGEKKFLFQIVANKDSGLDVDKLDYLCRDSFYLGWSNNKIHDFKRLIYFFRV------VKDEST---NDWHLAMRDRELFKVNEVFSFRHILHRYGCKHRVVKSIECMFRNGIKQV-----IENTVARDEFLETVLEQKVPYNSEIWFSKQFISKVNDYHLWHVLKKY------AKEMFKNIQERNLYKLLHQSQ 1137
            L  + ND ++G I     +  IIDT +FQRLRYI Q G  +YV P A+ +RFEHSLG  YLA  L++ L    E + +L I+  ++ CV++A LCHDLGHGP SH ++  F P  + + + KHE  S+E+F  LV+  +         +  + EE I  I   I G             + +   K FL++IV+NK +G+DVDK DY  RD  +LG  NN   D+KR I F R+      VK++ T      H+  R++E+  + ++F  R+ LHR   +H++   I+ M  +   +      I  T  +   + T ++             +  +K+ D     VL         A+ + +NI+ RNLYK L ++Q
Sbjct:  126 LMKVFNDPIHGHIEFHPLLIRIIDTPQFQRLRYIKQLGGGYYVFPGASHNRFEHSLGVGYLAGCLVRALA---EKQPELQISERDILCVQIAGLCHDLGHGPFSHMFDGRFIPRARPEKKWKHEQGSIEMFEHLVNSNELKLVMKNYGL--VPEEDITFIKEQIMGPPITPVKDSLWPYKGRPATKSFLYEIVSNKRNGIDVDKWDYFARDCHHLGIQNN--FDYKRFIKFARICEVEYKVKEDKTYIRKVKHICSREKEVGNLYDMFHTRNCLHRRAYQHKISNLIDIMITDAFLKADPYVEITGTAGKKFRISTAID-----------DMEAFTKLTDNIFLEVLHSTDPQLSEAQSILRNIECRNLYKYLGETQ 484          
BLAST of Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 vs. Ensembl Mouse
Match: Samhd1 (SAM domain and HD domain, 1 [Source:MGI Symbol;Acc:MGI:1927468])

HSP 1 Score: 177.948 bits (450), Expect = 7.212e-48
Identity = 124/377 (32.89%), Postives = 191/377 (50.66%), Query Frame = 1
Query:  100 LETMVNDIVYGTITLPEYVKEIIDTQEFQRLRYISQTGLTWYVNPSATCSRFEHSLGTFYLASKLIKQLKDQLESEDKLIITSEEVKCVELAALCHDLGHGPHSHFWEHAFDPSLKIKTR-KHEDVSVEIFRELVDQXXXXXXXXXXXXXGLTEEMIDQICRMITGE----------FEREKDGEKKFLFQIVANKDSGLDVDKLDYLCRDSFYLGWSNNKIHDFKRLIYFFRV------VKDEST---NDWHLAMRDRELFKVNEVFSFRHILHRYGCKHRVVKSIECMFRNGIKQV-----IENTVARDEFLETVLEQKVPYNSEIWFSKQFISKVNDYHLWHVLKKY------AKEMFKNIQERNLYKLLHQSQ 1137
            L  + ND ++G I     +  IIDT +FQRLRYI Q G  +YV P A+ +RFEHSLG  YLA  L++ L    E + +L I+  ++ CV++A LCHDLGHGP SH ++  F P  + + + KHE  S+E+F  LV+  +         +  + EE I  I   I G             + +   K FL++IV+NK +G+DVDK DY  RD  +LG  NN   D+KR I F R+      VK++ T      H+  R++E+  + ++F  R+ LHR   +H++   I+ M  +   +      I  T  +   + T ++             +  +K+ D     VL         A+ + +NI+ RNLYK L ++Q
Sbjct:  146 LMKVFNDPIHGHIEFHPLLIRIIDTPQFQRLRYIKQLGGGYYVFPGASHNRFEHSLGVGYLAGCLVRALA---EKQPELQISERDILCVQIAGLCHDLGHGPFSHMFDGRFIPRARPEKKWKHEQGSIEMFEHLVNSNELKLVMKNYGL--VPEEDITFIKEQIMGPPITPVKDSLWPYKGRPATKSFLYEIVSNKRNGIDVDKWDYFARDCHHLGIQNN--FDYKRFIKFARICEVEYKVKEDKTYIRKVKHICSREKEVGNLYDMFHTRNCLHRRAYQHKISNLIDIMITDAFLKADPYVEITGTAGKKFRISTAID-----------DMEAFTKLTDNIFLEVLHSTDPQLSEAQSILRNIECRNLYKYLGETQ 504          
BLAST of Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 vs. Ensembl Mouse
Match: Samhd1 (SAM domain and HD domain, 1 [Source:MGI Symbol;Acc:MGI:1927468])

HSP 1 Score: 177.563 bits (449), Expect = 8.479e-48
Identity = 124/377 (32.89%), Postives = 191/377 (50.66%), Query Frame = 1
Query:  100 LETMVNDIVYGTITLPEYVKEIIDTQEFQRLRYISQTGLTWYVNPSATCSRFEHSLGTFYLASKLIKQLKDQLESEDKLIITSEEVKCVELAALCHDLGHGPHSHFWEHAFDPSLKIKTR-KHEDVSVEIFRELVDQXXXXXXXXXXXXXGLTEEMIDQICRMITGE----------FEREKDGEKKFLFQIVANKDSGLDVDKLDYLCRDSFYLGWSNNKIHDFKRLIYFFRV------VKDEST---NDWHLAMRDRELFKVNEVFSFRHILHRYGCKHRVVKSIECMFRNGIKQV-----IENTVARDEFLETVLEQKVPYNSEIWFSKQFISKVNDYHLWHVLKKY------AKEMFKNIQERNLYKLLHQSQ 1137
            L  + ND ++G I     +  IIDT +FQRLRYI Q G  +YV P A+ +RFEHSLG  YLA  L++ L    E + +L I+  ++ CV++A LCHDLGHGP SH ++  F P  + + + KHE  S+E+F  LV+  +         +  + EE I  I   I G             + +   K FL++IV+NK +G+DVDK DY  RD  +LG  NN   D+KR I F R+      VK++ T      H+  R++E+  + ++F  R+ LHR   +H++   I+ M  +   +      I  T  +   + T ++             +  +K+ D     VL         A+ + +NI+ RNLYK L ++Q
Sbjct:  146 LMKVFNDPIHGHIEFHPLLIRIIDTPQFQRLRYIKQLGGGYYVFPGASHNRFEHSLGVGYLAGCLVRALA---EKQPELQISERDILCVQIAGLCHDLGHGPFSHMFDGRFIPRARPEKKWKHEQGSIEMFEHLVNSNELKLVMKNYGL--VPEEDITFIKEQIMGPPITPVKDSLWPYKGRPATKSFLYEIVSNKRNGIDVDKWDYFARDCHHLGIQNN--FDYKRFIKFARICEVEYKVKEDKTYIRKVKHICSREKEVGNLYDMFHTRNCLHRRAYQHKISNLIDIMITDAFLKADPYVEITGTAGKKFRISTAID-----------DMEAFTKLTDNIFLEVLHSTDPQLSEAQSILRNIECRNLYKYLGETQ 504          
BLAST of Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 vs. UniProt/SwissProt
Match: sp|Q5ZJL9|SAMH1_CHICK (Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 OS=Gallus gallus OX=9031 GN=SAMHD1 PE=2 SV=2)

HSP 1 Score: 204.912 bits (520), Expect = 4.573e-57
Identity = 151/462 (32.68%), Postives = 231/462 (50.00%), Query Frame = 1
Query:  115 NDIVYGTITLPEYVKEIIDTQEFQRLRYISQTGLTWYVNPSATCSRFEHSLGTFYLASKLIKQLKDQLESEDKLIITSEEVKCVELAALCHDLGHGPHSHFWEHAFDPSLKIKTR-KHEDVSVEIFRELVDQXXXXXXXXXXXXXGLTEEMIDQICRMITGEFE----------REKDGEKKFLFQIVANKDSGLDVDKLDYLCRDSFYLGWSNNKIHDFKRLIYFFRVVKDESTNDWHLAMRDRELFKVNEVFSFRHILHRYGCKHRVVKSIECMFRNGIKQV-----IENTVARDEFLETVLEQKVPYNSEIWFSKQFISKVNDYHLWHVLKKY------AKEMFKNIQERNLYKLLHQSQ---IQITSGNNFDSLDNDISDLQTFLQRTSGHSNXXXXXXXXXXQTENKG----DPLMLMKFYSKENPNKSFNYDKDSLPNSLSLKEDEIILMVFVERR 1413
            ND V+G I +   +  IIDT +FQRLRYI Q G T++V P A+ +RFEHSLG  YLA  L+++LK   E + +L IT  ++ CVE+A LCHDLGHGP SH ++  F P  +     KHE  SVE+F  L+   K         +  + EE I  I   I G  +          R +  EK FL++IVANK +G+DVDK DY  RD  +LG  NN   D++RLI F RV   E+ N  H+  RD+E+  + ++F  R+ LHR   +H+V   IE M     ++      IE +  +   + T +E    Y           +K+ D     +L         A+E+   I+ R LYK L ++Q   +     + +D L  DI++ +   ++      +     I  +   + G    +P+  + FY K +P+K+    K+ +   L     E ++ V+ +R+
Sbjct:  110 NDPVHGHIEIHPLLVRIIDTPQFQRLRYIKQLGGTYFVFPGASHNRFEHSLGVGYLAGCLVRELK---ERQPELDITQRDILCVEIAGLCHDLGHGPFSHMFDGRFIPLARQGLNWKHETASVEMFEHLITSNKLEEIMESYGL--ILEEDIAFIKEQIGGPIDETACEESWPYRGRPKEKSFLYEIVANKKNGIDVDKWDYFARDCHHLGIQNN--FDYRRLIKFTRVC--EAGNQKHICARDKEVGNLYDMFHTRNCLHRRAYQHKVGNIIEIMITEAFQKADCFFQIEGSKGKLYHISTAMEDMEAY-----------TKLTDNIYLEILHSSRPELSEAREILHKIERRELYKFLGETQPEKVNEIPKDEYDGLAGDIANSKP--EKDPPDVELTAEDFIVDVVNMDYGMKDQNPIDNVLFYCKADPSKAIKISKEQVSRLLPGTFSEQVIRVYCKRQ 549          
BLAST of Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 vs. UniProt/SwissProt
Match: sp|Q6INN8|SAMH1_XENLA (Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 OS=Xenopus laevis OX=8355 GN=samhd1 PE=1 SV=2)

HSP 1 Score: 202.216 bits (513), Expect = 6.069e-56
Identity = 151/473 (31.92%), Postives = 233/473 (49.26%), Query Frame = 1
Query:  115 NDIVYGTITLPEYVKEIIDTQEFQRLRYISQTGLTWYVNPSATCSRFEHSLGTFYLASKLIKQLKDQLESEDKLIITSEEVKCVELAALCHDLGHGPHSHFWEHAFDP-SLKIKTRKHEDVSVEIFRELVDQXXXXXXXXXXXXXGLTEEMI---DQICRMITGEFE--------------REKDGEKKFLFQIVANKDSGLDVDKLDYLCRDSFYLGWSNNKIHDFKRLIYFFRVVKDESTNDWHLAMRDRELFKVNEVFSFRHILHRYGCKHRVVKSIECMFRNGIKQV-----IENTVARDEFLETVLEQKVPYNSEIWFSKQFISKVNDYHLWHVLKKYAKEMFKNIQERNLYKLLHQSQIQITSGNNFDSLDNDISDLQTFLQRTSG-----HSNXXXXXXXXXXQTENKGDPLMLMKFYSKENPNKSFNYDKDSLPNSLSLKEDEIILMVFVERRIFDELEGVLEVF 1449
            ND ++G I L   +  IIDT EFQRLRYI Q G ++YV P A+ +RFEHS+G  YLA  L++ L    E +  L I   ++ CV++A LCHDLGHGP SH ++  F P +   K  KHE  SV +F  L+ Q         +  + L +++    +QI   ++ E E              R +  EK FL++IVANK +G+DVDK DY  RD  +LG  NN   D+KR + F RV   E  +  H+  RD+E+  + ++F  R+ LHR   +H+V   IE M  +   +      IE    +   +   ++  V Y          I   ND +L     K A+E+ + ++ R+LYK + Q+     S    D  D   +DL + + +TS      H+  ++   I+      + +P+  ++FY K +P K+    +D +   L  K  E I+ V+ ++     LE     F
Sbjct:  116 NDPIHGHIELHPLLVRIIDTPEFQRLRYIKQLGGSYYVFPGASHNRFEHSIGVGYLAGCLVQALH---ERQPDLQIDMRDMLCVQIAGLCHDLGHGPFSHMFDGRFMPLACPQKKFKHESASVAMFDHLI-QSNGLEEAMKENGLCLPDDLTFIKEQIAGPLSSEAEQQFNSSPNSSSWPYRGRTEEKSFLYEIVANKRNGIDVDKWDYFARDCHHLGIQNN--FDYKRFLKFARVC--EVGSKKHICTRDKEVGNLYDMFHTRNCLHRRAYQHKVGNIIETMITDAFVKADPHIKIEGANGKYYSISGSVDDMVAYTKLTDNIYHQILYSNDPNL-----KEAREILQKVERRHLYKYIGQTHPHSNSRIEPDKYDKLPADLASSVPQTSAKDVELHAEDFIVDVIHMDYGMKEQNPINNVRFYCKADPRKAIKIRRDQVSQLLPEKFAEQIIRVYCKKTDEKSLETAKRYF 575          
BLAST of Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 vs. UniProt/SwissProt
Match: sp|Q0VCA5|SAMH1_BOVIN (Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 OS=Bos taurus OX=9913 GN=SAMHD1 PE=2 SV=1)

HSP 1 Score: 191.43 bits (485), Expect = 2.836e-52
Identity = 129/386 (33.42%), Postives = 200/386 (51.81%), Query Frame = 1
Query:  109 MVNDIVYGTITLPEYVKEIIDTQEFQRLRYISQTGLTWYVNPSATCSRFEHSLGTFYLASKLIKQLKDQLESEDKLIITSEEVKCVELAALCHDLGHGPHSHFWEHAFDPSLKIKTR-KHEDVSVEIFRELVDQXXXXXXXXXXXXXGLTEEMIDQICRMITGEFE-----------REKDGEKKFLFQIVANKDSGLDVDKLDYLCRDSFYLGWSNNKIHDFKRLIYFFRVVKDESTNDWHLAMRDRELFKVNEVFSFRHILHRYGCKHRVVKSIECMFRNGIKQV-----IENTVARDEFLETVLEQKVPYNS-------EIWFSKQFISKVNDYHLWHVLKKYAKEMFKNIQERNLYKLLHQSQ--IQITSGNNFDSLDNDIS 1188
            ++ND ++G I     +  IIDT +FQRLRYI Q G  +YV P A+ +RFEHSLG  YLA +L+++L    E + +L I+  ++ CV++A LCHDLGHGP SH ++  F P  + + +  HE  SV +F  L++            +  + EE I  I   ITG  E           + +  EK FL++IVANK +G+DVDK DY  RD  +LG  N+   D+KR + F RV   E  N  H+  R++E+  + ++F  R+ LHR   +H+V   I+ M  +   +      I  +  R   + T ++    +         EI +S      +ND          A+ + K I+ RNLYK + ++Q  IQ     N++ L N+++
Sbjct:  105 VINDPIHGHIEFHPLLMRIIDTPQFQRLRYIKQLGGGYYVFPGASHNRFEHSLGVGYLAGRLVRELS---EKQPELQISERDILCVQIAGLCHDLGHGPFSHMFDGRFIPLARPEIKWTHEQGSVMMFEHLINSNGLQDVMKYYGL--IPEEDILFIKEQITGPPESPIKDASKWLYKGRPKEKSFLYEIVANKRNGIDVDKWDYFARDCHHLGIQNS--FDYKRFLKFARVC--EVDNMKHICTREKEVGNLYDMFHTRNCLHRRAYQHKVGNIIDTMITDAFLKADDHIEITGSAGRKYHISTAIDDMEAFTKLTDNIFLEILYSTD--PNLND----------ARMILKKIESRNLYKFVGETQPMIQRIKKENYEHLPNEVA 469          
BLAST of Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 vs. UniProt/SwissProt
Match: sp|B0G107|SAMH1_DICDI (Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 homolog OS=Dictyostelium discoideum OX=44689 GN=DDB_G0272484 PE=3 SV=1)

HSP 1 Score: 188.348 bits (477), Expect = 9.577e-52
Identity = 146/463 (31.53%), Postives = 247/463 (53.35%), Query Frame = 1
Query:  109 MVNDIVYGTITLPEYVKEIIDTQEFQRLRYISQTGLTWYVNPSATCSRFEHSLGTFYLASKLIKQLKDQLESEDKLIITSEEVKCVELAALCHDLGHGPHSHFWEHAFDPSLKIKTRKHEDVSVEIFRELVDQXXXXXXXXXXXXXGLTE---EMIDQICRMITGEFEREKDGEKKFLFQIVANKDSGLDVDKLDYLCRDSFYLGWSNNKIHDFKRLIYFFRVVKDESTNDWHLAMRDRELFKVNEVFSFRHILHRYGCKHRVVKSIECMFRNGIKQVIENTVARDEFLETVLEQKVPYNSEIWFSKQFISKVNDYHLWHV-------LKKYAKEMFKNIQERNLYKLLHQSQIQITSGN---NFDSLDNDISDLQTFLQRTSGHSNXXXXXXXXXXQTENKGDPLMLMKFYSKENPNKSFNYDKDSLPNSLSLKEDEIILMVFVERRIFDELEGVLEVFRSL 1458
            ++ND+++G + +P+Y+ + IDT++FQRLR + Q G T +V P A+ SRFEHS+G  +LA K I ++K    ++ +L IT  E K V +A LCHDLGHGP SH +E   D     K   HED+S+++   ++D              GL E   + I  I  +I G   + +  E+ F++ IVAN  + +DVDK DYL RDS+YLG S   + DF+RL+ F +V+ D+      +    +E++ + E+F  R+ LH+    H+V KSIE M  +   +        D+FL+   + + P        K+FI+ ++D  L  +       L+K ++++ KNI+ RNLYK +   +I +++     + DSL  DI+ +   +      S+I +     +   ++K DP+   +FY++ +  +SF   K+   + +  +  E  + +F   +  ++ E V   FR L
Sbjct:   81 IINDVIHGHMEVPDYIMDFIDTEQFQRLRDLKQVGTTSFVFPCASHSRFEHSIGVSHLAGKYIDRIK---VTQPELEITEREQKFVRIAGLCHDLGHGPFSHAFESWVDQLGGSKRFHHEDMSIKMLNWIIDD------------HGLDEYDSDDIKFISSLIQG---KHRPKERAFIYDIVANNRNSVDVDKFDYLSRDSYYLGRST--VCDFQRLMEFSKVIDDQ------ICFLSKEIYNLYELFHTRYSLHKLVYTHKVGKSIEFMIADAFTEA-------DQFLKISDQLEDP--------KEFIN-LSDSLLRRIETSKEPELEK-SRKIIKNIRNRNLYKFV--DEIIVSTDKIRWSADSLAEDIAKVGNGIL----ESDIIVQNLKLNYAFKDK-DPVQSTRFYTRYDSTQSFTIKKEETSHLIPNQFQEERIRIFCRSK--EKCEQVQTAFRKL 491          
BLAST of Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 vs. UniProt/SwissProt
Match: sp|Q502K2|SAMH1_DANRE (Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 OS=Danio rerio OX=7955 GN=samhd1 PE=2 SV=2)

HSP 1 Score: 188.734 bits (478), Expect = 4.400e-51
Identity = 148/475 (31.16%), Postives = 228/475 (48.00%), Query Frame = 1
Query:  115 NDIVYGTITLPEYVKEIIDTQEFQRLRYISQTGLTWYVNPSATCSRFEHSLGTFYLASKLIKQLKDQLESEDKLIITSEEVKCVELAALCHDLGHGPHSHFWEHAFDPSLKIKTR-KHEDVSVEIFRELVDQXXXXXXXXXXXXXGLTEEMIDQICRMITGEFE-----------REKDGEKKFLFQIVANKDSGLDVDKLDYLCRDSFYLGWSNNKIHDFKRLIYFFRVVKDESTNDWHLAMRDRELFKVNEVFSFRHILHRYGCKHRVVKSIECMFRNGIKQV-----IENTVARDEFLETVLEQKVPYNSEIWFSKQFISKVNDYHLWHVLKKYAKEM------FKNIQERNLYKLLHQSQIQITSGNNFDSLDNDISDLQTFLQR---TSGHSNXXXXXXXXXXQTENKG----DPLMLMKFYSKENPNKSFNYDKDSLPNSLSLKEDEIILMVFVERRIFDELEGVLEVF 1449
            ND ++G I L   +   IDT +FQRLR+I Q G T+ V P A+ +RFEHS+G  YLA  L+K L    E + +L IT +++ CV++A LCHDLGHGP SH ++  F P  +   + KHE  SV++F  LV+     +      +  L E++I  I   I G  E           + +  EK FL+++VANK +G+DVDK DY  RD ++LG  NN   D++R + F RV   E     H+  RD+E+  + ++F  R+ LHR   +H+V   IE M      +      I+ +  R   + + +E    Y           SK+ D+    +L     E+       +NI  R LYK + Q+    TS  N D     + D    L R   T    N+     + S+   + G    +P+  + FY K +P K+    K  +   L  +  E ++ V+ ++     LE   + F
Sbjct:   98 NDPIHGHIELHPLLLHFIDTPQFQRLRHIKQLGGTYLVFPGASHNRFEHSIGVGYLAGCLVKALN---ERQPELFITKQDILCVQIAGLCHDLGHGPFSHMFDGMFIPKARPADKWKHEIASVQMFDHLVEVNGLEAVMLHHGMR-LPEDLI-FIKEQIAGPLESAVLDQSQWPYKGRPVEKSFLYEVVANKRNGIDVDKWDYFARDCYHLGIQNN--FDYQRFLRFARVC--EVKGRKHICTRDKEVGNLYDMFHTRNCLHRRAYQHKVGNIIETMITEAFLKADPHIQIQGSSGRIFTISSAIEDMEAY-----------SKLTDHIFEQILYSSGPELSEARAILQNIICRRLYKCVGQT----TSETNVDVSQEKLLDWAKELARSKPTGTEGNLIAEDFVVSVIHMDYGMKEKNPINNVHFYCKNDPTKAIKIHKKQVSKLLPERFAEQLIRVYCKKTDDKSLEAAKKYF 548          
BLAST of Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 vs. TrEMBL
Match: A0A2Y9DAI2 (deoxynucleoside triphosphate triphosphohydrolase SAMHD1 isoform X1 OS=Trichechus manatus latirostris OX=127582 GN=LOC101344268 PE=4 SV=1)

HSP 1 Score: 212.616 bits (540), Expect = 2.322e-57
Identity = 151/459 (32.90%), Postives = 237/459 (51.63%), Query Frame = 1
Query:  109 MVNDIVYGTITLPEYVKEIIDTQEFQRLRYISQTGLTWYVNPSATCSRFEHSLGTFYLASKLIKQLKDQLESEDKLIITSEEVKCVELAALCHDLGHGPHSHFWEHAFDPSLKIKTR-KHEDVSVEIFRELVDQXXXXXXXXXXXXXGLTEEMIDQICRMITGEFE----------REKDGEKKFLFQIVANKDSGLDVDKLDYLCRDSFYLGWSNNKIHDFKRLIYFFRVVKDESTNDWHLAMRDRELFKVNEVFSFRHILHRYGCKHRVVKSIECMFRNGIKQVIENTVARDEFLETVLEQKVPYN-SEIWFSKQFISKVNDYHLWHVLKK------YAKEMFKNIQERNLYKLLHQSQI---QITSGNNFDSLDNDISDLQT----FLQRTSGHSNXXXXXXXXXXQTENKGDPLMLMKFYSKENPNKSFNYDKDSLPNSLSLKEDEIILMVFVER 1410
            ++ND ++G I L   +  IIDT +FQRLRYI Q G ++YV P A+ +RFEHSLG  YLA  L++ L    E + +L I+  ++ CV++A LCHDLGHGP SH ++  F P  + + + KHE+ SV++F  LVD            +  + EE I  I   ITG  E          + +  EK FL++IVANK +G+DVDK DY  RD  +LG  NN   D+KR I F RV   E  N  H+  R++E+  + ++F  R+ LHR   +H+V   IE M  +         +  D ++E    Q   ++ S      +  +K+ D     +L         A+E+ K I+ R LYK + Q+Q    +     N++SL  +++D +      LQ      +  + +       E+K +P+  ++FY K +PNK+    KD +   L  +  E ++ V+ ++
Sbjct:  117 VINDPIHGHIELHPLLIRIIDTPQFQRLRYIKQLGGSYYVFPGASHNRFEHSLGVGYLAGCLVRALH---EKQPELQISERDMLCVQIAGLCHDLGHGPFSHMFDGRFIPLARPEVKWKHEEGSVKMFEHLVDSNGLRDVMQHYGL--IPEEDICFIKEQITGPLESPTKSLVWTYKGRPKEKSFLYEIVANKRNGIDVDKWDYFARDCHHLGIQNN--FDYKRFIKFARVC--EVDNKKHICTREKEVGNLYDMFHTRNCLHRRAYQHKVGNIIETMITDAF-------LKADPYIEITGAQGKKFHISTAIDDMEAFTKLTDNIFLEILYSTDPKLDIAREILKKIESRKLYKYVGQTQPMGQEKIKKENYESLPQEVADAKPGPDVLLQAELKAEDFIVDVINMDYGMEDK-NPIDHVRFYCKNDPNKAIRITKDQVSQLLPERFAEQLIRVYCKK 558          
BLAST of Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 vs. TrEMBL
Match: G3SPI6 (SAM and HD domain containing deoxynucleoside triphosphate triphosphohydrolase 1 OS=Loxodonta africana OX=9785 GN=SAMHD1 PE=4 SV=1)

HSP 1 Score: 211.075 bits (536), Expect = 7.881e-57
Identity = 154/459 (33.55%), Postives = 237/459 (51.63%), Query Frame = 1
Query:  109 MVNDIVYGTITLPEYVKEIIDTQEFQRLRYISQTGLTWYVNPSATCSRFEHSLGTFYLASKLIKQLKDQLESEDKLIITSEEVKCVELAALCHDLGHGPHSHFWEHAFDPSLKIKTR-KHEDVSVEIFRELVDQXXXXXXXXXXXXXGLTEEMIDQICRMITGEFE---------REKDGEKKFLFQIVANKDSGLDVDKLDYLCRDSFYLGWSNNKIHDFKRLIYFFRVVKDESTNDWHLAMRDRELFKVNEVFSFRHILHRYGCKHRVVKSIECMFRNGIKQVIENTVARDEFLETVLEQKVPYN-SEIWFSKQFISKVNDYHLWHVLKK------YAKEMFKNIQERNLYKLLHQS----QIQITSGNNFDSLDNDIS----DLQTFLQRTSGHSNXXXXXXXXXXQTENKGDPLMLMKFYSKENPNKSFNYDKDSLPNSLSLKEDEIILMVFVER 1410
            ++ND ++G I L   +  IIDT +FQRLRYI Q G ++YV P A+ +RFEHS+G  YLA  L++ L+D+   + +L I+  +V CVE+A LCHDLGHGP SH ++  F P  + + + KHE  SV++F  LVD            +  + EE I  I   ITG  E         + +  EK FL++IVANK +G+DVDK DY  RD  +LG  NN   D++R I F RV   E  N  H+  RD+E+  + ++F  R+ LHR   +H+V   IE M  +   +        D ++E    Q   Y  S      +  +K+ D     +L         A+E+ K I+ R LYK + Q+    Q++I    +++SL  D++    D    LQ      +  + +       E+K +P+  + FY K +PNK+    KD +   L  +  E ++ V+ ++
Sbjct:  118 VINDPIHGHIELHPLLIRIIDTPQFQRLRYIKQLGGSYYVFPGASHNRFEHSVGVGYLAGCLVRALRDK---QPELQISDRDVLCVEIAGLCHDLGHGPFSHMFDGRFIPLARPEIKWKHEQGSVKMFEHLVDSNGLREVMKQYNL--IPEEDICFIKEQITGPLESPTKSLWTYKGRPKEKSFLYEIVANKRNGIDVDKWDYFARDCHHLGIQNN--FDYRRFIKFARVC--EVDNKKHICTRDKEVGNLYDMFHTRNSLHRRAYQHKVGNIIETMITDAFLEA-------DPYIEITGAQGRKYRLSTAIDDVEAFTKLTDNIFLEILYSTDPRLDVAREILKKIECRKLYKYVGQTQPKGQVKIKK-EHYESLPQDVANAKPDPDIVLQAELKAEDFIVDVINMDYGMEDK-NPIDHVFFYCKNDPNKAIRITKDQVSQLLPERFAEQLIRVYCKK 558          
BLAST of Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 vs. TrEMBL
Match: A0A2G8KQQ4 (Putative deoxynucleoside triphosphate triphosphohydrolase SAMHD1-like (Fragment) OS=Stichopus japonicus OX=307972 GN=BSL78_12796 PE=4 SV=1)

HSP 1 Score: 203.756 bits (517), Expect = 4.319e-55
Identity = 159/489 (32.52%), Postives = 253/489 (51.74%), Query Frame = 1
Query:  115 NDIVYGTITLPEYVKEIIDTQEFQRLRYISQTGLTWYVNPSATCSRFEHSLGTFYLASKLIKQLKDQLESEDKLIITSEEVKCVELAALCHDLGHGPHSHFWEHAFDPSLKIKTR--------------------KHEDVSV------EIFRELVDQXXXXXXXXXXXXXGLTEEMIDQICRMITGEFEREKDGEKKFLFQIVANKDSGLDVDKLDYLCRDSFYLGWSNNKIHDFKRLIYFFRVVKDESTNDWHLAMRDRELFKVNEVFSFRHILHRYGCKHRVVKSIECMFRNGIKQVIENTVARDEFLETVLEQKVPYN-SEIWFSKQFISKVNDYHLWHVL------KKYAKEMFKNIQERNLYKLLHQSQIQITSGNNFDSLDND-----ISDLQTFLQRTSGHSNXXXXXXXXXXQTENKGDPLMLMKFYSKENPNKS-----FNYDKDSLPNSLSLKEDEIILMVFVERRIFDELEGVLEVFR 1452
            ND V+G I +   +  IIDT EFQRLR+I Q G+ ++V P A+ +RFEHSLG  YLA KL + L+ + +S   L IT E++ CVE+A LCHDLGHGP SH ++ AF P ++ K +                    K E +++      E F E+VD+++            +++EM+++I         R+KD  K +L++IVANK +G+DVDK DY  RDS +LG  NN   D+KR + F RV+     +   +  RD+E+  + E+F  R+ LH   C HRV K +E M       ++E  +  D++L+   +  +    S+     +  SK+ND+ +W +L       K ++++   I  R+L+  + Q+Q++      F+  + D        L    ++T   S+I + ++ ++     K DP+  +KFYSK +PNKS        D  +LP   S    E  L V V++R  +    V E F+
Sbjct:   31 NDSVHGHIEIHPLLVSIIDTPEFQRLRFIKQMGMCYFVYPGASHNRFEHSLGVSYLAGKLARSLQSKQKS---LKITKEDILCVEIAGLCHDLGHGPFSHLFDEAFLPKVRPKYKGKVKALRTYTPREGTELPIIKDELLTILKGENQEGFLEVVDEREKKGM--------VSKEMVEEIWS------SRKKD--KSYLYEIVANKRNGIDVDKWDYFARDSMHLGIQNN--FDWKRYLRFARVL--HGPDGSQICTRDKEITNLYEMFHSRYSLHLRACNHRVNKILEAM-------IVEALIEADKYLQFPGKDGIMKTMSQSIDDMEAYSKLNDHIMWTILCSNDDNLKKSRDLINRILTRDLFVCVGQTQLKKKGSQLFNIKEEDAEKEIFEKLSEEAKKTIKQSDIIVHIAKFNYGMGEK-DPVEHVKFYSKCDPNKSVRISEIRQDSMALPREFS----ERFLRVCVKQRDNEVCRWVREAFK 484          
BLAST of Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 vs. TrEMBL
Match: A0A1S3JH28 (deoxynucleoside triphosphate triphosphohydrolase SAMHD1 OS=Lingula unguis OX=7574 GN=LOC106173172 PE=4 SV=1)

HSP 1 Score: 204.142 bits (518), Expect = 2.463e-54
Identity = 150/464 (32.33%), Postives = 238/464 (51.29%), Query Frame = 1
Query:  115 NDIVYGTITLPEYVKEIIDTQEFQRLRYISQTGLTWYVNPSATCSRFEHSLGTFYLASKLIKQLKDQLESEDKLIITSEEVKCVELAALCHDLGHGPHSHFWEHAFDPSLKIKTR-KHEDVSVEIFRELVDQXXXXXXXXXXXXXGLTEEMIDQICRMITGEFERE---------KDGEKKFLFQIVANKDSGLDVDKLDYLCRDSFYLGWSNNKIHDFKRLIYFFRVVKDESTNDWHLAM--RDRELFKVNEVFSFRHILHRYGCKHRVVKSIECMFRNGIKQV-----IENTVARDEFLETVLEQKVPYNSEIWFSKQFISKVNDYHLWHVLKKY------AKEMFKNIQERNLYKLLHQ----SQIQITSGNNFDSLDNDISDLQTF-----LQRTSGHSNXXXXXXXXXXQTENKGDPLMLMKFYSKENPNKSFNYDKDSLPNSLSLKEDEIILMVFVER 1410
            ND ++G I L      IIDT +FQRLRY+ Q G  +YV P AT +RFEHS+G  YLA +L+++LKD+   + +L IT +++ CV++A LCHDLGHGP+SH W+  F P ++   + +HED SV++F  LV+       + I    GL E     I   I G  ER+         +  +K FL+++VANK +G+DVDK DY  RD ++LG   N I D  R I F RV++     D HL +  RD+E+  + ++F  R++LHR   +H+V + +E M      +      +E    +   L   +E  V Y           +K+ND     +L  +      A+++ +NI++R LYK + Q    +++ IT  +  +    +I D+ T       +R     +  L +       + K +P+  ++FY K NP  +    KD +   L     E +L ++  R
Sbjct:  118 NDPIHGHIELHPLCVRIIDTPQFQRLRYLKQLGGAYYVFPGATHNRFEHSIGVCYLAGRLVRELKDR---QPELKITEQDILCVQIAGLCHDLGHGPYSHLWDGLFIPMVRQGIKWRHEDSSVKMFDYLVED---NDLKPIFEEYGLGERDRVFIKEQIAGPQERDVQQGWNYFGRKEQKSFLYEVVANKRNGIDVDKWDYFERDCYHLGI--NSIFDHNRFIKFARVIR----VDGHLQICSRDKEVGNLYDMFHTRNVLHRRAYQHKVNRIVEIMMAEAFAKADPHFDLEGRDGKTYHLSNAMEDVVAY-----------TKLNDSLFHQILNSHNPNLAGARDILRNIEKRVLYKCVGQTVPKAELTITKKDT-EVFAQEICDIVTPDDLEEAERPLRAEDFLLDVINLDYGMKKK-NPIDNVRFYKKNNPEVAIRVRKDQVSQLLPETFAEQLLRIYCRR 556          
BLAST of Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 vs. TrEMBL
Match: G1MQP9 (SAM and HD domain containing deoxynucleoside triphosphate triphosphohydrolase 1 OS=Meleagris gallopavo OX=9103 GN=SAMHD1 PE=4 SV=2)

HSP 1 Score: 201.83 bits (512), Expect = 3.754e-54
Identity = 155/470 (32.98%), Postives = 239/470 (50.85%), Query Frame = 1
Query:  115 NDIVYGTITLPEYVKEIIDTQEFQRLRYISQTGLTWYVNPSATCSRFEHSLGTFYLASKLIKQLKDQLESEDKLIITSEEVKCVELAALCHDLGHGPHSHFWEHAFDPSLKIKTR-KHEDVSVEIFRELVDQXXXXXXXXXXXXXGLTEEMIDQICRMITGEFE----------REKDGEKKFLFQIVANKDSGLDVDKLDYLCRDSFYLGWSNNKIHDFKRLIYFFRVVKDESTNDWHLAMRDRELFKVNEVFSFRHILHRYGCKHRVVKSIECMFRNGIKQVIENTVARDEFLET-VLEQKVPYNSEIWFSKQFISKVNDYHLWHVLKKY------AKEMFKNIQERNLYKLLHQSQ---IQITSGNNFDSLDNDISDLQTFLQRTSGHSNXXXXXXXXXXQTENKG----DPLMLMKFYSKENPNKSFNYDKDSLPNSLSLKEDEIILMVFVERRIFDELEGVLEVF 1449
            ND V+G I +   +  IIDT +FQRLRYI Q G T++V P A+ +RFEHSLG  YLA  L+++LK   E + +L IT  ++ CVE+A LCHDLGHGP SH ++  F P  +     KHE  SVE+F  L+   K         +I L E+M+  I   I G  +          R +  EK FL++IVANK +G+DVDK DY  RD  +LG  NN   D++RLI F RV   E+ N  H+  RD+E+  + ++F  R+ LHR   +H+V   IE M    + Q+ E     D F +    E K+   S      +  +K+ D     +L         A+E+ + I+ R L+K L ++Q   +     + +D L  DI++ +   ++      +     I  +   + G    +P+  + FY K +P+K+    K+ +   L     E ++ V+ +R+  D +    + F
Sbjct:   25 NDPVHGHIEMHPLLVRIIDTPQFQRLRYIKQLGGTYFVFPGASHNRFEHSLGVGYLAGCLVRELK---ERQPELGITQRDILCVEIAGLCHDLGHGPFSHMFDGRFIPLARQGLNWKHETASVEMFEHLITSNKLEEVMEWHGLI-LEEDMV-FIKEQIAGPIDETACEESWPYRGRPKEKSFLYEIVANKKNGIDVDKWDYFARDCHHLGIQNN--FDYRRLIKFTRVC--EAGNQKHICARDKEVGNLYDMFHTRNCLHRRAYQHKVGNIIEIM---QVLQITEAFQKADRFFQIEGSEGKLYQISTAMEDMEAYTKLTDNIYLEILHSSRPELSEAREILRKIERRELHKFLGETQPEKMNEIPKDEYDDLPGDIANSKP--EKDPPDVELTAEDFIVDVVNMDYGMKDQNPIDNVLFYCKADPSKAIKISKEQVSRLLPGTFSEQVIRVYCKRQDPDIVSAAKQYF 480          
BLAST of Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 vs. Ensembl Cavefish
Match: ENSAMXT00000032130.1 (deoxynucleoside triphosphate triphosphohydrolase SAMHD1-like [Source:NCBI gene;Acc:103028826])

HSP 1 Score: 198.364 bits (503), Expect = 3.497e-55
Identity = 145/447 (32.44%), Postives = 229/447 (51.23%), Query Frame = 1
Query:  115 NDIVYGTITLPEYVKEIIDTQEFQRLRYISQTGLTWYVNPSATCSRFEHSLGTFYLASKLIKQLKDQLESEDKLIITSEEVKCVELAALCHDLGHGPHSHFWEHAFDPSLKI--KTRKHEDVSVEIFRELVDQXXXXXXXXXXXX--XGLTEEMIDQICRMITGEFE-------REKDGEKKFLFQIVANKDSGLDVDKLDYLCRDSFYLGWSNNKIHDFKRLIYFFRVVKDESTNDWHLAMRDRELFKVNEVFSFRHILHRYGCKHRVVKSIECMFRNGIKQVIENTVARDEFLETVLEQKVPYNSEIWFSKQFISKVNDYHLWHVLKKYAKEMFKNIQERNLYKLLHQSQIQITSGNNFDSLDNDISDLQTFLQRTSGHSNXXXXXXXXXXQTENK-------GDPLMLMKFYSKENPNKSFNYDKDSLPNSLSLKEDEIILMVF 1401
            ND V+G I +   + +IIDT EFQRLR I Q G  +YV P A+ +RFEHSLG  +LA KL++ LK  L   + L IT  +  CV++AALCHDLGHGP S    HAFD  +K    + KHED SV++F+ L+++         +       +E+    I  +I G  +       + +D +K FL+ IVAN  +G+DVDK+DY  RD  +LG   N  H+  R I F RV   +   +  + MRD+E   + E+F  R++LH    +HRVVK++E M  + +K+      A+D     + E  +   + ++ +   + K+ +     + K  A+++ K + +R+LYKLL     +     + DS +     L+T+L+                 + + K        +P+  ++FY K +PN      KD + + L  K  E  +M+F
Sbjct:   27 NDSVHGHIEMHPLLVKIIDTPEFQRLRNIKQLGGGYYVYPGASHNRFEHSLGVAHLAGKLLQSLKKTL--PEGLEITPNDELCVQIAALCHDLGHGPFS----HAFDIFMKKLDSSWKHEDASVKMFKHLIEENGIKEIMARENKDWDAFSEKDFMFIMELIQGPSKSASEWPYKGRDKKKAFLYDIVANHRNGIDVDKMDYFTRDCHHLGMKCNFSHE--RFITFARVC--DENGETQICMRDKEAMNMYELFHVRNLLHHNAYQHRVVKAVELMIMDALKE------AKDHL--NLKEATMDPKTFVYLTDDILQKILNKPEKKLEK--AQKIIKRVLKRDLYKLLGVKTFEPQELKHLDSDEEWKKVLETWLENIQTPVGARKLNPEDFTEVQVKFNYGMKDKNPIDSLRFYRKYDPNTPIKLSKDEVSHLLPEKFAETKVMLF 453          
BLAST of Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 vs. Ensembl Cavefish
Match: ENSAMXT00000041115.1 (deoxynucleoside triphosphate triphosphohydrolase SAMHD1-like [Source:NCBI gene;Acc:111197473])

HSP 1 Score: 189.889 bits (481), Expect = 1.605e-54
Identity = 116/280 (41.43%), Postives = 161/280 (57.50%), Query Frame = 1
Query:  115 NDIVYGTITLPEYVKEIIDTQEFQRLRYISQTGLTWYVNPSATCSRFEHSLGTFYLASKLIKQLKDQLESEDKLIITSEEVKCVELAALCHDLGHGPHSHFWEHAFDPSLK--IKTRKHEDVSVEIFRELVDQXXXXXXXXXXXX--XGLTEEMIDQICRMITG---EFEREKDGEKKFLFQIVANKDSGLDVDKLDYLCRDSFYLGWSNNKIHDFKRLIYFFRVVKDESTNDWHLAMRDRELFKVNEVFSFRHILHRYGCKHRVVKSIECMFRNGIKQV 933
            ND V+G I +   + +IIDT EFQR R I Q G  +YV P A+ +RFEHSLG  +LA KL++ LK  L   + L IT  +  CV++AALCHDLGHGP S    HAFD  +K      KHED S+E+F  L+ +         +       +EE    I ++I G   E   E++ +K FL+ IVAN  +G+DVDK+DY  RD  +LG   N  H+  R I F RV   E   +  + MRD+E   + E+F  R++LH   C+HRVVK++E M  + +K+ 
Sbjct:   15 NDSVHGHIEMHPLLVKIIDTPEFQRSRNIKQLGGVYYVYPGASHNRFEHSLGVAHLAGKLLQSLKKNL--PEGLEITPNDELCVQIAALCHDLGHGPFS----HAFDIFMKDFDSKWKHEDASIEMFDHLIQKNGIKKIMEEENKDWDAFSEEHFMFIKKLIRGTKTEQPNEEEKKKAFLYDIVANYRNGIDVDKMDYFTRDCHHLGMKCNFSHE--RFITFARVC--EENGETQICMRDKEAMNMYEIFHVRNLLHHNACQHRVVKAVELMIMDALKEA 284          
BLAST of Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 vs. Ensembl Cavefish
Match: ENSAMXT00000057570.1 (deoxynucleoside triphosphate triphosphohydrolase SAMHD1-like [Source:NCBI gene;Acc:111191578])

HSP 1 Score: 183.726 bits (465), Expect = 2.261e-50
Identity = 145/467 (31.05%), Postives = 235/467 (50.32%), Query Frame = 1
Query:  115 NDIVYGTITLPEYVKEIIDTQEFQRLRYISQTGLTWYVNPSATCSRFEHSLGTFYLASKLIKQLKDQLESEDKLIITSEEVKCVELAALCHDLGHGPHSHFWEHAFDPSLKIKTRKHEDVSVEIFRELVDQXXXXXXXXXXXXXGLTEEMIDQICRMITGEFE-------REKDGEKKFLFQIVANKDSGLDVDKLDYLCRDSFYLGWSNNKIHDFKRLIYFFRVVKDESTNDWHLAMRDRELFKVNEVFSFRHILHRYGCKHRVVKSIECMFRNGIKQVIENTVARDEFLETVLEQKVPYNSEIWFSK---QFISKVNDYHLWHVLKKYAKEMFKNIQERNLYK-----------------------LLHQSQIQITSGNNFDSLDNDISDLQTFLQRTSGHSNXXXXXXXXXXQTE-----NKGDPLMLMKFYSKENPNKSFNYDKDSLPNSLSLKEDEIILMVF 1401
            ND V+G I +   + +IIDT EFQRLR + Q G  +YV P A+ +RFEHSLG  +LA KL++ LKD   S+  L I  E+  CV++A LCHDLGHGP SH ++   +   +    KHED SV++F  L+   K      ++    L  E  + I  +I  + +       + +  EK FL++IVANK +G+DVDK+DY  RD  +LG ++N  H+  R + F RV  DE+  + H+ MRD+E   + E+F  R+++ +  C HRV K++E M  + + +   +    +E L T+ E     ++    +    Q I +  D +L     K ++E+ K I++R+LY+                       LL +   +IT  N   +L ++   L+ FL + +             +  +      + +P+  + FY K  P+KS+   K  + + L     E  +M+F
Sbjct:   15 NDSVHGHIEMHPLLVKIIDTPEFQRLRNVKQFGGGYYVYPGASHNRFEHSLGVAHLAGKLVQNLKD---SQPDLGIDDEDELCVQIAGLCHDLGHGPFSHAFDDFMEQVQEDDKWKHEDQSVKMFDHLI--IKGHIKGIMEKKYNLKNEDFEFIKELINPDKDNKTEWQFKGRTQEKSFLYEIVANKLTGIDVDKMDYFSRDCHHLGMTSNFSHE--RYMMFARVCTDEN-GEKHICMRDKEAVNMYELFHVRNLIRQRACHHRVAKAVELMITDALIEANSHFKLGEENL-TICEAVNDLDTFTHLTDDILQEIERSTDDNL-----KQSQEIIKRIRDRDLYRFVDGELFKRNEVRSLKTTKEKKDLLEKWIKKIT--NQQTNLSSEEQQLKDFLDKKNNQHPKLSPEDFRIVVIDLTYGMEESNPIDSLLFYKKNQPDKSYKLSKAKVSHMLPGTFAETRVMLF 465          
BLAST of Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 vs. Ensembl Cavefish
Match: ENSAMXT00000045292.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000081.1:2518931:2530795:1 gene:ENSAMXG00000031001.1 transcript:ENSAMXT00000045292.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 170.629 bits (431), Expect = 1.624e-46
Identity = 139/481 (28.90%), Postives = 233/481 (48.44%), Query Frame = 1
Query:  118 DIVYGTITLPEYVKEIIDTQEFQRLRYISQTGLTWYVNPSATCSRFEHSLGTFYLASKLIKQLKDQLESEDKLIITSEEVKCVELAALCHDLGHGPHSHFWEHAFDPSLKIKTRKHEDVSVEIFRELVDQXXXXXXXXXXXXXGLTEEMIDQICRMITGEFERE-------------KDGEKKFLFQIVANKDSGLDVDKLDYLCRDSFYLGWSNNKIHDFKRLIYFFRVVKDESTNDWHLAMRDRELFKVNEVFSFRHILHRYGCKHRVVKSIECMFRNGIKQVIENTVARDEFLETVLEQKVPYNSEIWFSKQFISKVNDYHLWHVLKKYAKEMFKNIQERNLYKLLHQSQIQITSGNNFDSLDNDISDLQTFLQ----RTSGH-----SNXXXXXXXXXXQTENKGDPLMLMKFYSKENPNKSFNYDKDSLPNSLSLKEDEIILMVFVER---RIFDELEGVLEVF-----RSLESKS 1470
            D V+G I L   +  IIDT +FQRLR I Q G  ++V P A+ +RFEHS+G  +LA KL++ L+    ++++L IT  +  CV++A LCHDLGHGP SH +E            KHE++SV +F  L+++  +  +E ++     T++    I  +I                    +  EK +L+QIV N+ +G+DVDK+DY  RD  +LG   N  H+  R + F RV  DE      + +RD+E   + E+F  R  LH     HRV K++E M  + ++       A +E L        P ++ +  +   + K+ D  L       A  + + I +R +YK +     +     + D  ++    LQ +++    +  GH     +  +  + I      N+ DP+  ++FY ++ PN      +D +   L  +  EI +MVF +R   R+ D ++  +E       R+ E++S
Sbjct:   14 DPVHGHIALDPLLVSIIDTPQFQRLRNIKQLGGGYFVFPGASHNRFEHSIGVAHLAGKLVQSLR----TDNELNITDTDELCVKIAGLCHDLGHGPFSHVFEGFMKEENPESNWKHEEMSVRMFDYLIEE--NGISEIMRNEYNFTDQDFQFIRELIYTPKPPNNPNPENRQWSYTGRPQEKSYLYQIVNNQTTGIDVDKMDYFSRDCHHLGIKCNFSHE--RYLVFARVCIDEELGT-QICIRDKEAMNMYELFHIRSYLHHNIYHHRVTKAVESMIVDALR-------AANERLSISAAVNDP-SAYMKLTDFILQKILD--LADPEHPAAPGIIERISKREVYKFIDGKVFRPNDVRHVDLAESWEEKLQAWVEHVRNKAGGHQLEFNAQDFKIMPIKINCGRNEDDPISFLRFYRRDEPNIPIQLSRDEISFLLPERFAEIKVMVFYKREDERVVDLMKRHIEALWEELQRAPENQS 475          
BLAST of Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 vs. Ensembl Cavefish
Match: ENSAMXT00000040847.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000081.1:2469780:2530795:1 gene:ENSAMXG00000031001.1 transcript:ENSAMXT00000040847.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 170.629 bits (431), Expect = 1.624e-46
Identity = 139/481 (28.90%), Postives = 233/481 (48.44%), Query Frame = 1
Query:  118 DIVYGTITLPEYVKEIIDTQEFQRLRYISQTGLTWYVNPSATCSRFEHSLGTFYLASKLIKQLKDQLESEDKLIITSEEVKCVELAALCHDLGHGPHSHFWEHAFDPSLKIKTRKHEDVSVEIFRELVDQXXXXXXXXXXXXXGLTEEMIDQICRMITGEFERE-------------KDGEKKFLFQIVANKDSGLDVDKLDYLCRDSFYLGWSNNKIHDFKRLIYFFRVVKDESTNDWHLAMRDRELFKVNEVFSFRHILHRYGCKHRVVKSIECMFRNGIKQVIENTVARDEFLETVLEQKVPYNSEIWFSKQFISKVNDYHLWHVLKKYAKEMFKNIQERNLYKLLHQSQIQITSGNNFDSLDNDISDLQTFLQ----RTSGH-----SNXXXXXXXXXXQTENKGDPLMLMKFYSKENPNKSFNYDKDSLPNSLSLKEDEIILMVFVER---RIFDELEGVLEVF-----RSLESKS 1470
            D V+G I L   +  IIDT +FQRLR I Q G  ++V P A+ +RFEHS+G  +LA KL++ L+    ++++L IT  +  CV++A LCHDLGHGP SH +E            KHE++SV +F  L+++  +  +E ++     T++    I  +I                    +  EK +L+QIV N+ +G+DVDK+DY  RD  +LG   N  H+  R + F RV  DE      + +RD+E   + E+F  R  LH     HRV K++E M  + ++       A +E L        P ++ +  +   + K+ D  L       A  + + I +R +YK +     +     + D  ++    LQ +++    +  GH     +  +  + I      N+ DP+  ++FY ++ PN      +D +   L  +  EI +MVF +R   R+ D ++  +E       R+ E++S
Sbjct:   14 DPVHGHIALDPLLVSIIDTPQFQRLRNIKQLGGGYFVFPGASHNRFEHSIGVAHLAGKLVQSLR----TDNELNITDTDELCVKIAGLCHDLGHGPFSHVFEGFMKEENPESNWKHEEMSVRMFDYLIEE--NGISEIMRNEYNFTDQDFQFIRELIYTPKPPNNPNPENRQWSYTGRPQEKSYLYQIVNNQTTGIDVDKMDYFSRDCHHLGIKCNFSHE--RYLVFARVCIDEELGT-QICIRDKEAMNMYELFHIRSYLHHNIYHHRVTKAVESMIVDALR-------AANERLSISAAVNDP-SAYMKLTDFILQKILD--LADPEHPAAPGIIERISKREVYKFIDGKVFRPNDVRHVDLAESWEEKLQAWVEHVRNKAGGHQLEFNAQDFKIMPIKINCGRNEDDPISFLRFYRRDEPNIPIQLSRDEISFLLPERFAEIKVMVFYKREDERVVDLMKRHIEALWEELQRAPENQS 475          
BLAST of Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 vs. Ensembl Sea Lamprey
Match: samhd1 (SAM domain and HD domain 1 [Source:NCBI gene;Acc:553453])

HSP 1 Score: 179.874 bits (455), Expect = 1.412e-50
Identity = 121/364 (33.24%), Postives = 192/364 (52.75%), Query Frame = 1
Query:  115 NDIVYGTITLPEYVKEIIDTQEFQRLRYISQTGLTWYVNPSATCSRFEHSLGTFYLASKLIKQLKDQLESEDKLIITSEEVKCVELAALCHDLGHGPHSHFWEHAFDPSLKIKTR-KHEDVSVEIFRELVDQXXXXXXXXXXXXXGLTEEMIDQICRMITGEFE---------REKDGEKKFLFQIVANKDSGLDVDKLDYLCRDSFYLGWSNNKIHDFKRLIYFFRV--VKDESTNDWHLAMRDRELFKVNEVFSFRHILHRYGCKHRVVKSIECMFRNGIKQV-----IENTVARDEFLETVLEQKVPYNSEIWFSKQFISKVNDYHLWHVLK------KYAKEMFKNIQERNLYKLLHQSQ 1137
            ND ++G I +   +  IIDT +FQRLR I Q G T++V P A+ +RFEHS+G  YLA +L   ++ +   + +L I   +V CV++A LCHDLGHGP SH ++++F P+ +   + KHE  SV++F  LV         + +  + L E++ D I   I G            + +  +K FL++IVANK +G+DVDK DY  RD  +LG  NN   D +R I F RV  V++E T    +  R++E+  + ++F  R+ LHR   +HRV   IE M +    +      IE +  +   +   ++  V Y           +K+ D   + +L       K A+ + +N+  R LYK ++ +Q
Sbjct:   62 NDPIHGHIVMHPLLVRIIDTPQFQRLRNIKQLGGTYWVFPGASHNRFEHSMGVGYLAGQLATAIQSR---QPELGINERDVLCVQIAGLCHDLGHGPFSHMFDNSFIPAARPGCKWKHEVASVQMFDHLVQANGLEEVLSKEYGLKLPEDL-DFIKEQIAGPLADIADSKWPYKGRTKDKGFLYEIVANKSNGIDVDKWDYFARDCHHLGIQNN--FDHRRFIEFVRVCEVENERTKKV-ICFRNKEVGNLYDMFHTRNCLHRRAYQHRVGNIIELMIKEAFLKADKYIKIEGSGGKMFSISGAIDDMVAY-----------TKLTDLIFYEILHSRDPNLKEARVILENVVCRRLYKFVNHTQ 407          
BLAST of Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008964.1 (pep scaffold:Pmarinus_7.0:GL476766:34701:72987:-1 gene:ENSPMAG00000008111.1 transcript:ENSPMAT00000008964.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 154.836 bits (390), Expect = 1.054e-42
Identity = 108/288 (37.50%), Postives = 156/288 (54.17%), Query Frame = 1
Query:  109 MVNDIVYGTITLPEYVKEIIDTQEFQRLRYISQTGLTWYVNPSATCSRFEHSLGTFYLASKLIKQLKDQLESEDKLIITSEEVKCVELAALCHDLGHGPHSHFWEHAFDPSLKIKTR--KHEDVSVEIFRELVDQXXXXXXXXXXXXXGLTEEMIDQICRMITGE-----------FEREKDGE-KKFLFQIVANKDSGLDVDKLDYLCRDSFYLGWSNNKIHDFKRLIYFFRVVKDESTNDWHLAMRDRELFKVNEVFSFRHILHRYGCKHRVVKSIECMFRNGIKQ 930
            M+ND ++G I L + +  I+DT EFQRLR+I Q GL   V PSA  +RFEH +GT +LA +L++ LK+  +  +   IT  +V CVE+A LCHDLGHGP S    HAF+  +K K    KHE  SVE+   L+++           +      +I     ++ G            ++ EK+ + K FLF+IVAN  + +DVDK DY  RD++YLG++    H  +R I   RV   E   D+H+    ++   + E+F  R  LHR   +HRV K IE      IK+
Sbjct:    2 MINDPIHGLIELKKPLLLIVDTPEFQRLRFIKQLGLCHKVYPSAVHTRFEHCIGTSHLAGQLVRHLKECSKEHN---ITDMDVLCVEIAGLCHDLGHGPFS----HAFETVMKKKGIEWKHELKSVEMLCHLIEKNSLQKDLENCGLQ-FPHHLILIASLIVAGPLSSATCKIYFWYKIEKEYKCKMFLFEIVANDLNCIDVDKFDYFARDAYYLGFNTGFEH--QRYIQNARVC--EFHGDFHICQPKKQWSNLLELFHVRERLHRNAYQHRVTKLIEHKVAEAIKE 277          
BLAST of Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008965.1 (pep scaffold:Pmarinus_7.0:GL476766:34734:72987:-1 gene:ENSPMAG00000008111.1 transcript:ENSPMAT00000008965.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 151.754 bits (382), Expect = 1.412e-41
Identity = 109/281 (38.79%), Postives = 152/281 (54.09%), Query Frame = 1
Query:  109 MVNDIVYGTITLPEYVKEIIDTQEFQRLRYISQTGLTWYVNPSATCSRFEHSLGTFYLASKLIKQLKDQLESEDKLIITSEEVKCVELAALCHDLGHGPHSHFWEHAFDPSLKIKTR--KHEDVSVEIFRELVDQXXXXXXXXXXXXXGLT-EEMIDQICRMITGE-------------FEREKDGEKKFLFQIVANKDSGLDVDKLDYLCRDSFYLGWSNNKIHDFKRLIYFFRVVKDESTNDWHLAMRDRELFKVNEVFSFRHILHRYGCKHRVVKSIE 903
            M+ND ++G I L + +  I+DT EFQRLR+I Q GL   V PSA  +RFEH +GT +LA +L++ LK+  +  +   IT  +V CVE+A LCHDLGHGP S    HAF+  +K K    KHE  SVE+   L+++    S +      GL     +  I  +I                 E+E    K FLF+IVAN  + +DVDK DY  RD++YLG++    H  +R I   RV   E   D+H+    ++   + E+F  R  LHR   +HRV K IE
Sbjct:    2 MINDPIHGLIELKKPLLLIVDTPEFQRLRFIKQLGLCHKVYPSAVHTRFEHCIGTSHLAGQLVRHLKECSKEHN---ITDMDVLCVEIAGLCHDLGHGPFS----HAFETVMKKKGIEWKHELKSVEMLCHLIEK---NSLQKDLENCGLQFPHHLILIASLIVAPKAGPLSSATEWLYIEKEYKC-KMFLFEIVANDLNCIDVDKFDYFARDAYYLGFNTGFEH--QRYIQNARVC--EFHGDFHICQPKKQWSNLLELFHVRERLHRNAYQHRVTKLIE 267          
BLAST of Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008967.1 (pep scaffold:Pmarinus_7.0:GL476766:55761:72987:-1 gene:ENSPMAG00000008111.1 transcript:ENSPMAT00000008967.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 127.102 bits (318), Expect = 2.693e-34
Identity = 81/198 (40.91%), Postives = 112/198 (56.57%), Query Frame = 1
Query:  109 MVNDIVYGTITLPEYVKEIIDTQEFQRLRYISQTGLTWYVNPSATCSRFEHSLGTFYLASKLIKQLKDQLESEDKLIITSEEVKCVELAALCHDLGHGPHSHFWEHAFDPSLKIKTR--KHEDVSVEIFRELVDQXXXXXXXXXXXXXGLTEEMIDQICRMITGEFEREKDGEKKFLFQIVANKDSGLDVDKLDYLCR 696
            M+ND ++G I L + +  I+DT EFQRLR+I Q GL   V PSA  +RFEH +GT +LA +L++ LK+  +  +   IT  +V CVE+A LCHDLGHGP S    HAF+  +K K    KHE  SVE+   L+++            I         +  +I  E++      K FLF+IVAN  + +DVDK DY  R
Sbjct:    2 MINDPIHGLIELKKPLLLIVDTPEFQRLRFIKQLGLCHKVYPSAVHTRFEHCIGTSHLAGQLVRHLKECSKEHN---ITDMDVLCVEIAGLCHDLGHGPFS----HAFETVMKKKGIEWKHELKSVEMLCHLIEKNSLQKDLENLKTITFLLLSKTTLTEIIEKEYKC-----KMFLFEIVANDLNCIDVDKFDYFAR 187          
BLAST of Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 vs. Ensembl Nematostella
Match: EDO35454 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLH4])

HSP 1 Score: 164.081 bits (414), Expect = 1.513e-44
Identity = 128/440 (29.09%), Postives = 212/440 (48.18%), Query Frame = 1
Query:  100 LETMVNDIVYGTITLPEYVKEIIDTQEFQRLRYISQTGLTWYVNPSATCSRFEHSLGTFYLASKLIKQLKDQLESEDKLIITSEEVKCVELAALCHDLGHGPHSHFWEHAFDPSLKIKTR-KHEDVSVEIFRELVDQXXXXXXXXXXXXXGLTEEMIDQICRMITGEFERE------------KDGEKKFLFQIVANKDSGLDVDKLDYLCRDSFYLGWSNNKIHDFKRLIYFFRVVKDESTNDWHLAMRDRELFKVNEVFSFRHILHRYGCKHRVVKSIECMFRNGIKQVIENTVARDEFLETVLEQKVPYNSEIWFSKQFISKVNDYHLWHVLK------KYAKEMFKNIQERNLYKLLHQSQIQITSGNNFDSLDNDISDLQTFLQRTSGH---SNXXXXXXXXXXQTENKGDPLMLMKFYSKENPNKSFNYDKDSL 1353
            L  + ND ++G I +     +IIDT +FQRLR + Q G  ++V P A  +RFEHS+GT +LA  L+K ++   + +  L IT  +V CV++A LCHDLGHGP SH ++  F P+ +     KHE  SV++F  LVD              GL+++ ++ I  +I G    E            +  EK +L++IVANK +G+DVDK DY  RD   LG  N+   D KR +   RV+K        + +RD+E   + ++F  R  L +   +H+    IE M      +      A    L      K+   SE         K++D+  + +L       + A+ + + I++R+LYK + Q+ ++         +  +I D         G    S+  +   I         +P+  ++FY+K+N +++F + K+ +
Sbjct:   69 LTMLFNDPIHGHIDVHPLCVKIIDTPQFQRLRNLKQLGGCYFVFPGAAHNRFEHSIGTSHLAGGLLKSIR---KRQPGLGITDVDVLCVKIAGLCHDLGHGPFSHMFDAGFIPAARPGCDWKHEQASVDMFNYLVDD---NKLLEEFRRYGLSDKDMEFIQELIAGPRNMETPLKTQDWPYTGRSIEKSYLYEIVANKRTGIDVDKWDYFARDCHNLGIRNS--FDHKRFMKLARVIK--VGKRQQICIRDKEAGNIYDMFHTRTSLFKRAYQHKTANIIETMITEAFLK------ADKHLLFPGKNGKMLKMSEAIDDMVAYCKLSDHVFYQILHSTDPQLQEARRILQCIEKRDLYKCVGQTIMKQRRDKEIPDIRKEIIDAIPPDILAVGRAIDSDDVIIHLISFDYGMKDRNPIDELRFYTKDNLSEAFVFRKEQV 492          
BLAST of Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 vs. Ensembl Nematostella
Match: EDO35455 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLH5])

HSP 1 Score: 166.392 bits (420), Expect = 1.767e-44
Identity = 116/359 (32.31%), Postives = 184/359 (51.25%), Query Frame = 1
Query:  115 NDIVYGTITLPEYVKEIIDTQEFQRLRYISQTGLTWYVNPSATCSRFEHSLGTFYLASKLIKQLKDQLESEDKLIITSEEVKCVELAALCHDLGHGPHSHFWEHAFDPSLKIKTR-KHEDVSVEIFRELVDQXXXXXXXXXXXXXGLTEEMIDQICRMITGEFERE------------KDGEKKFLFQIVANKDSGLDVDKLDYLCRDSFYLGWSNNKIHDFKRLIYFFRVVKDESTNDWHLAMRDRELFKVNEVFSFRHILHRYGCKHRVVKSIECMFRNGIKQVIENTVARDEFLETVLEQKVPYNSEIWFSKQFISKVNDYHLWHVLK------KYAKEMFKNIQERNLYKLLHQS 1134
            ND ++G I +     +IIDT +FQRLR + Q G  ++V P A  +RFEHS+GT +LA +L++ +++Q   + +L IT  +V CV++A LCHDLGHGP SH ++  F P+ +     KHE  SV++F  LVD              GL+++ ++ I  +I G    E            +  EK +L++IVANK +G+DVDK DY  RD   LG  N+   D KR +   RV+K        + +RD+E   + ++F  R  L +   +H+    IE M      +      A    L      K+   SE         K++D+  + +L       + A+E+ + I++R+LYK + Q+
Sbjct:  125 NDPIHGHIDVHPLCVKIIDTPQFQRLRNLKQLGGCYFVFPGAAHNRFEHSIGTSHLAGELLESIREQ---QPELGITYVDVLCVKIAGLCHDLGHGPFSHMFDAGFIPAARPGCDWKHEQASVDMFNYLVDD---NKLSEEFRRYGLSDKDMEFIQELIAGPRNMETPLKTQDWPYTGRSVEKSYLYEIVANKRTGIDVDKWDYFARDCHNLGIRNS--FDHKRFMKLARVIK--VGKRQQICIRDKEAGNIYDMFHTRTSLFKRAYQHKTANIIETMITEAFLK------ADKHLLFPGKNGKMLKMSEAIDDMVAYCKLSDHVFYQILHSTDPQLQKAREILQCIEKRDLYKCVGQT 467          
BLAST of Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 vs. Ensembl Nematostella
Match: EDO26257 (pep supercontig:ASM20922v1:NEMVEscaffold_7765:3208:3433:-1 gene:NEMVEDRAFT_v1g154803 transcript:EDO26257 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 51.6026 bits (122), Expect = 6.617e-9
Identity = 24/52 (46.15%), Postives = 34/52 (65.38%), Query Frame = 1
Query:  115 NDIVYGTITLPEYVKEIIDTQEFQRLRYISQTGLTWYVNPSATCSRFEHSLG 270
            ND ++G I +     +IIDT +FQRLR + Q G  ++V P A  +RFEHS+G
Sbjct:    4 NDPIHGHIDVHPLCVKIIDTPQFQRLRNLKQLGGCYFVFPGAAHNRFEHSIG 55          
BLAST of Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 vs. Ensembl Medaka
Match: samhd1 (SAM and HD domain containing deoxynucleoside triphosphate triphosphohydrolase 1 [Source:NCBI gene;Acc:101159989])

HSP 1 Score: 197.978 bits (502), Expect = 2.272e-55
Identity = 149/475 (31.37%), Postives = 237/475 (49.89%), Query Frame = 1
Query:  115 NDIVYGTITLPEYVKEIIDTQEFQRLRYISQTGLTWYVNPSATCSRFEHSLGTFYLASKLIKQLKDQLESEDKLIITSEEVKCVELAALCHDLGHGPHSHFWEHAFDPSLKIKTR-KHEDVSVEIFRELVDQXXXXXXXXXXXXXGLT-EEMIDQICRMITGEFEREKDGE----------KKFLFQIVANKDSGLDVDKLDYLCRDSFYLGWSNNKIHDFKRLIYFFRVVKDESTNDWHLAMRDRELFKVNEVFSFRHILHRYGCKHRVVKSIECMFRNGIKQV-----IENTVARDEFLETVLEQKVPYNSEIWFSKQFISKVNDYHLWHVLK------KYAKEMFKNIQERNLYKLLHQSQIQIT---SGNNFDSLDNDISDLQTFLQRTSGHSNXXXXXXXXXXQTENKG----DPLMLMKFYSKENPNKSFNYDKDSLPNSLSLKEDEIILMVFVERRIFDELEGVLEVF 1449
            ND ++G + L   + +IIDT +FQRLR I Q G T++V P A+ +RFEHS+G  YLA +L++ L    E + +L+I   ++ CV++A LCHDLGHGP SH ++  F P    +   KHE  S+++F  LV+       + +    GL   E +D I   I G    +  G+          K FL++IVANK +G+DVDK DY  RD ++LG  NN   D++R + F RV   E     H+  RD+E+  + ++F  R+ LHR   +H+V   IE M      +      IE T  +   L T ++  V Y           +K+ DY    +L       + A+E+  NI  R LYK L Q+Q   T   S       + ++S  ++  Q +S   ++     I ++   + G    +P+  ++FY K +PNK+    K+ +   L     E ++ V+ ++   + LE   + F
Sbjct:  111 NDPIHGHVELHPLLIKIIDTPQFQRLRNIKQLGGTYFVFPGASHNRFEHSIGVGYLAGQLVQALN---ERQPELLICHRDILCVQIAGLCHDLGHGPFSHMFDGMFIPKACPQVNWKHETASLDMFDHLVES---NGLKVVMEEHGLVLPEDLDFIKEQIAGPLSTQTPGQKWPYKGRPEDKSFLYEIVANKRNGIDVDKWDYFARDCYHLGIQNN--FDYQRFLKFARVC--EVDGQKHICTRDKEVGNLYDMFHTRNCLHRRAYQHKVCNIIETMITEAFLKADPYIQIEGTEGKMFTLSTAIDDMVAY-----------TKLTDYVFEQILNSSSSELREAREILHNIVCRRLYKCLGQTQPDQTVTVSQETIKIWEQELS--ESTPQNSSSAVSLQPQDFIVNVIVMDYGMKEKNPINNVRFYCKNDPNKAIQIRKNQVSKLLPEHFAEQLIRVYFKKTDNESLEAAKKHF 562          
BLAST of Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 vs. Ensembl Medaka
Match: samhd1 (SAM and HD domain containing deoxynucleoside triphosphate triphosphohydrolase 1 [Source:NCBI gene;Acc:101159989])

HSP 1 Score: 196.823 bits (499), Expect = 2.675e-55
Identity = 150/481 (31.19%), Postives = 232/481 (48.23%), Query Frame = 1
Query:  115 NDIVYGTITLPEYVKEIIDTQEFQRLRYISQTGLTWYVNPSATCSRFEHSLGTFYLASKLIKQLKDQLESEDKLIITSEEVKCVELAALCHDLGHGPHSHFWEHAFDPSLKIKTR-KHEDVSVEIFRELVDQXXXXXXXXXXXXXGLT-EEMIDQICRMITGEFEREKDGE----------KKFLFQIVANKDSGLDVDKLDYLCRDSFYLGWSNNKIHDFKRLIYFFRVVKDESTNDWHLAMRDRELFKVNEVFSFRHILHRYGCKHRVVKSIECMFRNGIKQV-----IENTVARDEFLETVLEQKVPYNSEIWFSKQFISKVNDYHLWHVLK------KYAKEMFKNIQERNLYKLLHQSQIQITSGNNFDSLDNDISDLQTFLQRTSGHSNXXXXXXXXXXQTEN-------------KGDPLMLMKFYSKENPNKSFNYDKDSLPNSLSLKEDEIILMVFVERRIFDELEGVLEVF 1449
            ND ++G + L   + +IIDT +FQRLR I Q G T++V P A+ +RFEHS+G  YLA +L++ L    E + +L+I   ++ CV++A LCHDLGHGP SH ++  F P    +   KHE  S+++F  LV+       + +    GL   E +D I   I G    +  G+          K FL++IVANK +G+DVDK DY  RD ++LG  NN   D++R + F RV   E     H+  RD+E+  + ++F  R+ LHR   +H+V   IE M      +      IE T  +   L T ++  V Y           +K+ DY    +L       + A+E+  NI  R LYK L Q+Q                   QT  ++    S    S S  SLQ ++             + +P+  ++FY K +PNK+    K+ +   L     E ++ V+ ++   + LE   + F
Sbjct:   82 NDPIHGHVELHPLLIKIIDTPQFQRLRNIKQLGGTYFVFPGASHNRFEHSIGVGYLAGQLVQALN---ERQPELLICHRDILCVQIAGLCHDLGHGPFSHMFDGMFIPKACPQVNWKHETASLDMFDHLVES---NGLKVVMEEHGLVLPEDLDFIKEQIAGPLSTQTPGQKWPYKGRPEDKSFLYEIVANKRNGIDVDKWDYFARDCYHLGIQNN--FDYQRFLKFARVC--EVDGQKHICTRDKEVGNLYDMFHTRNCLHRRAYQHKVCNIIETMITEAFLKADPYIQIEGTEGKMFTLSTAIDDMVAY-----------TKLTDYVFEQILNSSSSELREAREILHNIVCRRLYKCLGQTQPD-----------------QTIWEQELSESTPQNSSSAVSLQPQDFIVNVIVMDYGMKEKNPINNVRFYCKNDPNKAIQIRKNQVSKLLPEHFAEQLIRVYFKKTDNESLEAAKKHF 524          
BLAST of Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 vs. Ensembl Medaka
Match: ENSORLT00000044675.1 (deoxynucleoside triphosphate triphosphohydrolase SAMHD1-like [Source:NCBI gene;Acc:101162528])

HSP 1 Score: 75.8702 bits (185), Expect = 2.615e-14
Identity = 63/198 (31.82%), Postives = 99/198 (50.00%), Query Frame = 1
Query:  403 PHSHFWEHAFDPSLKIKTR-------KHEDVSVEIFRELVDQXXXXXXXXXXXXXGLTEEMIDQICRMITGEFEREKD--------------GE-KKFLFQIVANKDSGLDVDKLDYLCRDSFYLGWSNNKIHDFKRLIYFFRVVKDEST--NDWHLAMRDRELFKVNEVFSFRHILHRYGCKHRVVKSIECMFRNGI 924
            P +H  +   D   K++ R       +HED SVE+F+ L+++ +   TE   +   L +  +  I  +I GE  ++K               GE K FL++IV+NK +G+DVDK DY  RD  +LG  NN   D  R   F RV+  E       H+  RD+E   + ++F  R  LHR   +H+V K++E M ++ +
Sbjct:    4 PQAHDEDDEDDKERKVQARNKDDKEWRHEDASVEMFQYLLEKNRELLTEMKNSR--LEDNDLVFIKELILGEPLKKKSDKPEDPSDWPYEGRGEDKSFLYEIVSNKQNGIDVDKFDYFARDCHHLGLKNN--FDHMRYFKFTRVIGVEKNKLKRKHICSRDKEAGNLYDLFYTRDRLHRRAYQHKVTKNVEIMIKDAL 197          
BLAST of Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 vs. Planmine SMEST
Match: SMESG000079627.1 (SMESG000079627.1)

HSP 1 Score: 930.628 bits (2404), Expect = 0.000e+0
Identity = 475/481 (98.75%), Postives = 478/481 (99.38%), Query Frame = 1
Query:   97 CLETMVNDIVYGTITLPEYVKEIIDTQEFQRLRYISQTGLTWYVNPSATCSRFEHSLGTFYLASKLIKQLKDQLESEDKLIITSEEVKCVELAALCHDLGHGPHSHFWEHAFDPSLKIKTRKHEDVSVEIFRELVDQXXXXXXXXXXXXXGLTEEMIDQICRMITGEFEREKDGEKKFLFQIVANKDSGLDVDKLDYLCRDSFYLGWSNNKIHDFKRLIYFFRVVKDESTNDWHLAMRDRELFKVNEVFSFRHILHRYGCKHRVVKSIECMFRNGIKQVIENTVARDEFLETVLEQKVPYNSEIWFSKQFISKVNDYHLWHVLKKYAKEMFKNIQERNLYKLLHQSQIQITSGNNFDSLDNDISDLQTFLQRTSGHSNXXXXXXXXXXQTENKGDPLMLMKFYSKENPNKSFNYDKDSLPNSLSLKEDEIILMVFVERRIFDELEGVLEVFRSLESKSYNSQEDFIMSNLQTKYLFKEIKY 1539
            CLETMVNDIVYGTITLPEYVKEIIDTQEFQRLRYISQTGLTWYVNPSATCSRFEHSLGTFYLASKLIKQLKDQLE EDKLIITSEEVKCVELAALCHDLGHGPHSHFWEHAFDPSLKIKTRKHEDVSVEIFRELVDQKKSTSTETIKTIIGLTEEMIDQICRMITGE+EREKDGEKKFLFQIVANKDSGLDVDKLDYLCRDSFYLGWSNNKIHDFKRLIYFFRVVKDEST DWHLAMRDRELFKVNEVFSFRHILHRYGCKHRVVKSIECMFRNGIKQVIENTVARDEFLETVLEQKVPYNS+IWFSKQFISKVNDYHLWHVLKKYAKEMFKNIQERNLYKLLHQSQIQITSGNNFDSLDNDISDLQTFLQRTSGHSNIYLSLSIYSLQTENKGDPLMLMKFYSKENPNKSF+YDKDSLPNSLSLKEDEIILMVFVERRIFDELEGVLEVFRSLESKSYNSQEDFIM NLQTKYLFKEIKY
Sbjct:    4 CLETMVNDIVYGTITLPEYVKEIIDTQEFQRLRYISQTGLTWYVNPSATCSRFEHSLGTFYLASKLIKQLKDQLEGEDKLIITSEEVKCVELAALCHDLGHGPHSHFWEHAFDPSLKIKTRKHEDVSVEIFRELVDQKKSTSTETIKTIIGLTEEMIDQICRMITGEYEREKDGEKKFLFQIVANKDSGLDVDKLDYLCRDSFYLGWSNNKIHDFKRLIYFFRVVKDESTKDWHLAMRDRELFKVNEVFSFRHILHRYGCKHRVVKSIECMFRNGIKQVIENTVARDEFLETVLEQKVPYNSDIWFSKQFISKVNDYHLWHVLKKYAKEMFKNIQERNLYKLLHQSQIQITSGNNFDSLDNDISDLQTFLQRTSGHSNIYLSLSIYSLQTENKGDPLMLMKFYSKENPNKSFDYDKDSLPNSLSLKEDEIILMVFVERRIFDELEGVLEVFRSLESKSYNSQEDFIMRNLQTKYLFKEIKY 484          
BLAST of Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 vs. Planmine SMEST
Match: SMESG000079633.1 (SMESG000079633.1)

HSP 1 Score: 904.434 bits (2336), Expect = 0.000e+0
Identity = 463/477 (97.06%), Postives = 471/477 (98.74%), Query Frame = 1
Query:  109 MVNDIVYGTITLPEYVKEIIDTQEFQRLRYISQTGLTWYVNPSATCSRFEHSLGTFYLASKLIKQLKDQLESEDKLIITSEEVKCVELAALCHDLGHGPHSHFWEHAFDPSLKIKTRKHEDVSVEIFRELVDQXXXXXXXXXXXXXGLTEEMIDQICRMITGEFEREKDGEKKFLFQIVANKDSGLDVDKLDYLCRDSFYLGWSNNKIHDFKRLIYFFRVVKDESTNDWHLAMRDRELFKVNEVFSFRHILHRYGCKHRVVKSIECMFRNGIKQVIENTVARDEFLETVLEQKVPYNSEIWFSKQFISKVNDYHLWHVLKKYAKEMFKNIQERNLYKLLHQSQIQITSGNNFDSLDNDISDLQTFLQRTSGHSNXXXXXXXXXXQTENKGDPLMLMKFYSKENPNKSFNYDKDSLPNSLSLKEDEIILMVFVERRIFDELEGVLEVFRSLESKSYNSQEDFIMSNLQTKYLFKEIKY 1539
            M+NDIV+GTITLPEYVK IIDT+EFQRLRYISQ GLT ++ PSATCSRFEHSLGTFYLASKLIKQLKDQLESEDKLIITSEEVKCVELAALCHDLGHGPHSHFWEHAFDPSLKIKTRKHEDVSVEIFRELVDQKKSTSTETIKTIIGLTEEMIDQICRMITGE+EREKDGEKKFLFQIVANKDSGLDVDKLDYLCRDSFYLGWSNNKIHDFKRLIYFFRVVKDEST DWHLAMRDRELFKVNEVFSFRHILHRYGC+HRVVKSIECMFRNGIKQVIENTVARDEFLETVLEQKVPYNS+IWFSKQFISKVNDYHLWHVLKKYAKEMFKNIQERNLYKLLHQSQIQITSGNNFDSLDNDISDLQTFLQRTSGHSNIYLSLSIYSLQTENKGDPLMLMKFYSKENPNKSFNYDKDSLPNSLSLKEDEIILMVFVERRIFDELEGVLEVFRSLESKSYNSQEDFIM NLQTKYLFKEIKY
Sbjct:    1 MINDIVHGTITLPEYVKVIIDTEEFQRLRYISQIGLTRHIYPSATCSRFEHSLGTFYLASKLIKQLKDQLESEDKLIITSEEVKCVELAALCHDLGHGPHSHFWEHAFDPSLKIKTRKHEDVSVEIFRELVDQKKSTSTETIKTIIGLTEEMIDQICRMITGEYEREKDGEKKFLFQIVANKDSGLDVDKLDYLCRDSFYLGWSNNKIHDFKRLIYFFRVVKDESTKDWHLAMRDRELFKVNEVFSFRHILHRYGCQHRVVKSIECMFRNGIKQVIENTVARDEFLETVLEQKVPYNSDIWFSKQFISKVNDYHLWHVLKKYAKEMFKNIQERNLYKLLHQSQIQITSGNNFDSLDNDISDLQTFLQRTSGHSNIYLSLSIYSLQTENKGDPLMLMKFYSKENPNKSFNYDKDSLPNSLSLKEDEIILMVFVERRIFDELEGVLEVFRSLESKSYNSQEDFIMRNLQTKYLFKEIKY 477          
BLAST of Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 vs. Planmine SMEST
Match: SMESG000079667.1 (SMESG000079667.1)

HSP 1 Score: 453.751 bits (1166), Expect = 1.816e-155
Identity = 246/475 (51.79%), Postives = 337/475 (70.95%), Query Frame = 1
Query:  106 TMVNDIVYGTITLPEYVKEIIDTQEFQRLRYISQTGLTWYVNPSATCSRFEHSLGTFYLASKLIKQLKDQLESEDKLIITSEEVKCVELAALCHDLGHGPHSHFWEHAFDPSLKIKTRKHEDVSVEIFRELVDQXXXXXXXXXXXXXGLTEEMIDQICRMITGEFEREKDGEKKFLFQIVANKDSGLDVDKLDYLCRDSFYLGWSN-NKIHDFKRLIYFFRVVKDESTNDWHLAMRDRELFKVNEVFSFRHILHRYGCKHRVVKSIECMFRNGIKQVIENTVARDEFLETVLEQKVPYNSEIWFSKQFISKVNDYHLWHVLKKYAKEMFKNIQERNLYKLLHQSQIQITSGNNFDSLDNDISDLQTFLQRTSGHSNXXXXXXXXXXQTENKGDPLMLMKFYSKENPNKSFNYDKDSLPNSLSLKEDEIILMVFVERRIFDELEGVLEVFRSLESKSYNSQEDFIMSNLQTKYLFK 1527
            T VNDIV+G I LP Y+KEIID+ +FQRLR+I Q G  ++V  SA  SRFEHS+GTF+LAS+LIKQLK+Q + + ++ I+ E+VKCVE+AALCHDLGHGP+SHFWEHAFD    I+ RKHED+SVEIF  L++  KS  T+ IK  IGL +  ID I R+I G F++E D ++ FLF+IVANK SGLDVDK DYLCRDS Y GWSN NKIHD KR+++F R+ K   ++ WHLAMRDRE+F +++VF +RH+LHRYG +H+ VK IECMF + +  ++ N  AR+E +ETV+  KV Y+ +IWFS +FISKV DYH+W+++ KY   + + IQER LYK+    QIQI    NF      I DLQ    +      I   +S ++LQ+EN+G+PL+ + FY+K+NP K  NY+++SLP+ + LK DEI+LM+F E     E E +L   R+L++   +++    +  L+ KY+F+
Sbjct:   14 TFVNDIVHGIIKLPVYIKEIIDSPQFQRLRHIRQLGFGYFVYSSAGYSRFEHSIGTFHLASELIKQLKNQTDQDKEIEISDEDVKCVEIAALCHDLGHGPYSHFWEHAFDNE-TIEPRKHEDLSVEIFSMLLEHIKSDETQKIKDKIGLKKNTIDLIKRIILGNFDKEIDKKRMFLFEIVANKCSGLDVDKFDYLCRDSIYFGWSNKNKIHDIKRILHFLRIAK--KSDMWHLAMRDREIFHIHDVFYYRHLLHRYGYQHKTVKIIECMFNDALNDIVHNEDARNELIETVIGPKV-YDPKIWFSSEFISKVCDYHIWNIMSKYTSGIVERIQERKLYKIF--DQIQIELNPNFQGQKGHI-DLQEIKSKLKDFP-IKFVISSFALQSENRGNPLLSVNFYTKQNPLKCTNYEEESLPDLVKLKGDEIVLMIFTETIPNKETERML---RTLKANLCSNE----IEGLREKYIFR 473          
BLAST of Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 vs. Planmine SMEST
Match: SMESG000079583.1 (SMESG000079583.1)

HSP 1 Score: 446.432 bits (1147), Expect = 1.279e-152
Identity = 245/480 (51.04%), Postives = 327/480 (68.12%), Query Frame = 1
Query:  103 ETMVNDIVYGTITLPEYVKEIIDTQEFQRLRYISQTGLTWYVNPSATCSRFEHSLGTFYLASKLIKQLKDQLESEDKLIITSEEVKCVELAALCHDLGHGPHSHFWEHAFDPSLKIKTRKHEDVSVEIFRELVDQXXXXXXXXXXXXXGLTEEMIDQICRMITGEFEREKDGEKKFLFQIVANKDSGLDVDKLDYLCRDSFYLGWSN-NKIHDFKRLIYFFRVVKDESTNDWHLAMRDRELFKVNEVFSFRHILHRYGCKHRVVKSIECMFRNGIKQVIENTVARDEFLETVLEQKVPYNSEIWFSKQFISKVNDYHLWHVLKKYAKEMFKNIQERNLYKLLHQSQIQITSGNNFDSLDNDISDLQTFLQRTSGHSNXXXXXXXXXXQTENKGDPLMLMKFYSKENPNKSFNYDKDSLPNSLSLKEDEIILMVFVERRIFDELEGVLEVFRSLESKSYNSQEDFIMSNLQTKYLFKEIKY 1539
            ++ VNDIV+G I LPEY+KEIIDT +FQRLR+I Q G  + V P+A  SRFEHS+GTF+LAS+LIKQLK Q+  E   +I+ +EVKCVE+AALCHDLGHGP SH WEHAFD S  I+ RKHED+SVE+F  L+  KK+   + IK  I L  EMI+ I ++I G +   KD EK F F+IVANK SGLDVDK DYLCRDS YLGWSN NKIHD KR+++  R+ K   T  WHLAMRDRE+F +++VF +RH+LHRY  +H+ VK IECMF+  +  ++ N  AR+E +ETV+  KV Y+ +IWFS  FISKV DYH+W+++ KY   + + IQER LYK+    QIQI    NF   +  I DLQ    +    S I    S +S+ +ENKG+PL+ + FYSKENP++ FNY  D+LP+ + L E+E +L +  E +  +E +  L   ++L     N +    +++L+ KY FK + Y
Sbjct:    9 DSFVNDIVHGIIKLPEYIKEIIDTPQFQRLRHIRQLGFGYLVYPTAGYSRFEHSIGTFHLASELIKQLKSQINKEKVDMISDDEVKCVEIAALCHDLGHGPFSHVWEHAFD-SQTIQPRKHEDLSVEMFLRLLYHKKTGEIKNIKEKIKLNTEMINFIEKLILGTY--NKDEEKMFFFEIVANKTSGLDVDKFDYLCRDSIYLGWSNKNKIHDIKRILHLLRIAKKSDTGKWHLAMRDREIFHIHDVFYYRHLLHRYAYQHKTVKVIECMFKAALNDIVHNEDARNELIETVIGPKV-YDPKIWFSSDFISKVCDYHIWNIMSKYTSGIVEKIQERKLYKIF--DQIQIKLDPNFQGQNGHI-DLQEIKSKLKDFS-IKSVCSSFSVGSENKGNPLLSVNFYSKENPSECFNYTDDNLPDLVKLVENETVLTILTETKPDEETKKQL---KTLMDNLINRK----IASLREKYTFKRMLY 473          
BLAST of Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 vs. Planmine SMEST
Match: SMESG000079585.1 (SMESG000079585.1)

HSP 1 Score: 396.741 bits (1018), Expect = 7.588e-134
Identity = 221/447 (49.44%), Postives = 297/447 (66.44%), Query Frame = 1
Query:  211 GLTWYVNPSATCSRFEHSLGTFYLASKLIKQLKDQLESEDKLIITSEEVKCVELAALCHDLGHGPHSHFWEHAFDPSLKIKTRKHEDVSVEIFRELVDQXXXXXXXXXXXXXGLTEEMIDQICRMITGEFEREKDGEKKFLFQIVANKDSGLDVDKLDYLCRDSFYLGWSN-NKIHDFKRLIYFFRVVKDESTNDWHLAMRDRELFKVNEVFSFRHILHRYGCKHRVVKSIECMFRNGIKQVIENTVARDEFLETVLEQKVPYNSEIWFSKQFISKVNDYHLWHVLKKYAKEMFKNIQERNLYKLLHQSQIQITSGNNFDSLDNDISDLQTFLQRTSGHSNXXXXXXXXXXQTENKGDPLMLMKFYSKENPNKSFNYDKDSLPNSLSLKEDEIILMVFVERRIFDELEGVLEVFRSLESKSYNSQEDFI---MSNLQTKYLFKEIKY 1539
            G  + V P+A  SRFEHS+GTF+LAS+LIKQLK Q+  E   +I+ +EVKCVE+AALCHDLGHGP SH WEHAFD S  I +RKHED+SVE+F  L+  KK+   + IK  I L  EMI+ I ++I G +   KD EK F F+IVANK SGLDVDK DYLCRDS YLGWSN NKIHD KR+++  R+ K   T  WHLAMRDRE+F +++VF +RH+LHRY  +H+ VK IECMF+  +  ++ N  AR+E +ETV+  KV Y+ +IWFS +FISKV DYH+W+++ KY   + + IQER LYK+    QIQI    NF   +  I DLQ    +    S I    S +S+ +ENKG+PL+ + FYSKENP++ FNY  D+LP+ + L E+E +L +  E +  +E +  L+             +D I   +++L+ KY FK + Y
Sbjct:    2 GFGYLVYPTAGYSRFEHSIGTFHLASELIKQLKSQINKEKVDMISDDEVKCVEIAALCHDLGHGPFSHVWEHAFD-SQTIPSRKHEDLSVEMFLRLLYHKKTGEIKNIKEKIKLNTEMINFIEKLILGTYN--KDEEKMFFFEIVANKTSGLDVDKFDYLCRDSIYLGWSNKNKIHDIKRILHLLRIAKKSDTGKWHLAMRDREIFHIHDVFYYRHLLHRYAYQHKTVKVIECMFKAALNDIVHNEDARNELIETVIGPKV-YDPKIWFSSEFISKVCDYHIWNIMSKYTSGIVEKIQERKLYKIF--DQIQIKLDPNFQGQNGHI-DLQEIKSKLKDFS-IKSVCSSFSVGSENKGNPLLSVNFYSKENPSECFNYTDDNLPDLVKLVENETVLTILTETKPNEETKKQLKTL----------MDDLINRKIASLREKYTFKRMLY 430          
The following BLAST results are available for this feature:
BLAST of Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SAMHD11.538e-5131.07SAM and HD domain containing deoxynucleoside triph... [more]
SAMHD13.045e-5131.07SAM and HD domain containing deoxynucleoside triph... [more]
SAMHD13.045e-5131.07SAM and HD domain containing deoxynucleoside triph... [more]
SAMHD17.457e-5034.63SAM and HD domain containing deoxynucleoside triph... [more]
SAMHD11.175e-4838.71SAM and HD domain containing deoxynucleoside triph... [more]
back to top
BLAST of Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ZK177.81.341e-3533.22pep chromosome:WBcel235:II:5509032:5513775:-1 gene... [more]
ZK177.81.341e-3533.22pep chromosome:WBcel235:II:5509028:5511208:-1 gene... [more]
ZK177.82.562e-3533.22pep chromosome:WBcel235:II:5509032:5513748:-1 gene... [more]
back to top
BLAST of Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
fal4.073e-2227.11gene:FBgn0028380 transcript:FBtr0347258[more]
fal4.073e-2227.11gene:FBgn0028380 transcript:FBtr0290284[more]
fal4.073e-2227.11gene:FBgn0028380 transcript:FBtr0321324[more]
back to top
BLAST of Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
samhd15.379e-5231.16SAM domain and HD domain 1 [Source:NCBI gene;Acc:5... [more]
si:ch73-236c18.97.411e-4738.14si:ch73-236c18.9 [Source:ZFIN;Acc:ZDB-GENE-121214-... [more]
si:ch73-236c18.81.282e-4530.39si:ch73-236c18.8 [Source:ZFIN;Acc:ZDB-GENE-121214-... [more]
back to top
BLAST of Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SAMHD12.064e-5631.56SAM domain and HD domain 1 [Source:NCBI gene;Acc:1... [more]
SAMHD13.577e-5631.34SAM domain and HD domain 1 [Source:NCBI gene;Acc:1... [more]
SAMHD11.762e-5531.71SAM domain and HD domain 1 [Source:NCBI gene;Acc:1... [more]
SAMHD13.260e-5531.04SAM domain and HD domain 1 [Source:NCBI gene;Acc:1... [more]
SAMHD15.369e-5530.98SAM domain and HD domain 1 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Samhd12.500e-4832.89SAM domain and HD domain, 1 [Source:MGI Symbol;Acc... [more]
Samhd16.790e-4832.89SAM domain and HD domain, 1 [Source:MGI Symbol;Acc... [more]
Samhd17.212e-4832.89SAM domain and HD domain, 1 [Source:MGI Symbol;Acc... [more]
Samhd18.479e-4832.89SAM domain and HD domain, 1 [Source:MGI Symbol;Acc... [more]
back to top
BLAST of Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5ZJL9|SAMH1_CHICK4.573e-5732.68Deoxynucleoside triphosphate triphosphohydrolase S... [more]
sp|Q6INN8|SAMH1_XENLA6.069e-5631.92Deoxynucleoside triphosphate triphosphohydrolase S... [more]
sp|Q0VCA5|SAMH1_BOVIN2.836e-5233.42Deoxynucleoside triphosphate triphosphohydrolase S... [more]
sp|B0G107|SAMH1_DICDI9.577e-5231.53Deoxynucleoside triphosphate triphosphohydrolase S... [more]
sp|Q502K2|SAMH1_DANRE4.400e-5131.16Deoxynucleoside triphosphate triphosphohydrolase S... [more]
back to top
BLAST of Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2Y9DAI22.322e-5732.90deoxynucleoside triphosphate triphosphohydrolase S... [more]
G3SPI67.881e-5733.55SAM and HD domain containing deoxynucleoside triph... [more]
A0A2G8KQQ44.319e-5532.52Putative deoxynucleoside triphosphate triphosphohy... [more]
A0A1S3JH282.463e-5432.33deoxynucleoside triphosphate triphosphohydrolase S... [more]
G1MQP93.754e-5432.98SAM and HD domain containing deoxynucleoside triph... [more]
back to top
BLAST of Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000032130.13.497e-5532.44deoxynucleoside triphosphate triphosphohydrolase S... [more]
ENSAMXT00000041115.11.605e-5441.43deoxynucleoside triphosphate triphosphohydrolase S... [more]
ENSAMXT00000057570.12.261e-5031.05deoxynucleoside triphosphate triphosphohydrolase S... [more]
ENSAMXT00000045292.11.624e-4628.90pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000040847.11.624e-4628.90pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
samhd11.412e-5033.24SAM domain and HD domain 1 [Source:NCBI gene;Acc:5... [more]
ENSPMAT00000008964.11.054e-4237.50pep scaffold:Pmarinus_7.0:GL476766:34701:72987:-1 ... [more]
ENSPMAT00000008965.11.412e-4138.79pep scaffold:Pmarinus_7.0:GL476766:34734:72987:-1 ... [more]
ENSPMAT00000008967.12.693e-3440.91pep scaffold:Pmarinus_7.0:GL476766:55761:72987:-1 ... [more]
back to top
BLAST of Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO354541.513e-4429.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO354551.767e-4432.31Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO262576.617e-946.15pep supercontig:ASM20922v1:NEMVEscaffold_7765:3208... [more]
back to top
BLAST of Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
samhd12.272e-5531.37SAM and HD domain containing deoxynucleoside triph... [more]
samhd12.675e-5531.19SAM and HD domain containing deoxynucleoside triph... [more]
ENSORLT00000044675.12.615e-1431.82deoxynucleoside triphosphate triphosphohydrolase S... [more]
back to top
BLAST of Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000079627.10.000e+098.75SMESG000079627.1[more]
SMESG000079633.10.000e+097.06SMESG000079633.1[more]
SMESG000079667.11.816e-15551.79SMESG000079667.1[more]
SMESG000079583.11.279e-15251.04SMESG000079583.1[more]
SMESG000079585.17.588e-13449.44SMESG000079585.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028036 ID=SMED30028036|Name=Deoxynucleoside triphosphate triphosphohydrolase SAMHD1|organism=Schmidtea mediterranea sexual|type=transcript|length=1678bp
TCTTCCGATCTATAAAATATTACTTTATTAAACAGATATTTTGTGAGTAG
TACTGCAGTTTTGTTCAAAACAAAAAAACTTAAGAAGATGTCCAAATGTT
TAGAGACAATGGTAAACGATATCGTCTATGGAACGATAACCTTGCCCGAA
TACGTGAAAGAAATAATAGATACTCAGGAATTTCAAAGGCTTAGATACAT
ATCGCAAACTGGTTTAACTTGGTATGTTAACCCTTCTGCTACTTGCTCAA
GATTTGAACATTCGCTGGGAACATTTTATCTGGCTAGTAAGCTCATTAAG
CAACTCAAAGACCAATTGGAAAGTGAAGACAAATTAATAATCACTTCAGA
AGAGGTAAAATGCGTCGAATTAGCCGCTTTGTGTCATGACCTAGGTCATG
GACCACATTCTCATTTCTGGGAACATGCTTTCGATCCATCATTGAAAATT
AAAACAAGAAAGCATGAAGATGTATCAGTGGAAATATTTCGAGAGTTAGT
AGACCAAAAGAAATCCACTTCTACCGAGACAATTAAAACGATTATTGGTC
TGACGGAGGAAATGATTGATCAAATCTGCCGAATGATTACAGGAGAGTTT
GAAAGAGAAAAGGACGGTGAAAAAAAATTCTTATTCCAAATTGTTGCGAA
TAAGGATTCAGGGCTCGATGTGGATAAGTTGGACTATTTATGTAGAGACT
CATTCTACTTAGGTTGGTCGAATAATAAAATTCATGATTTCAAACGGTTG
ATATATTTCTTTCGAGTTGTCAAAGATGAAAGTACAAATGATTGGCATTT
GGCAATGAGAGATCGAGAACTCTTTAAAGTTAATGAAGTATTTTCATTTC
GACACATTCTTCATCGCTACGGTTGTAAACATCGGGTAGTTAAATCTATC
GAATGCATGTTCAGAAATGGGATAAAACAAGTCATTGAAAATACAGTTGC
TCGAGATGAATTCCTCGAAACCGTTCTAGAACAGAAAGTCCCTTACAACT
CAGAAATTTGGTTCTCCAAACAATTCATCAGCAAGGTCAATGATTATCAT
CTTTGGCACGTGCTGAAGAAGTACGCCAAAGAAATGTTTAAAAATATTCA
AGAACGCAACTTGTACAAACTATTACACCAATCTCAAATCCAAATCACTT
CCGGTAATAATTTTGACAGTCTTGACAACGATATTTCTGATTTACAGACT
TTTCTACAAAGAACTTCTGGTCATTCAAATATCTATTTATCACTTTCAAT
TTATAGCTTGCAAACTGAGAACAAAGGAGATCCATTGATGTTGATGAAAT
TTTATTCCAAAGAAAATCCAAACAAATCTTTTAATTATGATAAGGATTCT
CTTCCAAATTCGTTATCTTTGAAAGAGGATGAAATAATTCTGATGGTTTT
CGTCGAGCGAAGAATTTTTGATGAACTGGAAGGTGTTTTGGAGGTTTTCA
GATCTCTGGAAAGCAAGTCTTACAATTCACAGGAGGACTTTATAATGAGT
AATTTGCAAACAAAATATCTATTCAAGGAAATAAAATATTAAATATTTTT
GTTTTTATTTGTTCAAATTGAAAAAAATATATCTGGAGAAATTTATTTTT
TATGATTTATTTCCAACCAGTCTGAATTTTATATTTACAAACGATGTCCA
CTATGTTTTAATTTGAAATATATTTGTC
back to top

protein sequence of SMED30028036-orf-1

>SMED30028036-orf-1 ID=SMED30028036-orf-1|Name=SMED30028036-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=485bp
MSKCLETMVNDIVYGTITLPEYVKEIIDTQEFQRLRYISQTGLTWYVNPS
ATCSRFEHSLGTFYLASKLIKQLKDQLESEDKLIITSEEVKCVELAALCH
DLGHGPHSHFWEHAFDPSLKIKTRKHEDVSVEIFRELVDQKKSTSTETIK
TIIGLTEEMIDQICRMITGEFEREKDGEKKFLFQIVANKDSGLDVDKLDY
LCRDSFYLGWSNNKIHDFKRLIYFFRVVKDESTNDWHLAMRDRELFKVNE
VFSFRHILHRYGCKHRVVKSIECMFRNGIKQVIENTVARDEFLETVLEQK
VPYNSEIWFSKQFISKVNDYHLWHVLKKYAKEMFKNIQERNLYKLLHQSQ
IQITSGNNFDSLDNDISDLQTFLQRTSGHSNIYLSLSIYSLQTENKGDPL
MLMKFYSKENPNKSFNYDKDSLPNSLSLKEDEIILMVFVERRIFDELEGV
LEVFRSLESKSYNSQEDFIMSNLQTKYLFKEIKY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR003607HD/PDEase_dom
IPR006674HD_domain
IPR001024PLAT/LH2_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0003676nucleic acid binding
GO:0003723RNA binding
GO:0003824catalytic activity
GO:0008270zinc ion binding
GO:0008832dGTPase activity
GO:0016787hydrolase activity
GO:0032567dGTP binding
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0002376immune system process
GO:0006203dGTP catabolic process
GO:0008152metabolic process
GO:0045087innate immune response
GO:0045088regulation of innate immune response
GO:0046061dATP catabolic process
GO:0051607defense response to virus
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003607HD/PDEase domainSMARTSM00471hd_13coord: 51..210
e-value: 4.0E-8
score: 43.0
IPR003607HD/PDEase domainPROSITEPS51831HDcoord: 55..201
score: 14.867
IPR003607HD/PDEase domainCDDcd00077HDccoord: 54..209
e-value: 8.08886E-13
score: 63.8977
NoneNo IPR availableGENE3DG3DSA:1.10.3210.10coord: 7..341
e-value: 3.9E-86
score: 291.5
NoneNo IPR availablePANTHERPTHR11373:SF4DEOXYNUCLEOSIDE TRIPHOSPHATE TRIPHOSPHOHYDROLASE SAMHD1coord: 8..457
NoneNo IPR availablePANTHERPTHR11373SAM DOMAIN AND HD DOMAIN-CONTAINING PROTEIN-RELATEDcoord: 8..457
NoneNo IPR availableSUPERFAMILYSSF109604HD-domain/PDEase-likecoord: 7..455
IPR006674HD domainPFAMPF01966HDcoord: 55..202
e-value: 3.3E-14
score: 53.2