Abl interactor 2

Overview
NameAbl interactor 2
Smed IDSMED30028026
Length (bp)1793
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Abl interactor 2 (SMED30028026) t-SNE clustered cells

Violin plots show distribution of expression levels for Abl interactor 2 (SMED30028026) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Abl interactor 2 (SMED30028026) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Abl interactor 2 (SMED30028026) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028026

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30028026SMESG000033358.1 Contig4439GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30028026SMESG000055438.1 Contig4439GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30028026SMESG000055438.1 dd_Smed_v4_690_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30028026SMESG000055438.1 dd_Smed_v4_690_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30028026SMESG000055438.1 dd_Smed_v4_690_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30028026SMESG000055438.1 dd_Smed_v4_690_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30028026SMESG000055438.1 dd_Smed_v4_987_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Abl interactor 2 vs. Ensembl Human
Match: ABI2 (abl interactor 2 [Source:HGNC Symbol;Acc:HGNC:24011])

HSP 1 Score: 118.627 bits (296), Expect = 9.032e-28
Identity = 64/151 (42.38%), Postives = 93/151 (61.59%), Query Frame = 1
Query:   58 ILLKEDIPNGTEDLINTSKTLEDVADHCLLTY------DRSLEQTVNYTAQALGSVAYKINLLATNFLEVLDKQNIKLNELQTKVNHLNMQVHIHQEKTARLSIGKYTMPRDPNVLKVSKVIEPLT-EIQGKYKRKEIDFSVLDNVGHGLK 489
            +LL+E+IP G   L ++   LE VAD+C   Y       R+LE+T  YT Q+L SVAY IN LA N L++LD Q  +L  +++ +NH++  V IH+EK AR  IG  T   + N  +  K+I P   E   +Y RK ID+++LD++GHG+K
Sbjct:    6 MLLEEEIPGGRRALFDSYTNLERVADYCENNYIQSADKQRALEETKAYTTQSLASVAYLINTLANNVLQMLDIQASQLRRMESSINHISQTVDIHKEKVARREIGILTT--NKNTSRTHKIIAPANLERPVRYIRKPIDYTILDDIGHGVK 154          

HSP 2 Score: 65.855 bits (159), Expect = 1.027e-10
Identity = 25/46 (54.35%), Postives = 37/46 (80.43%), Query Frame = 1
Query: 1336 SQVDDGWAPNQYICKVITLYEYQQNKDDELSFQEGELIYVVKKNND 1473
            ++ D  WAP  Y+ KV+ +Y+Y ++K+DELSFQEG +IYV+KKN+D
Sbjct:  441 AEEDPPWAPRSYLEKVVAIYDYTKDKEDELSFQEGAIIYVIKKNDD 486          
BLAST of Abl interactor 2 vs. Ensembl Human
Match: ABI2 (abl interactor 2 [Source:HGNC Symbol;Acc:HGNC:24011])

HSP 1 Score: 118.627 bits (296), Expect = 1.037e-27
Identity = 64/151 (42.38%), Postives = 93/151 (61.59%), Query Frame = 1
Query:   58 ILLKEDIPNGTEDLINTSKTLEDVADHCLLTY------DRSLEQTVNYTAQALGSVAYKINLLATNFLEVLDKQNIKLNELQTKVNHLNMQVHIHQEKTARLSIGKYTMPRDPNVLKVSKVIEPLT-EIQGKYKRKEIDFSVLDNVGHGLK 489
            +LL+E+IP G   L ++   LE VAD+C   Y       R+LE+T  YT Q+L SVAY IN LA N L++LD Q  +L  +++ +NH++  V IH+EK AR  IG  T   + N  +  K+I P   E   +Y RK ID+++LD++GHG+K
Sbjct:    6 MLLEEEIPGGRRALFDSYTNLERVADYCENNYIQSADKQRALEETKAYTTQSLASVAYLINTLANNVLQMLDIQASQLRRMESSINHISQTVDIHKEKVARREIGILTT--NKNTSRTHKIIAPANLERPVRYIRKPIDYTILDDIGHGVK 154          

HSP 2 Score: 107.842 bits (268), Expect = 4.295e-24
Identity = 42/68 (61.76%), Postives = 58/68 (85.29%), Query Frame = 1
Query: 1336 SQVDDGWAPNQYICKVITLYEYQQNKDDELSFQEGELIYVVKKNNDGWWEGVMNGRTGLFPGNYVQNM 1539
            ++ D  WAP  Y+ KV+ +Y+Y ++K+DELSFQEG +IYV+KKN+DGW+EGVMNG TGLFPGNYV+++
Sbjct:  435 AEEDPPWAPRSYLEKVVAIYDYTKDKEDELSFQEGAIIYVIKKNDDGWYEGVMNGVTGLFPGNYVESI 502          
BLAST of Abl interactor 2 vs. Ensembl Human
Match: ABI2 (abl interactor 2 [Source:HGNC Symbol;Acc:HGNC:24011])

HSP 1 Score: 117.857 bits (294), Expect = 1.084e-27
Identity = 64/151 (42.38%), Postives = 93/151 (61.59%), Query Frame = 1
Query:   58 ILLKEDIPNGTEDLINTSKTLEDVADHCLLTY------DRSLEQTVNYTAQALGSVAYKINLLATNFLEVLDKQNIKLNELQTKVNHLNMQVHIHQEKTARLSIGKYTMPRDPNVLKVSKVIEPLT-EIQGKYKRKEIDFSVLDNVGHGLK 489
            +LL+E+IP G   L ++   LE VAD+C   Y       R+LE+T  YT Q+L SVAY IN LA N L++LD Q  +L  +++ +NH++  V IH+EK AR  IG  T   + N  +  K+I P   E   +Y RK ID+++LD++GHG+K
Sbjct:    6 MLLEEEIPGGRRALFDSYTNLERVADYCENNYIQSADKQRALEETKAYTTQSLASVAYLINTLANNVLQMLDIQASQLRRMESSINHISQTVDIHKEKVARREIGILTT--NKNTSRTHKIIAPANLERPVRYIRKPIDYTILDDIGHGVK 154          

HSP 2 Score: 107.457 bits (267), Expect = 3.967e-24
Identity = 42/68 (61.76%), Postives = 58/68 (85.29%), Query Frame = 1
Query: 1336 SQVDDGWAPNQYICKVITLYEYQQNKDDELSFQEGELIYVVKKNNDGWWEGVMNGRTGLFPGNYVQNM 1539
            ++ D  WAP  Y+ KV+ +Y+Y ++K+DELSFQEG +IYV+KKN+DGW+EGVMNG TGLFPGNYV+++
Sbjct:  386 AEEDPPWAPRSYLEKVVAIYDYTKDKEDELSFQEGAIIYVIKKNDDGWYEGVMNGVTGLFPGNYVESI 453          
BLAST of Abl interactor 2 vs. Ensembl Human
Match: ABI2 (abl interactor 2 [Source:HGNC Symbol;Acc:HGNC:24011])

HSP 1 Score: 118.627 bits (296), Expect = 1.220e-27
Identity = 64/151 (42.38%), Postives = 93/151 (61.59%), Query Frame = 1
Query:   58 ILLKEDIPNGTEDLINTSKTLEDVADHCLLTY------DRSLEQTVNYTAQALGSVAYKINLLATNFLEVLDKQNIKLNELQTKVNHLNMQVHIHQEKTARLSIGKYTMPRDPNVLKVSKVIEPLT-EIQGKYKRKEIDFSVLDNVGHGLK 489
            +LL+E+IP G   L ++   LE VAD+C   Y       R+LE+T  YT Q+L SVAY IN LA N L++LD Q  +L  +++ +NH++  V IH+EK AR  IG  T   + N  +  K+I P   E   +Y RK ID+++LD++GHG+K
Sbjct:    6 MLLEEEIPGGRRALFDSYTNLERVADYCENNYIQSADKQRALEETKAYTTQSLASVAYLINTLANNVLQMLDIQASQLRRMESSINHISQTVDIHKEKVARREIGILTT--NKNTSRTHKIIAPANLERPVRYIRKPIDYTILDDIGHGVK 154          

HSP 2 Score: 107.071 bits (266), Expect = 6.428e-24
Identity = 42/68 (61.76%), Postives = 58/68 (85.29%), Query Frame = 1
Query: 1336 SQVDDGWAPNQYICKVITLYEYQQNKDDELSFQEGELIYVVKKNNDGWWEGVMNGRTGLFPGNYVQNM 1539
            ++ D  WAP  Y+ KV+ +Y+Y ++K+DELSFQEG +IYV+KKN+DGW+EGVMNG TGLFPGNYV+++
Sbjct:  441 AEEDPPWAPRSYLEKVVAIYDYTKDKEDELSFQEGAIIYVIKKNDDGWYEGVMNGVTGLFPGNYVESI 508          
BLAST of Abl interactor 2 vs. Ensembl Human
Match: ABI2 (abl interactor 2 [Source:HGNC Symbol;Acc:HGNC:24011])

HSP 1 Score: 118.627 bits (296), Expect = 1.220e-27
Identity = 64/151 (42.38%), Postives = 93/151 (61.59%), Query Frame = 1
Query:   58 ILLKEDIPNGTEDLINTSKTLEDVADHCLLTY------DRSLEQTVNYTAQALGSVAYKINLLATNFLEVLDKQNIKLNELQTKVNHLNMQVHIHQEKTARLSIGKYTMPRDPNVLKVSKVIEPLT-EIQGKYKRKEIDFSVLDNVGHGLK 489
            +LL+E+IP G   L ++   LE VAD+C   Y       R+LE+T  YT Q+L SVAY IN LA N L++LD Q  +L  +++ +NH++  V IH+EK AR  IG  T   + N  +  K+I P   E   +Y RK ID+++LD++GHG+K
Sbjct:    6 MLLEEEIPGGRRALFDSYTNLERVADYCENNYIQSADKQRALEETKAYTTQSLASVAYLINTLANNVLQMLDIQASQLRRMESSINHISQTVDIHKEKVARREIGILTT--NKNTSRTHKIIAPANLERPVRYIRKPIDYTILDDIGHGVK 154          

HSP 2 Score: 107.071 bits (266), Expect = 6.428e-24
Identity = 42/68 (61.76%), Postives = 58/68 (85.29%), Query Frame = 1
Query: 1336 SQVDDGWAPNQYICKVITLYEYQQNKDDELSFQEGELIYVVKKNNDGWWEGVMNGRTGLFPGNYVQNM 1539
            ++ D  WAP  Y+ KV+ +Y+Y ++K+DELSFQEG +IYV+KKN+DGW+EGVMNG TGLFPGNYV+++
Sbjct:  441 AEEDPPWAPRSYLEKVVAIYDYTKDKEDELSFQEGAIIYVIKKNDDGWYEGVMNGVTGLFPGNYVESI 508          
BLAST of Abl interactor 2 vs. Ensembl Celegans
Match: abi-1 (ABl Interactor homolog [Source:UniProtKB/TrEMBL;Acc:Q10929])

HSP 1 Score: 91.6633 bits (226), Expect = 2.434e-19
Identity = 53/150 (35.33%), Postives = 86/150 (57.33%), Query Frame = 1
Query:   61 LLKEDIPNGTEDLINTSKTLEDVADHCLLTYDRS------LEQTVNYTAQALGSVAYKINLLATNFLEVLDKQNIKLNELQTKVNHLNMQVHIHQEKTARLSIGKYTMPRDPNVLKVSKVIEP-LTEIQGKYKRKEIDFSVLDNVGHGLK 489
            L++  IP+    L  +   L+ VA +C   Y +S      LE++  +  QAL SVAY+IN + T+  ++L  Q  K+N L  +V +++  V +H+EK AR  IG  T   +  + K  K+I P + + + +Y+R  IDFSVLD +GHG++
Sbjct:    9 LIERRIPDNRAQLETSHANLQQVAAYCEDNYIQSNNKSAALEESKKFAIQALASVAYQINKMVTDLHDMLALQTDKVNSLTNQVQYVSQVVDVHKEKLARREIGSLTT--NKTLFKQPKIIAPAIPDEKQRYQRTPIDFSVLDGIGHGVR 156          

HSP 2 Score: 88.9669 bits (219), Expect = 1.502e-18
Identity = 35/60 (58.33%), Postives = 48/60 (80.00%), Query Frame = 1
Query: 1351 GWAPNQYICKVITLYEYQQNKDDELSFQEGELIYVVKKNNDGWWEGVMNGRTGLFPGNYV 1530
            GW PN+Y+ KV  LY+Y   K+DEL+ +E  ++YV+KKN+D W+EGV++G TGLFPGNYV
Sbjct:  407 GWMPNEYLEKVRVLYDYDAAKEDELTLRENAIVYVLKKNDDDWYEGVLDGVTGLFPGNYV 466          
BLAST of Abl interactor 2 vs. Ensembl Celegans
Match: abi-1 (ABl Interactor homolog [Source:UniProtKB/TrEMBL;Acc:Q10929])

HSP 1 Score: 91.6633 bits (226), Expect = 2.434e-19
Identity = 53/150 (35.33%), Postives = 86/150 (57.33%), Query Frame = 1
Query:   61 LLKEDIPNGTEDLINTSKTLEDVADHCLLTYDRS------LEQTVNYTAQALGSVAYKINLLATNFLEVLDKQNIKLNELQTKVNHLNMQVHIHQEKTARLSIGKYTMPRDPNVLKVSKVIEP-LTEIQGKYKRKEIDFSVLDNVGHGLK 489
            L++  IP+    L  +   L+ VA +C   Y +S      LE++  +  QAL SVAY+IN + T+  ++L  Q  K+N L  +V +++  V +H+EK AR  IG  T   +  + K  K+I P + + + +Y+R  IDFSVLD +GHG++
Sbjct:    9 LIERRIPDNRAQLETSHANLQQVAAYCEDNYIQSNNKSAALEESKKFAIQALASVAYQINKMVTDLHDMLALQTDKVNSLTNQVQYVSQVVDVHKEKLARREIGSLTT--NKTLFKQPKIIAPAIPDEKQRYQRTPIDFSVLDGIGHGVR 156          

HSP 2 Score: 88.9669 bits (219), Expect = 1.502e-18
Identity = 35/60 (58.33%), Postives = 48/60 (80.00%), Query Frame = 1
Query: 1351 GWAPNQYICKVITLYEYQQNKDDELSFQEGELIYVVKKNNDGWWEGVMNGRTGLFPGNYV 1530
            GW PN+Y+ KV  LY+Y   K+DEL+ +E  ++YV+KKN+D W+EGV++G TGLFPGNYV
Sbjct:  407 GWMPNEYLEKVRVLYDYDAAKEDELTLRENAIVYVLKKNDDDWYEGVLDGVTGLFPGNYV 466          
BLAST of Abl interactor 2 vs. Ensembl Celegans
Match: hum-1 (Heavy chain, Unconventional Myosin [Source:UniProtKB/TrEMBL;Acc:Q19901])

HSP 1 Score: 60.8474 bits (146), Expect = 2.571e-9
Identity = 26/51 (50.98%), Postives = 35/51 (68.63%), Query Frame = 1
Query: 1381 VITLYEYQQNKDDELSFQEGELIYVVKKNNDGWWEGVMNGRTGLFPGNYVQ 1533
            VI +Y Y+    DELSF+ G  I ++ K+  GWW+G +N R GLFPGNYV+
Sbjct: 1049 VIAVYPYEAQDVDELSFEAGAEIELMNKDASGWWQGKVNNRVGLFPGNYVK 1099          
BLAST of Abl interactor 2 vs. Ensembl Celegans
Match: mlk-1 (Mitogen-activated protein kinase kinase kinase mlk-1 [Source:UniProtKB/Swiss-Prot;Acc:A0A0K3AV08])

HSP 1 Score: 60.077 bits (144), Expect = 3.567e-9
Identity = 32/92 (34.78%), Postives = 50/92 (54.35%), Query Frame = 1
Query: 1336 SQVDDGWAPNQYICKVITLYEYQQNKDDELSFQEGELIYVV--KKNNDGWWEGVMNGRTGLFPGNYVQNMN*SHN*FIIIFYYADNLMIYLA 1605
            SQV     P +     +  YEY+  KDDEL+   G +I +V  + N DGW+ G +NG+ GLFP NY + +    N   ++ +  D +M+ +A
Sbjct:   59 SQVSRESPPIRASKAFVASYEYEAQKDDELNLPLGAIITLVTVETNEDGWYRGELNGKVGLFPSNYAREVTYKDN---LVEFKQDEIMLPVA 147          
BLAST of Abl interactor 2 vs. Ensembl Celegans
Match: mlk-1 (Mitogen-activated protein kinase kinase kinase mlk-1 [Source:UniProtKB/Swiss-Prot;Acc:A0A0K3AV08])

HSP 1 Score: 60.077 bits (144), Expect = 4.052e-9
Identity = 32/92 (34.78%), Postives = 50/92 (54.35%), Query Frame = 1
Query: 1336 SQVDDGWAPNQYICKVITLYEYQQNKDDELSFQEGELIYVV--KKNNDGWWEGVMNGRTGLFPGNYVQNMN*SHN*FIIIFYYADNLMIYLA 1605
            SQV     P +     +  YEY+  KDDEL+   G +I +V  + N DGW+ G +NG+ GLFP NY + +    N   ++ +  D +M+ +A
Sbjct:   59 SQVSRESPPIRASKAFVASYEYEAQKDDELNLPLGAIITLVTVETNEDGWYRGELNGKVGLFPSNYAREVTYKDN---LVEFKQDEIMLPVA 147          
BLAST of Abl interactor 2 vs. Ensembl Fly
Match: Abi (gene:FBgn0020510 transcript:FBtr0307077)

HSP 1 Score: 109.768 bits (273), Expect = 3.457e-25
Identity = 67/170 (39.41%), Postives = 101/170 (59.41%), Query Frame = 1
Query:   10 LNNFSMGTEFLPKDYIILLKEDIPNGTEDLINTSKTLEDVADHCLLTYDRS------LEQTVNYTAQALGSVAYKINLLATNFLEVLDKQNIKLNELQTKVNHLNMQVHIHQEKTARLSIGKYTMPR-DPNVLKVSKVIEPLTEIQGKYKRKEIDFSVLDNVGHGLKEPQ 498
            L    M +E +  +   L++ +IP+G + L ++   LE VAD+C  TY R+      LE T NYT Q+L SVAY+IN LA +++++L+ Q  +L E+++++NH+   VHIH+EK AR  IG  T  +      K+   I P   I  KY RK ID+S+LD +GHG+   Q
Sbjct:    2 LTETPMASENIMDELASLIRTEIPDGRQSLRDSYTNLERVADYCEDTYYRADNKKAALEATKNYTTQSLASVAYQINTLAYSYMQLLELQAQQLGEMESQMNHIAQTVHIHKEKVARREIGVLTANKVSSRQFKIVAPINPEKPI--KYVRKPIDYSMLDEIGHGINSAQ 169          

HSP 2 Score: 102.064 bits (253), Expect = 1.028e-22
Identity = 40/61 (65.57%), Postives = 51/61 (83.61%), Query Frame = 1
Query: 1351 GWAPNQYICKVITLYEYQQNKDDELSFQEGELIYVVKKNNDGWWEGVMNGRTGLFPGNYVQ 1533
            GW P  +I KV+ +Y+Y  +KDDELSFQE  ++YV+KKN+DGWWEGVM+G TGLFPGNYV+
Sbjct:  414 GWVPKNFIEKVVAIYDYYADKDDELSFQESSVLYVLKKNDDGWWEGVMDGVTGLFPGNYVE 474          
BLAST of Abl interactor 2 vs. Ensembl Fly
Match: Abi (gene:FBgn0020510 transcript:FBtr0307076)

HSP 1 Score: 109.768 bits (273), Expect = 3.465e-25
Identity = 67/170 (39.41%), Postives = 101/170 (59.41%), Query Frame = 1
Query:   10 LNNFSMGTEFLPKDYIILLKEDIPNGTEDLINTSKTLEDVADHCLLTYDRS------LEQTVNYTAQALGSVAYKINLLATNFLEVLDKQNIKLNELQTKVNHLNMQVHIHQEKTARLSIGKYTMPR-DPNVLKVSKVIEPLTEIQGKYKRKEIDFSVLDNVGHGLKEPQ 498
            L    M +E +  +   L++ +IP+G + L ++   LE VAD+C  TY R+      LE T NYT Q+L SVAY+IN LA +++++L+ Q  +L E+++++NH+   VHIH+EK AR  IG  T  +      K+   I P   I  KY RK ID+S+LD +GHG+   Q
Sbjct:    2 LTETPMASENIMDELASLIRTEIPDGRQSLRDSYTNLERVADYCEDTYYRADNKKAALEATKNYTTQSLASVAYQINTLAYSYMQLLELQAQQLGEMESQMNHIAQTVHIHKEKVARREIGVLTANKVSSRQFKIVAPINPEKPI--KYVRKPIDYSMLDEIGHGINSAQ 169          

HSP 2 Score: 102.064 bits (253), Expect = 1.037e-22
Identity = 40/61 (65.57%), Postives = 51/61 (83.61%), Query Frame = 1
Query: 1351 GWAPNQYICKVITLYEYQQNKDDELSFQEGELIYVVKKNNDGWWEGVMNGRTGLFPGNYVQ 1533
            GW P  +I KV+ +Y+Y  +KDDELSFQE  ++YV+KKN+DGWWEGVM+G TGLFPGNYV+
Sbjct:  409 GWVPKNFIEKVVAIYDYYADKDDELSFQESSVLYVLKKNDDGWWEGVMDGVTGLFPGNYVE 469          
BLAST of Abl interactor 2 vs. Ensembl Fly
Match: Abi (gene:FBgn0020510 transcript:FBtr0337096)

HSP 1 Score: 109.768 bits (273), Expect = 3.465e-25
Identity = 67/170 (39.41%), Postives = 101/170 (59.41%), Query Frame = 1
Query:   10 LNNFSMGTEFLPKDYIILLKEDIPNGTEDLINTSKTLEDVADHCLLTYDRS------LEQTVNYTAQALGSVAYKINLLATNFLEVLDKQNIKLNELQTKVNHLNMQVHIHQEKTARLSIGKYTMPR-DPNVLKVSKVIEPLTEIQGKYKRKEIDFSVLDNVGHGLKEPQ 498
            L    M +E +  +   L++ +IP+G + L ++   LE VAD+C  TY R+      LE T NYT Q+L SVAY+IN LA +++++L+ Q  +L E+++++NH+   VHIH+EK AR  IG  T  +      K+   I P   I  KY RK ID+S+LD +GHG+   Q
Sbjct:    2 LTETPMASENIMDELASLIRTEIPDGRQSLRDSYTNLERVADYCEDTYYRADNKKAALEATKNYTTQSLASVAYQINTLAYSYMQLLELQAQQLGEMESQMNHIAQTVHIHKEKVARREIGVLTANKVSSRQFKIVAPINPEKPI--KYVRKPIDYSMLDEIGHGINSAQ 169          

HSP 2 Score: 102.064 bits (253), Expect = 1.037e-22
Identity = 40/61 (65.57%), Postives = 51/61 (83.61%), Query Frame = 1
Query: 1351 GWAPNQYICKVITLYEYQQNKDDELSFQEGELIYVVKKNNDGWWEGVMNGRTGLFPGNYVQ 1533
            GW P  +I KV+ +Y+Y  +KDDELSFQE  ++YV+KKN+DGWWEGVM+G TGLFPGNYV+
Sbjct:  409 GWVPKNFIEKVVAIYDYYADKDDELSFQESSVLYVLKKNDDGWWEGVMDGVTGLFPGNYVE 469          
BLAST of Abl interactor 2 vs. Ensembl Fly
Match: Abi (gene:FBgn0020510 transcript:FBtr0337097)

HSP 1 Score: 109.768 bits (273), Expect = 3.496e-25
Identity = 67/170 (39.41%), Postives = 101/170 (59.41%), Query Frame = 1
Query:   10 LNNFSMGTEFLPKDYIILLKEDIPNGTEDLINTSKTLEDVADHCLLTYDRS------LEQTVNYTAQALGSVAYKINLLATNFLEVLDKQNIKLNELQTKVNHLNMQVHIHQEKTARLSIGKYTMPR-DPNVLKVSKVIEPLTEIQGKYKRKEIDFSVLDNVGHGLKEPQ 498
            L    M +E +  +   L++ +IP+G + L ++   LE VAD+C  TY R+      LE T NYT Q+L SVAY+IN LA +++++L+ Q  +L E+++++NH+   VHIH+EK AR  IG  T  +      K+   I P   I  KY RK ID+S+LD +GHG+   Q
Sbjct:    2 LTETPMASENIMDELASLIRTEIPDGRQSLRDSYTNLERVADYCEDTYYRADNKKAALEATKNYTTQSLASVAYQINTLAYSYMQLLELQAQQLGEMESQMNHIAQTVHIHKEKVARREIGVLTANKVSSRQFKIVAPINPEKPI--KYVRKPIDYSMLDEIGHGINSAQ 169          

HSP 2 Score: 102.064 bits (253), Expect = 1.044e-22
Identity = 40/61 (65.57%), Postives = 51/61 (83.61%), Query Frame = 1
Query: 1351 GWAPNQYICKVITLYEYQQNKDDELSFQEGELIYVVKKNNDGWWEGVMNGRTGLFPGNYVQ 1533
            GW P  +I KV+ +Y+Y  +KDDELSFQE  ++YV+KKN+DGWWEGVM+G TGLFPGNYV+
Sbjct:  410 GWVPKNFIEKVVAIYDYYADKDDELSFQESSVLYVLKKNDDGWWEGVMDGVTGLFPGNYVE 470          
BLAST of Abl interactor 2 vs. Ensembl Fly
Match: Abi (gene:FBgn0020510 transcript:FBtr0082910)

HSP 1 Score: 109.768 bits (273), Expect = 3.496e-25
Identity = 67/170 (39.41%), Postives = 101/170 (59.41%), Query Frame = 1
Query:   10 LNNFSMGTEFLPKDYIILLKEDIPNGTEDLINTSKTLEDVADHCLLTYDRS------LEQTVNYTAQALGSVAYKINLLATNFLEVLDKQNIKLNELQTKVNHLNMQVHIHQEKTARLSIGKYTMPR-DPNVLKVSKVIEPLTEIQGKYKRKEIDFSVLDNVGHGLKEPQ 498
            L    M +E +  +   L++ +IP+G + L ++   LE VAD+C  TY R+      LE T NYT Q+L SVAY+IN LA +++++L+ Q  +L E+++++NH+   VHIH+EK AR  IG  T  +      K+   I P   I  KY RK ID+S+LD +GHG+   Q
Sbjct:    2 LTETPMASENIMDELASLIRTEIPDGRQSLRDSYTNLERVADYCEDTYYRADNKKAALEATKNYTTQSLASVAYQINTLAYSYMQLLELQAQQLGEMESQMNHIAQTVHIHKEKVARREIGVLTANKVSSRQFKIVAPINPEKPI--KYVRKPIDYSMLDEIGHGINSAQ 169          

HSP 2 Score: 102.064 bits (253), Expect = 1.044e-22
Identity = 40/61 (65.57%), Postives = 51/61 (83.61%), Query Frame = 1
Query: 1351 GWAPNQYICKVITLYEYQQNKDDELSFQEGELIYVVKKNNDGWWEGVMNGRTGLFPGNYVQ 1533
            GW P  +I KV+ +Y+Y  +KDDELSFQE  ++YV+KKN+DGWWEGVM+G TGLFPGNYV+
Sbjct:  410 GWVPKNFIEKVVAIYDYYADKDDELSFQESSVLYVLKKNDDGWWEGVMDGVTGLFPGNYVE 470          
BLAST of Abl interactor 2 vs. Ensembl Zebrafish
Match: abi2a (abl-interactor 2a [Source:ZFIN;Acc:ZDB-GENE-060929-192])

HSP 1 Score: 116.701 bits (291), Expect = 4.815e-28
Identity = 64/151 (42.38%), Postives = 96/151 (63.58%), Query Frame = 1
Query:   58 ILLKEDIPNGTEDLINTSKTLEDVADHCLLTY----DR--SLEQTVNYTAQALGSVAYKINLLATNFLEVLDKQNIKLNELQTKVNHLNMQVHIHQEKTARLSIGKYTMPRDPNVLKVSKVIEPLT-EIQGKYKRKEIDFSVLDNVGHGLK 489
            +LL+E+IP G   L+++   L+ VA++C   Y    D+  +LE+T NYT Q+L SVAY IN LA N L++LD Q  +L  +++ +NH++  V IH+EK AR  IG  T   + N  +  K+I P   E   +Y RK ID+S+LD++GHG+K
Sbjct:    6 MLLEEEIPAGRRALLDSFTNLDRVAEYCESNYVQAPDKHVALEETKNYTTQSLASVAYLINTLANNVLQMLDIQASQLRRMESSINHISQTVDIHKEKVARREIGILTT--NKNTSRTHKIIAPANPERPVRYIRKPIDYSMLDDIGHGVK 154          
BLAST of Abl interactor 2 vs. Ensembl Zebrafish
Match: abi2b (abl-interactor 2b [Source:ZFIN;Acc:ZDB-GENE-060519-5])

HSP 1 Score: 117.857 bits (294), Expect = 8.836e-28
Identity = 65/151 (43.05%), Postives = 95/151 (62.91%), Query Frame = 1
Query:   58 ILLKEDIPNGTEDLINTSKTLEDVADHCLLTY------DRSLEQTVNYTAQALGSVAYKINLLATNFLEVLDKQNIKLNELQTKVNHLNMQVHIHQEKTARLSIGKYTMPRDPNVLKVSKVIEPLT-EIQGKYKRKEIDFSVLDNVGHGLK 489
            +LL+E+IP G   L+++   LE VA++C   Y       R+LE+T +YT Q+L SVAY IN LA N L++LD Q  +L  +++ +NH++  V IH+EK AR  IG  T   + N  +  K+I P   E   +Y RK ID+S+LD+VGHG+K
Sbjct:    6 MLLEEEIPAGRGALLDSYANLERVAEYCESNYIQSPDKHRALEETKSYTTQSLASVAYLINTLANNVLQMLDIQASQLRRMESSINHISQTVDIHKEKVARREIGILTT--NKNTSRTHKIIAPANPERPVRYIRKPIDYSLLDDVGHGVK 154          

HSP 2 Score: 105.916 bits (263), Expect = 6.791e-24
Identity = 45/83 (54.22%), Postives = 62/83 (74.70%), Query Frame = 1
Query: 1336 SQVDDGWAPNQYICKVITLYEYQQNKDDELSFQEGELIYVVKKNNDGWWEGVMNGRTGLFPGNYVQNMN*SHN*FIIIFYYAD 1584
            ++ D  WAP  Y+ KV+ +Y+Y ++K+DELSFQEG +IYV+KKN+DGW+EGVM+G TGLFPGNYV++          I +YAD
Sbjct:  389 AEEDPPWAPRSYLEKVVAIYDYTRDKEDELSFQEGAIIYVIKKNDDGWYEGVMSGTTGLFPGNYVES----------IMHYAD 461          
BLAST of Abl interactor 2 vs. Ensembl Zebrafish
Match: abi2b (abl-interactor 2b [Source:ZFIN;Acc:ZDB-GENE-060519-5])

HSP 1 Score: 117.857 bits (294), Expect = 1.112e-27
Identity = 65/151 (43.05%), Postives = 95/151 (62.91%), Query Frame = 1
Query:   58 ILLKEDIPNGTEDLINTSKTLEDVADHCLLTY------DRSLEQTVNYTAQALGSVAYKINLLATNFLEVLDKQNIKLNELQTKVNHLNMQVHIHQEKTARLSIGKYTMPRDPNVLKVSKVIEPLT-EIQGKYKRKEIDFSVLDNVGHGLK 489
            +LL+E+IP G   L+++   LE VA++C   Y       R+LE+T +YT Q+L SVAY IN LA N L++LD Q  +L  +++ +NH++  V IH+EK AR  IG  T   + N  +  K+I P   E   +Y RK ID+S+LD+VGHG+K
Sbjct:    6 MLLEEEIPAGRGALLDSYANLERVAEYCESNYIQSPDKHRALEETKSYTTQSLASVAYLINTLANNVLQMLDIQASQLRRMESSINHISQTVDIHKEKVARREIGILTT--NKNTSRTHKIIAPANPERPVRYIRKPIDYSLLDDVGHGVK 154          

HSP 2 Score: 106.686 bits (265), Expect = 5.588e-24
Identity = 45/83 (54.22%), Postives = 62/83 (74.70%), Query Frame = 1
Query: 1336 SQVDDGWAPNQYICKVITLYEYQQNKDDELSFQEGELIYVVKKNNDGWWEGVMNGRTGLFPGNYVQNMN*SHN*FIIIFYYAD 1584
            ++ D  WAP  Y+ KV+ +Y+Y ++K+DELSFQEG +IYV+KKN+DGW+EGVM+G TGLFPGNYV++          I +YAD
Sbjct:  418 AEEDPPWAPRSYLEKVVAIYDYTRDKEDELSFQEGAIIYVIKKNDDGWYEGVMSGTTGLFPGNYVES----------IMHYAD 490          
BLAST of Abl interactor 2 vs. Ensembl Zebrafish
Match: abi2a (abl-interactor 2a [Source:ZFIN;Acc:ZDB-GENE-060929-192])

HSP 1 Score: 116.316 bits (290), Expect = 1.155e-27
Identity = 64/151 (42.38%), Postives = 96/151 (63.58%), Query Frame = 1
Query:   58 ILLKEDIPNGTEDLINTSKTLEDVADHCLLTY----DR--SLEQTVNYTAQALGSVAYKINLLATNFLEVLDKQNIKLNELQTKVNHLNMQVHIHQEKTARLSIGKYTMPRDPNVLKVSKVIEPLT-EIQGKYKRKEIDFSVLDNVGHGLK 489
            +LL+E+IP G   L+++   L+ VA++C   Y    D+  +LE+T NYT Q+L SVAY IN LA N L++LD Q  +L  +++ +NH++  V IH+EK AR  IG  T   + N  +  K+I P   E   +Y RK ID+S+LD++GHG+K
Sbjct:    6 MLLEEEIPAGRRALLDSFTNLDRVAEYCESNYVQAPDKHVALEETKNYTTQSLASVAYLINTLANNVLQMLDIQASQLRRMESSINHISQTVDIHKEKVARREIGILTT--NKNTSRTHKIIAPANPERPVRYIRKPIDYSMLDDIGHGVK 154          
BLAST of Abl interactor 2 vs. Ensembl Zebrafish
Match: abi2b (abl-interactor 2b [Source:ZFIN;Acc:ZDB-GENE-060519-5])

HSP 1 Score: 116.701 bits (291), Expect = 1.493e-27
Identity = 65/151 (43.05%), Postives = 95/151 (62.91%), Query Frame = 1
Query:   58 ILLKEDIPNGTEDLINTSKTLEDVADHCLLTY------DRSLEQTVNYTAQALGSVAYKINLLATNFLEVLDKQNIKLNELQTKVNHLNMQVHIHQEKTARLSIGKYTMPRDPNVLKVSKVIEPLT-EIQGKYKRKEIDFSVLDNVGHGLK 489
            +LL+E+IP G   L+++   LE VA++C   Y       R+LE+T +YT Q+L SVAY IN LA N L++LD Q  +L  +++ +NH++  V IH+EK AR  IG  T   + N  +  K+I P   E   +Y RK ID+S+LD+VGHG+K
Sbjct:    6 MLLEEEIPAGRGALLDSYANLERVAEYCESNYIQSPDKHRALEETKSYTTQSLASVAYLINTLANNVLQMLDIQASQLRRMESSINHISQTVDIHKEKVARREIGILTT--NKNTSRTHKIIAPANPERPVRYIRKPIDYSLLDDVGHGVK 154          

HSP 2 Score: 105.145 bits (261), Expect = 1.235e-23
Identity = 45/83 (54.22%), Postives = 62/83 (74.70%), Query Frame = 1
Query: 1336 SQVDDGWAPNQYICKVITLYEYQQNKDDELSFQEGELIYVVKKNNDGWWEGVMNGRTGLFPGNYVQNMN*SHN*FIIIFYYAD 1584
            ++ D  WAP  Y+ KV+ +Y+Y ++K+DELSFQEG +IYV+KKN+DGW+EGVM+G TGLFPGNYV++          I +YAD
Sbjct:  375 AEEDPPWAPRSYLEKVVAIYDYTRDKEDELSFQEGAIIYVIKKNDDGWYEGVMSGTTGLFPGNYVES----------IMHYAD 447          
BLAST of Abl interactor 2 vs. Ensembl Xenopus
Match: abi2 (abl-interactor 2 [Source:NCBI gene;Acc:548798])

HSP 1 Score: 118.242 bits (295), Expect = 1.325e-27
Identity = 64/151 (42.38%), Postives = 93/151 (61.59%), Query Frame = 1
Query:   58 ILLKEDIPNGTEDLINTSKTLEDVADHCLLTY------DRSLEQTVNYTAQALGSVAYKINLLATNFLEVLDKQNIKLNELQTKVNHLNMQVHIHQEKTARLSIGKYTMPRDPNVLKVSKVIEPLT-EIQGKYKRKEIDFSVLDNVGHGLK 489
            +LL+E+IP G   L+++   LE VAD+C   Y       R+LE+T  YT Q+L SVAY IN LA N L++LD Q  +L  +++ +NH++  V IH+EK AR  IG  T   + N  +  K+I P   E   +Y RK ID+++LD+ GHG+K
Sbjct:    6 MLLEEEIPGGRRALLDSYTNLERVADYCENNYIQSPDKQRALEETKAYTTQSLASVAYLINTLANNVLQMLDIQASQLRRMESSINHISQTVDIHKEKVARREIGILTT--NKNTSRTHKIIAPANLERPVRYIRKPIDYTILDDTGHGVK 154          

HSP 2 Score: 107.842 bits (268), Expect = 3.703e-24
Identity = 42/68 (61.76%), Postives = 58/68 (85.29%), Query Frame = 1
Query: 1336 SQVDDGWAPNQYICKVITLYEYQQNKDDELSFQEGELIYVVKKNNDGWWEGVMNGRTGLFPGNYVQNM 1539
            ++ D  WAP  Y+ KV+ +Y+Y ++K+DELSFQEG +IYV+KKN+DGW+EGVMNG TGLFPGNYV+++
Sbjct:  433 AEEDPPWAPRTYLEKVVAIYDYSKDKEDELSFQEGAIIYVIKKNDDGWYEGVMNGVTGLFPGNYVESI 500          
BLAST of Abl interactor 2 vs. Ensembl Xenopus
Match: abi2 (abl-interactor 2 [Source:NCBI gene;Acc:548798])

HSP 1 Score: 118.242 bits (295), Expect = 1.448e-27
Identity = 64/151 (42.38%), Postives = 93/151 (61.59%), Query Frame = 1
Query:   58 ILLKEDIPNGTEDLINTSKTLEDVADHCLLTY------DRSLEQTVNYTAQALGSVAYKINLLATNFLEVLDKQNIKLNELQTKVNHLNMQVHIHQEKTARLSIGKYTMPRDPNVLKVSKVIEPLT-EIQGKYKRKEIDFSVLDNVGHGLK 489
            +LL+E+IP G   L+++   LE VAD+C   Y       R+LE+T  YT Q+L SVAY IN LA N L++LD Q  +L  +++ +NH++  V IH+EK AR  IG  T   + N  +  K+I P   E   +Y RK ID+++LD+ GHG+K
Sbjct:    6 MLLEEEIPGGRRALLDSYTNLERVADYCENNYIQSPDKQRALEETKAYTTQSLASVAYLINTLANNVLQMLDIQASQLRRMESSINHISQTVDIHKEKVARREIGILTT--NKNTSRTHKIIAPANLERPVRYIRKPIDYTILDDTGHGVK 154          

HSP 2 Score: 107.842 bits (268), Expect = 3.870e-24
Identity = 42/68 (61.76%), Postives = 58/68 (85.29%), Query Frame = 1
Query: 1336 SQVDDGWAPNQYICKVITLYEYQQNKDDELSFQEGELIYVVKKNNDGWWEGVMNGRTGLFPGNYVQNM 1539
            ++ D  WAP  Y+ KV+ +Y+Y ++K+DELSFQEG +IYV+KKN+DGW+EGVMNG TGLFPGNYV+++
Sbjct:  466 AEEDPPWAPRTYLEKVVAIYDYSKDKEDELSFQEGAIIYVIKKNDDGWYEGVMNGVTGLFPGNYVESI 533          
BLAST of Abl interactor 2 vs. Ensembl Xenopus
Match: abi2 (abl-interactor 2 [Source:NCBI gene;Acc:548798])

HSP 1 Score: 118.242 bits (295), Expect = 1.766e-27
Identity = 64/151 (42.38%), Postives = 93/151 (61.59%), Query Frame = 1
Query:   58 ILLKEDIPNGTEDLINTSKTLEDVADHCLLTY------DRSLEQTVNYTAQALGSVAYKINLLATNFLEVLDKQNIKLNELQTKVNHLNMQVHIHQEKTARLSIGKYTMPRDPNVLKVSKVIEPLT-EIQGKYKRKEIDFSVLDNVGHGLK 489
            +LL+E+IP G   L+++   LE VAD+C   Y       R+LE+T  YT Q+L SVAY IN LA N L++LD Q  +L  +++ +NH++  V IH+EK AR  IG  T   + N  +  K+I P   E   +Y RK ID+++LD+ GHG+K
Sbjct:    6 MLLEEEIPGGRRALLDSYTNLERVADYCENNYIQSPDKQRALEETKAYTTQSLASVAYLINTLANNVLQMLDIQASQLRRMESSINHISQTVDIHKEKVARREIGILTT--NKNTSRTHKIIAPANLERPVRYIRKPIDYTILDDTGHGVK 154          

HSP 2 Score: 107.457 bits (267), Expect = 5.486e-24
Identity = 42/68 (61.76%), Postives = 58/68 (85.29%), Query Frame = 1
Query: 1336 SQVDDGWAPNQYICKVITLYEYQQNKDDELSFQEGELIYVVKKNNDGWWEGVMNGRTGLFPGNYVQNM 1539
            ++ D  WAP  Y+ KV+ +Y+Y ++K+DELSFQEG +IYV+KKN+DGW+EGVMNG TGLFPGNYV+++
Sbjct:  472 AEEDPPWAPRTYLEKVVAIYDYSKDKEDELSFQEGAIIYVIKKNDDGWYEGVMNGVTGLFPGNYVESI 539          
BLAST of Abl interactor 2 vs. Ensembl Xenopus
Match: abi1 (abl interactor 1 [Source:NCBI gene;Acc:493216])

HSP 1 Score: 115.546 bits (288), Expect = 2.653e-27
Identity = 65/151 (43.05%), Postives = 94/151 (62.25%), Query Frame = 1
Query:   58 ILLKEDIPNGTEDLINTSKTLEDVADHCLLTY------DRSLEQTVNYTAQALGSVAYKINLLATNFLEVLDKQNIKLNELQTKVNHLNMQVHIHQEKTARLSIGKYTMPRDPNVLKVSKVIEPL-TEIQGKYKRKEIDFSVLDNVGHGLK 489
            +LL+E+IP G + LI +   L  VAD+C   Y       ++LE+T  YT Q+L SVAY+IN LA N L++LD Q  +L  +++ +NH++  V IH+EK AR  IG  T   + N  +  K+I P   E   +Y RK ID++VLD+VGHG+K
Sbjct:    6 MLLEEEIPAGKKALIESFHNLTRVADYCESNYIQAPDKRKALEETKAYTTQSLASVAYQINALANNVLQLLDIQASQLRRMESSINHISQTVDIHKEKVARREIGILTT--NKNTARSHKIIAPANMERPVRYIRKPIDYTVLDDVGHGVK 154          

HSP 2 Score: 99.7525 bits (247), Expect = 5.755e-22
Identity = 43/80 (53.75%), Postives = 57/80 (71.25%), Query Frame = 1
Query: 1345 DDGWAPNQYICKVITLYEYQQNKDDELSFQEGELIYVVKKNNDGWWEGVMNGRTGLFPGNYVQNMN*SHN*FIIIFYYAD 1584
            D  WAP  Y+ KV+ +Y+Y ++K+DELSF EG +IYV+KKN+DGW+EGV NG TGLFPGNYV+           + +YAD
Sbjct:  324 DPIWAPKSYLEKVVAIYDYSKDKEDELSFMEGAIIYVIKKNDDGWYEGVSNGVTGLFPGNYVET----------VMHYAD 393          
BLAST of Abl interactor 2 vs. Ensembl Xenopus
Match: abi2 (abl-interactor 2 [Source:NCBI gene;Acc:548798])

HSP 1 Score: 117.087 bits (292), Expect = 2.782e-27
Identity = 64/151 (42.38%), Postives = 93/151 (61.59%), Query Frame = 1
Query:   58 ILLKEDIPNGTEDLINTSKTLEDVADHCLLTY------DRSLEQTVNYTAQALGSVAYKINLLATNFLEVLDKQNIKLNELQTKVNHLNMQVHIHQEKTARLSIGKYTMPRDPNVLKVSKVIEPLT-EIQGKYKRKEIDFSVLDNVGHGLK 489
            +LL+E+IP G   L+++   LE VAD+C   Y       R+LE+T  YT Q+L SVAY IN LA N L++LD Q  +L  +++ +NH++  V IH+EK AR  IG  T   + N  +  K+I P   E   +Y RK ID+++LD+ GHG+K
Sbjct:    6 MLLEEEIPGGRRALLDSYTNLERVADYCENNYIQSPDKQRALEETKAYTTQSLASVAYLINTLANNVLQMLDIQASQLRRMESSINHISQTVDIHKEKVARREIGILTT--NKNTSRTHKIIAPANLERPVRYIRKPIDYTILDDTGHGVK 154          

HSP 2 Score: 105.916 bits (263), Expect = 1.248e-23
Identity = 42/68 (61.76%), Postives = 58/68 (85.29%), Query Frame = 1
Query: 1336 SQVDDGWAPNQYICKVITLYEYQQNKDDELSFQEGELIYVVKKNNDGWWEGVMNGRTGLFPGNYVQNM 1539
            ++ D  WAP  Y+ KV+ +Y+Y ++K+DELSFQEG +IYV+KKN+DGW+EGVMNG TGLFPGNYV+++
Sbjct:  410 AEEDPPWAPRTYLEKVVAIYDYSKDKEDELSFQEGAIIYVIKKNDDGWYEGVMNGVTGLFPGNYVESI 477          
BLAST of Abl interactor 2 vs. Ensembl Mouse
Match: Abi2 (abl-interactor 2 [Source:MGI Symbol;Acc:MGI:106913])

HSP 1 Score: 118.627 bits (296), Expect = 6.499e-28
Identity = 64/151 (42.38%), Postives = 93/151 (61.59%), Query Frame = 1
Query:   58 ILLKEDIPNGTEDLINTSKTLEDVADHCLLTY------DRSLEQTVNYTAQALGSVAYKINLLATNFLEVLDKQNIKLNELQTKVNHLNMQVHIHQEKTARLSIGKYTMPRDPNVLKVSKVIEPLT-EIQGKYKRKEIDFSVLDNVGHGLK 489
            +LL+E+IP G   L ++   LE VAD+C   Y       R+LE+T  YT Q+L SVAY IN LA N L++LD Q  +L  +++ +NH++  V IH+EK AR  IG  T   + N  +  K+I P   E   +Y RK ID+++LD++GHG+K
Sbjct:    6 MLLEEEIPGGRRALFDSYTNLERVADYCENNYIQSPDKQRALEETKAYTTQSLASVAYLINTLANNVLQMLDIQASQLRRMESSINHISQTVDIHKEKVARREIGILTT--NKNTSRTHKIIAPANLERPVRYIRKPIDYTILDDIGHGVK 154          

HSP 2 Score: 65.4698 bits (158), Expect = 9.111e-11
Identity = 25/46 (54.35%), Postives = 37/46 (80.43%), Query Frame = 1
Query: 1336 SQVDDGWAPNQYICKVITLYEYQQNKDDELSFQEGELIYVVKKNND 1473
            ++ D  WAP  Y+ KV+ +Y+Y ++K+DELSFQEG +IYV+KKN+D
Sbjct:  441 AEEDPPWAPRAYLEKVVAIYDYTKDKEDELSFQEGAIIYVIKKNDD 486          
BLAST of Abl interactor 2 vs. Ensembl Mouse
Match: Abi2 (abl-interactor 2 [Source:MGI Symbol;Acc:MGI:106913])

HSP 1 Score: 117.857 bits (294), Expect = 8.121e-28
Identity = 64/151 (42.38%), Postives = 93/151 (61.59%), Query Frame = 1
Query:   58 ILLKEDIPNGTEDLINTSKTLEDVADHCLLTY------DRSLEQTVNYTAQALGSVAYKINLLATNFLEVLDKQNIKLNELQTKVNHLNMQVHIHQEKTARLSIGKYTMPRDPNVLKVSKVIEPLT-EIQGKYKRKEIDFSVLDNVGHGLK 489
            +LL+E+IP G   L ++   LE VAD+C   Y       R+LE+T  YT Q+L SVAY IN LA N L++LD Q  +L  +++ +NH++  V IH+EK AR  IG  T   + N  +  K+I P   E   +Y RK ID+++LD++GHG+K
Sbjct:    6 MLLEEEIPGGRRALFDSYTNLERVADYCENNYIQSPDKQRALEETKAYTTQSLASVAYLINTLANNVLQMLDIQASQLRRMESSINHISQTVDIHKEKVARREIGILTT--NKNTSRTHKIIAPANLERPVRYIRKPIDYTILDDIGHGVK 154          

HSP 2 Score: 105.916 bits (263), Expect = 7.611e-24
Identity = 42/68 (61.76%), Postives = 58/68 (85.29%), Query Frame = 1
Query: 1336 SQVDDGWAPNQYICKVITLYEYQQNKDDELSFQEGELIYVVKKNNDGWWEGVMNGRTGLFPGNYVQNM 1539
            ++ D  WAP  Y+ KV+ +Y+Y ++K+DELSFQEG +IYV+KKN+DGW+EGVMNG TGLFPGNYV+++
Sbjct:  374 AEEDPPWAPRAYLEKVVAIYDYTKDKEDELSFQEGAIIYVIKKNDDGWYEGVMNGVTGLFPGNYVESI 441          
BLAST of Abl interactor 2 vs. Ensembl Mouse
Match: Abi2 (abl-interactor 2 [Source:MGI Symbol;Acc:MGI:106913])

HSP 1 Score: 117.857 bits (294), Expect = 8.483e-28
Identity = 64/151 (42.38%), Postives = 93/151 (61.59%), Query Frame = 1
Query:   58 ILLKEDIPNGTEDLINTSKTLEDVADHCLLTY------DRSLEQTVNYTAQALGSVAYKINLLATNFLEVLDKQNIKLNELQTKVNHLNMQVHIHQEKTARLSIGKYTMPRDPNVLKVSKVIEPLT-EIQGKYKRKEIDFSVLDNVGHGLK 489
            +LL+E+IP G   L ++   LE VAD+C   Y       R+LE+T  YT Q+L SVAY IN LA N L++LD Q  +L  +++ +NH++  V IH+EK AR  IG  T   + N  +  K+I P   E   +Y RK ID+++LD++GHG+K
Sbjct:    6 MLLEEEIPGGRRALFDSYTNLERVADYCENNYIQSPDKQRALEETKAYTTQSLASVAYLINTLANNVLQMLDIQASQLRRMESSINHISQTVDIHKEKVARREIGILTT--NKNTSRTHKIIAPANLERPVRYIRKPIDYTILDDIGHGVK 154          

HSP 2 Score: 106.686 bits (265), Expect = 3.968e-24
Identity = 42/68 (61.76%), Postives = 58/68 (85.29%), Query Frame = 1
Query: 1336 SQVDDGWAPNQYICKVITLYEYQQNKDDELSFQEGELIYVVKKNNDGWWEGVMNGRTGLFPGNYVQNM 1539
            ++ D  WAP  Y+ KV+ +Y+Y ++K+DELSFQEG +IYV+KKN+DGW+EGVMNG TGLFPGNYV+++
Sbjct:  386 AEEDPPWAPRAYLEKVVAIYDYTKDKEDELSFQEGAIIYVIKKNDDGWYEGVMNGVTGLFPGNYVESI 453          
BLAST of Abl interactor 2 vs. Ensembl Mouse
Match: Abi2 (abl-interactor 2 [Source:MGI Symbol;Acc:MGI:106913])

HSP 1 Score: 117.857 bits (294), Expect = 9.925e-28
Identity = 64/151 (42.38%), Postives = 93/151 (61.59%), Query Frame = 1
Query:   58 ILLKEDIPNGTEDLINTSKTLEDVADHCLLTY------DRSLEQTVNYTAQALGSVAYKINLLATNFLEVLDKQNIKLNELQTKVNHLNMQVHIHQEKTARLSIGKYTMPRDPNVLKVSKVIEPLT-EIQGKYKRKEIDFSVLDNVGHGLK 489
            +LL+E+IP G   L ++   LE VAD+C   Y       R+LE+T  YT Q+L SVAY IN LA N L++LD Q  +L  +++ +NH++  V IH+EK AR  IG  T   + N  +  K+I P   E   +Y RK ID+++LD++GHG+K
Sbjct:    6 MLLEEEIPGGRRALFDSYTNLERVADYCENNYIQSPDKQRALEETKAYTTQSLASVAYLINTLANNVLQMLDIQASQLRRMESSINHISQTVDIHKEKVARREIGILTT--NKNTSRTHKIIAPANLERPVRYIRKPIDYTILDDIGHGVK 154          

HSP 2 Score: 105.916 bits (263), Expect = 1.020e-23
Identity = 42/68 (61.76%), Postives = 58/68 (85.29%), Query Frame = 1
Query: 1336 SQVDDGWAPNQYICKVITLYEYQQNKDDELSFQEGELIYVVKKNNDGWWEGVMNGRTGLFPGNYVQNM 1539
            ++ D  WAP  Y+ KV+ +Y+Y ++K+DELSFQEG +IYV+KKN+DGW+EGVMNG TGLFPGNYV+++
Sbjct:  408 AEEDPPWAPRAYLEKVVAIYDYTKDKEDELSFQEGAIIYVIKKNDDGWYEGVMNGVTGLFPGNYVESI 475          
BLAST of Abl interactor 2 vs. Ensembl Mouse
Match: Abi1 (abl-interactor 1 [Source:MGI Symbol;Acc:MGI:104913])

HSP 1 Score: 116.316 bits (290), Expect = 1.019e-27
Identity = 65/151 (43.05%), Postives = 95/151 (62.91%), Query Frame = 1
Query:   58 ILLKEDIPNGTEDLINTSKTLEDVADHCLLTY------DRSLEQTVNYTAQALGSVAYKINLLATNFLEVLDKQNIKLNELQTKVNHLNMQVHIHQEKTARLSIGKYTMPRDPNVLKVSKVIEPL-TEIQGKYKRKEIDFSVLDNVGHGLK 489
            +LL+E+IP+G   LI + + L  VAD+C   Y       ++LE+T  YT Q+L SVAY+IN LA N L++LD Q  +L  +++ +NH++  V IH+EK AR  IG  T   + N  +  K+I P   E   +Y RK ID++VLD+VGHG+K
Sbjct:    6 MLLEEEIPSGKRALIESYQNLTRVADYCENNYIQATDKRKALEETKAYTTQSLASVAYQINALANNVLQLLDIQASQLRRMESSINHISQTVDIHKEKVARREIGILTT--NKNTSRTHKIIAPANMERPVRYIRKPIDYTVLDDVGHGVK 154          

HSP 2 Score: 102.064 bits (253), Expect = 6.328e-23
Identity = 41/65 (63.08%), Postives = 54/65 (83.08%), Query Frame = 1
Query: 1345 DDGWAPNQYICKVITLYEYQQNKDDELSFQEGELIYVVKKNNDGWWEGVMNGRTGLFPGNYVQNM 1539
            D  WAP  YI KV+ +Y+Y ++KDDELSF+EG +IYV+KKN+DGW+EGV N  TGLFPGNYV+++
Sbjct:  319 DPAWAPKNYIEKVVAIYDYTKDKDDELSFKEGAIIYVIKKNDDGWFEGVCNRVTGLFPGNYVESI 383          
BLAST of Abl interactor 2 vs. UniProt/SwissProt
Match: sp|P62484|ABI2_MOUSE (Abl interactor 2 OS=Mus musculus OX=10090 GN=Abi2 PE=1 SV=1)

HSP 1 Score: 117.857 bits (294), Expect = 5.681e-27
Identity = 64/151 (42.38%), Postives = 93/151 (61.59%), Query Frame = 1
Query:   58 ILLKEDIPNGTEDLINTSKTLEDVADHCLLTY------DRSLEQTVNYTAQALGSVAYKINLLATNFLEVLDKQNIKLNELQTKVNHLNMQVHIHQEKTARLSIGKYTMPRDPNVLKVSKVIEPLT-EIQGKYKRKEIDFSVLDNVGHGLK 489
            +LL+E+IP G   L ++   LE VAD+C   Y       R+LE+T  YT Q+L SVAY IN LA N L++LD Q  +L  +++ +NH++  V IH+EK AR  IG  T   + N  +  K+I P   E   +Y RK ID+++LD++GHG+K
Sbjct:    6 MLLEEEIPGGRRALFDSYTNLERVADYCENNYIQSPDKQRALEETKAYTTQSLASVAYLINTLANNVLQMLDIQASQLRRMESSINHISQTVDIHKEKVARREIGILTT--NKNTSRTHKIIAPANLERPVRYIRKPIDYTILDDIGHGVK 154          

HSP 2 Score: 105.916 bits (263), Expect = 5.324e-23
Identity = 42/68 (61.76%), Postives = 58/68 (85.29%), Query Frame = 1
Query: 1336 SQVDDGWAPNQYICKVITLYEYQQNKDDELSFQEGELIYVVKKNNDGWWEGVMNGRTGLFPGNYVQNM 1539
            ++ D  WAP  Y+ KV+ +Y+Y ++K+DELSFQEG +IYV+KKN+DGW+EGVMNG TGLFPGNYV+++
Sbjct:  374 AEEDPPWAPRAYLEKVVAIYDYTKDKEDELSFQEGAIIYVIKKNDDGWYEGVMNGVTGLFPGNYVESI 441          
BLAST of Abl interactor 2 vs. UniProt/SwissProt
Match: sp|Q9NYB9|ABI2_HUMAN (Abl interactor 2 OS=Homo sapiens OX=9606 GN=ABI2 PE=1 SV=1)

HSP 1 Score: 118.242 bits (295), Expect = 6.426e-27
Identity = 64/151 (42.38%), Postives = 93/151 (61.59%), Query Frame = 1
Query:   58 ILLKEDIPNGTEDLINTSKTLEDVADHCLLTY------DRSLEQTVNYTAQALGSVAYKINLLATNFLEVLDKQNIKLNELQTKVNHLNMQVHIHQEKTARLSIGKYTMPRDPNVLKVSKVIEPLT-EIQGKYKRKEIDFSVLDNVGHGLK 489
            +LL+E+IP G   L ++   LE VAD+C   Y       R+LE+T  YT Q+L SVAY IN LA N L++LD Q  +L  +++ +NH++  V IH+EK AR  IG  T   + N  +  K+I P   E   +Y RK ID+++LD++GHG+K
Sbjct:    6 MLLEEEIPGGRRALFDSYTNLERVADYCENNYIQSADKQRALEETKAYTTQSLASVAYLINTLANNVLQMLDIQASQLRRMESSINHISQTVDIHKEKVARREIGILTT--NKNTSRTHKIIAPANLERPVRYIRKPIDYTILDDIGHGVK 154          

HSP 2 Score: 107.071 bits (266), Expect = 3.230e-23
Identity = 42/68 (61.76%), Postives = 58/68 (85.29%), Query Frame = 1
Query: 1336 SQVDDGWAPNQYICKVITLYEYQQNKDDELSFQEGELIYVVKKNNDGWWEGVMNGRTGLFPGNYVQNM 1539
            ++ D  WAP  Y+ KV+ +Y+Y ++K+DELSFQEG +IYV+KKN+DGW+EGVMNG TGLFPGNYV+++
Sbjct:  441 AEEDPPWAPRSYLEKVVAIYDYTKDKEDELSFQEGAIIYVIKKNDDGWYEGVMNGVTGLFPGNYVESI 508          
BLAST of Abl interactor 2 vs. UniProt/SwissProt
Match: sp|Q9QZM5|ABI1_RAT (Abl interactor 1 OS=Rattus norvegicus OX=10116 GN=Abi1 PE=1 SV=3)

HSP 1 Score: 117.087 bits (292), Expect = 1.302e-26
Identity = 65/151 (43.05%), Postives = 95/151 (62.91%), Query Frame = 1
Query:   58 ILLKEDIPNGTEDLINTSKTLEDVADHCLLTY------DRSLEQTVNYTAQALGSVAYKINLLATNFLEVLDKQNIKLNELQTKVNHLNMQVHIHQEKTARLSIGKYTMPRDPNVLKVSKVIEPL-TEIQGKYKRKEIDFSVLDNVGHGLK 489
            +LL+E+IP+G   LI + + L  VAD+C   Y       ++LE+T  YT Q+L SVAY+IN LA N L++LD Q  +L  +++ +NH++  V IH+EK AR  IG  T   + N  +  K+I P   E   +Y RK ID++VLD+VGHG+K
Sbjct:    6 MLLEEEIPSGKRALIESYQNLTRVADYCENNYIQATDKRKALEETKAYTTQSLASVAYQINALANNVLQLLDIQASQLRRMESSINHISQTVDIHKEKVARREIGILTT--NKNTSRTHKIIAPANMERPVRYIRKPIDYTVLDDVGHGVK 154          

HSP 2 Score: 102.449 bits (254), Expect = 9.340e-22
Identity = 41/65 (63.08%), Postives = 54/65 (83.08%), Query Frame = 1
Query: 1345 DDGWAPNQYICKVITLYEYQQNKDDELSFQEGELIYVVKKNNDGWWEGVMNGRTGLFPGNYVQNM 1539
            D  WAP  YI KV+ +Y+Y ++KDDELSF+EG +IYV+KKN+DGW+EGV N  TGLFPGNYV+++
Sbjct:  407 DPAWAPKNYIEKVVAIYDYTKDKDDELSFKEGAIIYVIKKNDDGWFEGVCNRVTGLFPGNYVESI 471          
BLAST of Abl interactor 2 vs. UniProt/SwissProt
Match: sp|Q8CBW3|ABI1_MOUSE (Abl interactor 1 OS=Mus musculus OX=10090 GN=Abi1 PE=1 SV=3)

HSP 1 Score: 117.087 bits (292), Expect = 1.368e-26
Identity = 65/151 (43.05%), Postives = 95/151 (62.91%), Query Frame = 1
Query:   58 ILLKEDIPNGTEDLINTSKTLEDVADHCLLTY------DRSLEQTVNYTAQALGSVAYKINLLATNFLEVLDKQNIKLNELQTKVNHLNMQVHIHQEKTARLSIGKYTMPRDPNVLKVSKVIEPL-TEIQGKYKRKEIDFSVLDNVGHGLK 489
            +LL+E+IP+G   LI + + L  VAD+C   Y       ++LE+T  YT Q+L SVAY+IN LA N L++LD Q  +L  +++ +NH++  V IH+EK AR  IG  T   + N  +  K+I P   E   +Y RK ID++VLD+VGHG+K
Sbjct:    6 MLLEEEIPSGKRALIESYQNLTRVADYCENNYIQATDKRKALEETKAYTTQSLASVAYQINALANNVLQLLDIQASQLRRMESSINHISQTVDIHKEKVARREIGILTT--NKNTSRTHKIIAPANMERPVRYIRKPIDYTVLDDVGHGVK 154          

HSP 2 Score: 102.064 bits (253), Expect = 1.260e-21
Identity = 41/65 (63.08%), Postives = 54/65 (83.08%), Query Frame = 1
Query: 1345 DDGWAPNQYICKVITLYEYQQNKDDELSFQEGELIYVVKKNNDGWWEGVMNGRTGLFPGNYVQNM 1539
            D  WAP  YI KV+ +Y+Y ++KDDELSF+EG +IYV+KKN+DGW+EGV N  TGLFPGNYV+++
Sbjct:  412 DPAWAPKNYIEKVVAIYDYTKDKDDELSFKEGAIIYVIKKNDDGWFEGVCNRVTGLFPGNYVESI 476          
BLAST of Abl interactor 2 vs. UniProt/SwissProt
Match: sp|Q8IZP0|ABI1_HUMAN (Abl interactor 1 OS=Homo sapiens OX=9606 GN=ABI1 PE=1 SV=4)

HSP 1 Score: 117.087 bits (292), Expect = 1.466e-26
Identity = 65/151 (43.05%), Postives = 95/151 (62.91%), Query Frame = 1
Query:   58 ILLKEDIPNGTEDLINTSKTLEDVADHCLLTY------DRSLEQTVNYTAQALGSVAYKINLLATNFLEVLDKQNIKLNELQTKVNHLNMQVHIHQEKTARLSIGKYTMPRDPNVLKVSKVIEPL-TEIQGKYKRKEIDFSVLDNVGHGLK 489
            +LL+E+IP+G   LI + + L  VAD+C   Y       ++LE+T  YT Q+L SVAY+IN LA N L++LD Q  +L  +++ +NH++  V IH+EK AR  IG  T   + N  +  K+I P   E   +Y RK ID++VLD+VGHG+K
Sbjct:    6 MLLEEEIPSGKRALIESYQNLTRVADYCENNYIQATDKRKALEETKAYTTQSLASVAYQINALANNVLQLLDIQASQLRRMESSINHISQTVDIHKEKVARREIGILTT--NKNTSRTHKIIAPANMERPVRYIRKPIDYTVLDDVGHGVK 154          

HSP 2 Score: 101.679 bits (252), Expect = 2.211e-21
Identity = 41/65 (63.08%), Postives = 53/65 (81.54%), Query Frame = 1
Query: 1345 DDGWAPNQYICKVITLYEYQQNKDDELSFQEGELIYVVKKNNDGWWEGVMNGRTGLFPGNYVQNM 1539
            D  WAP  YI KV+ +Y+Y ++KDDELSF EG +IYV+KKN+DGW+EGV N  TGLFPGNYV+++
Sbjct:  439 DPAWAPKNYIEKVVAIYDYTKDKDDELSFMEGAIIYVIKKNDDGWYEGVCNRVTGLFPGNYVESI 503          
BLAST of Abl interactor 2 vs. TrEMBL
Match: A0A3P7BEX1 (SH3 domain-containing protein OS=Schistocephalus solidus OX=70667 GN=SSLN_LOCUS202 PE=4 SV=1)

HSP 1 Score: 126.716 bits (317), Expect = 3.216e-29
Identity = 57/84 (67.86%), Postives = 68/84 (80.95%), Query Frame = 1
Query: 1282 TVGIAHLQPNPYDVLRVKSQVDDGWAPNQYICKVITLYEYQQNKDDELSFQEGELIYVVKKNNDGWWEGVMNGRTGLFPGNYVQ 1533
            TV I+ LQP+P D LR +   D  WAPNQYI KVIT+YEY  +K+DEL+F E ELIYV+KKN+DGWWEGVM+G TGLFPGNYV+
Sbjct:  166 TVDISRLQPSPMDQLRPRRPDDAPWAPNQYIQKVITVYEYTADKNDELTFGENELIYVIKKNDDGWWEGVMSGSTGLFPGNYVE 249          
BLAST of Abl interactor 2 vs. TrEMBL
Match: A0A183S7K4 (SH3 domain-containing protein OS=Schistocephalus solidus OX=70667 PE=4 SV=1)

HSP 1 Score: 126.716 bits (317), Expect = 3.620e-29
Identity = 57/84 (67.86%), Postives = 68/84 (80.95%), Query Frame = 1
Query: 1282 TVGIAHLQPNPYDVLRVKSQVDDGWAPNQYICKVITLYEYQQNKDDELSFQEGELIYVVKKNNDGWWEGVMNGRTGLFPGNYVQ 1533
            TV I+ LQP+P D LR +   D  WAPNQYI KVIT+YEY  +K+DEL+F E ELIYV+KKN+DGWWEGVM+G TGLFPGNYV+
Sbjct:  166 TVDISRLQPSPMDQLRPRRPDDAPWAPNQYIQKVITVYEYTADKNDELTFGENELIYVIKKNDDGWWEGVMSGSTGLFPGNYVE 249          
BLAST of Abl interactor 2 vs. TrEMBL
Match: A0A0V0JB58 (Zinc finger protein 330 OS=Schistocephalus solidus OX=70667 GN=ZN330 PE=4 SV=1)

HSP 1 Score: 127.872 bits (320), Expect = 3.025e-28
Identity = 57/85 (67.06%), Postives = 68/85 (80.00%), Query Frame = 1
Query: 1279 DTVGIAHLQPNPYDVLRVKSQVDDGWAPNQYICKVITLYEYQQNKDDELSFQEGELIYVVKKNNDGWWEGVMNGRTGLFPGNYVQ 1533
             TV I+ LQP+P D LR +   D  WAPNQYI KVIT+YEY  +K+DEL+F E ELIYV+KKN+DGWWEGVM+G TGLFPGNYV+
Sbjct:  324 STVDISRLQPSPMDQLRPRRPDDAPWAPNQYIQKVITVYEYTADKNDELTFGENELIYVIKKNDDGWWEGVMSGSTGLFPGNYVE 408          
BLAST of Abl interactor 2 vs. TrEMBL
Match: A0A0V0J3G4 (Zinc finger protein 330 (Fragment) OS=Schistocephalus solidus OX=70667 GN=ZN330 PE=4 SV=1)

HSP 1 Score: 129.413 bits (324), Expect = 6.659e-28
Identity = 57/85 (67.06%), Postives = 68/85 (80.00%), Query Frame = 1
Query: 1279 DTVGIAHLQPNPYDVLRVKSQVDDGWAPNQYICKVITLYEYQQNKDDELSFQEGELIYVVKKNNDGWWEGVMNGRTGLFPGNYVQ 1533
             TV I+ LQP+P D LR +   D  WAPNQYI KVIT+YEY  +K+DEL+F E ELIYV+KKN+DGWWEGVM+G TGLFPGNYV+
Sbjct:  512 STVDISRLQPSPMDQLRPRRPDDAPWAPNQYIQKVITVYEYTADKNDELTFGENELIYVIKKNDDGWWEGVMSGSTGLFPGNYVE 596          

HSP 2 Score: 95.5153 bits (236), Expect = 7.566e-17
Identity = 52/151 (34.44%), Postives = 88/151 (58.28%), Query Frame = 1
Query:   55 IILLKEDIPNGTEDLINTSKTLEDVADHCLLTYDRS------LEQTVNYTAQALGSVAYKINLLATNFLEVLDKQNIKLNELQTKVNHLNMQVHIHQEKTARLSIGKYTMPRDPNVLKVSKVIEPLTEIQGKYKRKEIDFSVLDNVGHGLK 489
            + ++ + + NG   L+ T+  +E  A +C   Y  S      + +T+NY  Q+LG++ ++++ LAT FL VLD++   L  ++ KV+ L M++ I QEK AR +IG  T+ + P     SK+ +   E    + R+ IDF+VLD++GHG K
Sbjct:   23 MFIMSDVVNNGKNALLQTAANIEQAAAYCSSNYLNSHNQKDAIGETMNYATQSLGTMIHQLSQLATTFLRVLDEKVDNLANIEDKVSKLGMELKIRQEKIARKAIGSCTVSKVPVKYAHSKLRQ---EPPADFIRRPIDFTVLDHIGHGFK 170          
BLAST of Abl interactor 2 vs. TrEMBL
Match: A0A0V0J558 (Zinc finger protein 330 (Fragment) OS=Schistocephalus solidus OX=70667 GN=ZN330 PE=4 SV=1)

HSP 1 Score: 129.413 bits (324), Expect = 7.007e-28
Identity = 57/85 (67.06%), Postives = 68/85 (80.00%), Query Frame = 1
Query: 1279 DTVGIAHLQPNPYDVLRVKSQVDDGWAPNQYICKVITLYEYQQNKDDELSFQEGELIYVVKKNNDGWWEGVMNGRTGLFPGNYVQ 1533
             TV I+ LQP+P D LR +   D  WAPNQYI KVIT+YEY  +K+DEL+F E ELIYV+KKN+DGWWEGVM+G TGLFPGNYV+
Sbjct:  520 STVDISRLQPSPMDQLRPRRPDDAPWAPNQYIQKVITVYEYTADKNDELTFGENELIYVIKKNDDGWWEGVMSGSTGLFPGNYVE 604          

HSP 2 Score: 95.5153 bits (236), Expect = 7.594e-17
Identity = 52/151 (34.44%), Postives = 88/151 (58.28%), Query Frame = 1
Query:   55 IILLKEDIPNGTEDLINTSKTLEDVADHCLLTYDRS------LEQTVNYTAQALGSVAYKINLLATNFLEVLDKQNIKLNELQTKVNHLNMQVHIHQEKTARLSIGKYTMPRDPNVLKVSKVIEPLTEIQGKYKRKEIDFSVLDNVGHGLK 489
            + ++ + + NG   L+ T+  +E  A +C   Y  S      + +T+NY  Q+LG++ ++++ LAT FL VLD++   L  ++ KV+ L M++ I QEK AR +IG  T+ + P     SK+ +   E    + R+ IDF+VLD++GHG K
Sbjct:   23 MFIMSDVVNNGKNALLQTAANIEQAAAYCSSNYLNSHNQKDAIGETMNYATQSLGTMIHQLSQLATTFLRVLDEKVDNLANIEDKVSKLGMELKIRQEKIARKAIGSCTVSKVPVKYAHSKLRQ---EPPADFIRRPIDFTVLDHIGHGFK 170          
BLAST of Abl interactor 2 vs. Ensembl Cavefish
Match: abi2b (abl interactor 2 [Source:NCBI gene;Acc:103021515])

HSP 1 Score: 118.242 bits (295), Expect = 7.338e-28
Identity = 65/151 (43.05%), Postives = 95/151 (62.91%), Query Frame = 1
Query:   58 ILLKEDIPNGTEDLINTSKTLEDVADHCLLTY------DRSLEQTVNYTAQALGSVAYKINLLATNFLEVLDKQNIKLNELQTKVNHLNMQVHIHQEKTARLSIGKYTMPRDPNVLKVSKVIEPLT-EIQGKYKRKEIDFSVLDNVGHGLK 489
            +LL+E+IP G   L+++   LE VA++C   Y       R+LE+T +YT Q+L SVAY IN LA N L++LD Q  +L  +++ +NH++  V IH+EK AR  IG  T   + N  +  K+I P   E   +Y RK ID+S+LD+VGHG+K
Sbjct:    6 MLLEEEIPAGRGALLDSYANLERVAEYCESNYIQSPDKQRALEETKSYTTQSLASVAYLINTLANNVLQMLDIQASQLRRMESSINHISQTVDIHKEKVARREIGILTT--NKNTSRTHKIIAPANPERPVRYIRKPIDYSLLDDVGHGVK 154          

HSP 2 Score: 107.842 bits (268), Expect = 1.769e-24
Identity = 46/83 (55.42%), Postives = 62/83 (74.70%), Query Frame = 1
Query: 1336 SQVDDGWAPNQYICKVITLYEYQQNKDDELSFQEGELIYVVKKNNDGWWEGVMNGRTGLFPGNYVQNMN*SHN*FIIIFYYAD 1584
            ++ D  WAP  Y+ KV+ +Y+Y ++K+DELSFQEG +IYV+KKN+DGW+EGVMNG TGLFPGNYV++          I +YAD
Sbjct:  424 AEEDPPWAPRSYMEKVVAIYDYARDKEDELSFQEGAIIYVIKKNDDGWYEGVMNGTTGLFPGNYVES----------IMHYAD 496          
BLAST of Abl interactor 2 vs. Ensembl Cavefish
Match: abi2b (abl interactor 2 [Source:NCBI gene;Acc:103021515])

HSP 1 Score: 118.627 bits (296), Expect = 9.621e-28
Identity = 65/151 (43.05%), Postives = 95/151 (62.91%), Query Frame = 1
Query:   58 ILLKEDIPNGTEDLINTSKTLEDVADHCLLTY------DRSLEQTVNYTAQALGSVAYKINLLATNFLEVLDKQNIKLNELQTKVNHLNMQVHIHQEKTARLSIGKYTMPRDPNVLKVSKVIEPLT-EIQGKYKRKEIDFSVLDNVGHGLK 489
            +LL+E+IP G   L+++   LE VA++C   Y       R+LE+T +YT Q+L SVAY IN LA N L++LD Q  +L  +++ +NH++  V IH+EK AR  IG  T   + N  +  K+I P   E   +Y RK ID+S+LD+VGHG+K
Sbjct:    6 MLLEEEIPAGRGALLDSYANLERVAEYCESNYIQSPDKQRALEETKSYTTQSLASVAYLINTLANNVLQMLDIQASQLRRMESSINHISQTVDIHKEKVARREIGILTT--NKNTSRTHKIIAPANPERPVRYIRKPIDYSLLDDVGHGVK 154          

HSP 2 Score: 108.612 bits (270), Expect = 1.831e-24
Identity = 46/83 (55.42%), Postives = 62/83 (74.70%), Query Frame = 1
Query: 1336 SQVDDGWAPNQYICKVITLYEYQQNKDDELSFQEGELIYVVKKNNDGWWEGVMNGRTGLFPGNYVQNMN*SHN*FIIIFYYAD 1584
            ++ D  WAP  Y+ KV+ +Y+Y ++K+DELSFQEG +IYV+KKN+DGW+EGVMNG TGLFPGNYV++          I +YAD
Sbjct:  495 AEEDPPWAPRSYMEKVVAIYDYARDKEDELSFQEGAIIYVIKKNDDGWYEGVMNGTTGLFPGNYVES----------IMHYAD 567          
BLAST of Abl interactor 2 vs. Ensembl Cavefish
Match: abi2b (abl interactor 2 [Source:NCBI gene;Acc:103021515])

HSP 1 Score: 118.627 bits (296), Expect = 1.053e-27
Identity = 65/151 (43.05%), Postives = 95/151 (62.91%), Query Frame = 1
Query:   58 ILLKEDIPNGTEDLINTSKTLEDVADHCLLTY------DRSLEQTVNYTAQALGSVAYKINLLATNFLEVLDKQNIKLNELQTKVNHLNMQVHIHQEKTARLSIGKYTMPRDPNVLKVSKVIEPLT-EIQGKYKRKEIDFSVLDNVGHGLK 489
            +LL+E+IP G   L+++   LE VA++C   Y       R+LE+T +YT Q+L SVAY IN LA N L++LD Q  +L  +++ +NH++  V IH+EK AR  IG  T   + N  +  K+I P   E   +Y RK ID+S+LD+VGHG+K
Sbjct:    6 MLLEEEIPAGRGALLDSYANLERVAEYCESNYIQSPDKQRALEETKSYTTQSLASVAYLINTLANNVLQMLDIQASQLRRMESSINHISQTVDIHKEKVARREIGILTT--NKNTSRTHKIIAPANPERPVRYIRKPIDYSLLDDVGHGVK 154          

HSP 2 Score: 108.227 bits (269), Expect = 2.532e-24
Identity = 46/83 (55.42%), Postives = 62/83 (74.70%), Query Frame = 1
Query: 1336 SQVDDGWAPNQYICKVITLYEYQQNKDDELSFQEGELIYVVKKNNDGWWEGVMNGRTGLFPGNYVQNMN*SHN*FIIIFYYAD 1584
            ++ D  WAP  Y+ KV+ +Y+Y ++K+DELSFQEG +IYV+KKN+DGW+EGVMNG TGLFPGNYV++          I +YAD
Sbjct:  501 AEEDPPWAPRSYMEKVVAIYDYARDKEDELSFQEGAIIYVIKKNDDGWYEGVMNGTTGLFPGNYVES----------IMHYAD 573          
BLAST of Abl interactor 2 vs. Ensembl Cavefish
Match: abi2b (abl interactor 2 [Source:NCBI gene;Acc:103021515])

HSP 1 Score: 118.242 bits (295), Expect = 1.140e-27
Identity = 65/151 (43.05%), Postives = 95/151 (62.91%), Query Frame = 1
Query:   58 ILLKEDIPNGTEDLINTSKTLEDVADHCLLTY------DRSLEQTVNYTAQALGSVAYKINLLATNFLEVLDKQNIKLNELQTKVNHLNMQVHIHQEKTARLSIGKYTMPRDPNVLKVSKVIEPLT-EIQGKYKRKEIDFSVLDNVGHGLK 489
            +LL+E+IP G   L+++   LE VA++C   Y       R+LE+T +YT Q+L SVAY IN LA N L++LD Q  +L  +++ +NH++  V IH+EK AR  IG  T   + N  +  K+I P   E   +Y RK ID+S+LD+VGHG+K
Sbjct:    6 MLLEEEIPAGRGALLDSYANLERVAEYCESNYIQSPDKQRALEETKSYTTQSLASVAYLINTLANNVLQMLDIQASQLRRMESSINHISQTVDIHKEKVARREIGILTT--NKNTSRTHKIIAPANPERPVRYIRKPIDYSLLDDVGHGVK 154          

HSP 2 Score: 107.457 bits (267), Expect = 3.413e-24
Identity = 46/83 (55.42%), Postives = 62/83 (74.70%), Query Frame = 1
Query: 1336 SQVDDGWAPNQYICKVITLYEYQQNKDDELSFQEGELIYVVKKNNDGWWEGVMNGRTGLFPGNYVQNMN*SHN*FIIIFYYAD 1584
            ++ D  WAP  Y+ KV+ +Y+Y ++K+DELSFQEG +IYV+KKN+DGW+EGVMNG TGLFPGNYV++          I +YAD
Sbjct:  472 AEEDPPWAPRSYMEKVVAIYDYARDKEDELSFQEGAIIYVIKKNDDGWYEGVMNGTTGLFPGNYVES----------IMHYAD 544          
BLAST of Abl interactor 2 vs. Ensembl Cavefish
Match: abi2b (abl interactor 2 [Source:NCBI gene;Acc:103021515])

HSP 1 Score: 117.472 bits (293), Expect = 1.448e-27
Identity = 65/151 (43.05%), Postives = 95/151 (62.91%), Query Frame = 1
Query:   58 ILLKEDIPNGTEDLINTSKTLEDVADHCLLTY------DRSLEQTVNYTAQALGSVAYKINLLATNFLEVLDKQNIKLNELQTKVNHLNMQVHIHQEKTARLSIGKYTMPRDPNVLKVSKVIEPLT-EIQGKYKRKEIDFSVLDNVGHGLK 489
            +LL+E+IP G   L+++   LE VA++C   Y       R+LE+T +YT Q+L SVAY IN LA N L++LD Q  +L  +++ +NH++  V IH+EK AR  IG  T   + N  +  K+I P   E   +Y RK ID+S+LD+VGHG+K
Sbjct:    6 MLLEEEIPAGRGALLDSYANLERVAEYCESNYIQSPDKQRALEETKSYTTQSLASVAYLINTLANNVLQMLDIQASQLRRMESSINHISQTVDIHKEKVARREIGILTT--NKNTSRTHKIIAPANPERPVRYIRKPIDYSLLDDVGHGVK 154          

HSP 2 Score: 107.071 bits (266), Expect = 3.782e-24
Identity = 46/83 (55.42%), Postives = 62/83 (74.70%), Query Frame = 1
Query: 1336 SQVDDGWAPNQYICKVITLYEYQQNKDDELSFQEGELIYVVKKNNDGWWEGVMNGRTGLFPGNYVQNMN*SHN*FIIIFYYAD 1584
            ++ D  WAP  Y+ KV+ +Y+Y ++K+DELSFQEG +IYV+KKN+DGW+EGVMNG TGLFPGNYV++          I +YAD
Sbjct:  452 AEEDPPWAPRSYMEKVVAIYDYARDKEDELSFQEGAIIYVIKKNDDGWYEGVMNGTTGLFPGNYVES----------IMHYAD 524          
BLAST of Abl interactor 2 vs. Ensembl Sea Lamprey
Match: ABI1 (abl interactor 1 [Source:HGNC Symbol;Acc:HGNC:11320])

HSP 1 Score: 104.375 bits (259), Expect = 3.780e-24
Identity = 41/66 (62.12%), Postives = 56/66 (84.85%), Query Frame = 1
Query: 1336 SQVDDGWAPNQYICKVITLYEYQQNKDDELSFQEGELIYVVKKNNDGWWEGVMNGRTGLFPGNYVQ 1533
            ++ D  WAP  Y+ KV+ +Y+Y ++K+DELSFQEG +IYV+KKN+DGW+EG MNG+TGLFPGNYV+
Sbjct:  382 AEADPPWAPKSYLEKVVAVYDYNKDKEDELSFQEGSIIYVIKKNDDGWYEGTMNGQTGLFPGNYVE 447          

HSP 2 Score: 98.5969 bits (244), Expect = 2.876e-22
Identity = 50/112 (44.64%), Postives = 75/112 (66.96%), Query Frame = 1
Query:  157 RSLEQTVNYTAQALGSVAYKINLLATNFLEVLDKQNIKLNELQTKVNHLNMQVHIHQEKTARLSIGKYTMPRDPNVLKVSKVIEPLT-EIQGKYKRKEIDFSVLDNVGHGLK 489
            R+LE+T  YT Q+L SVAY+IN LA N L++LD Q  +L ++++ +NH++  V IH+EK AR  IG  T   + N  +  K++ P+  E   +Y RK +D+S LD+VGHG+K
Sbjct:    7 RALEETKAYTTQSLASVAYQINTLANNVLQMLDIQASQLRKMESSINHISQTVDIHKEKVARREIGILTT--NKNTSRTHKILAPVNPERPVRYVRKPVDYSALDDVGHGVK 116          
BLAST of Abl interactor 2 vs. Ensembl Sea Lamprey
Match: ABI1 (abl interactor 1 [Source:HGNC Symbol;Acc:HGNC:11320])

HSP 1 Score: 101.679 bits (252), Expect = 3.092e-23
Identity = 46/80 (57.50%), Postives = 56/80 (70.00%), Query Frame = 1
Query: 1345 DDGWAPNQYICKVITLYEYQQNKDDELSFQEGELIYVVKKNNDGWWEGVMNGRTGLFPGNYVQNMN*SHN*FIIIFYYAD 1584
            D  WAP  YI KV+ +Y+Y Q+KDDELSF EG +IYVV+KN+DGW+EG  NG TGLFPGNYV+           I +YAD
Sbjct:  385 DPEWAPKIYIEKVVAVYDYVQDKDDELSFHEGSIIYVVRKNDDGWYEGATNGHTGLFPGNYVEP----------IMHYAD 454          

HSP 2 Score: 97.8265 bits (242), Expect = 5.050e-22
Identity = 49/112 (43.75%), Postives = 76/112 (67.86%), Query Frame = 1
Query:  157 RSLEQTVNYTAQALGSVAYKINLLATNFLEVLDKQNIKLNELQTKVNHLNMQVHIHQEKTARLSIGKYTMPRDPNVLKVSKVIEPLT-EIQGKYKRKEIDFSVLDNVGHGLK 489
            ++LE+T  YT Q+L SVAY+IN LA N L++LD Q  +L ++++ +NH++  V IH+EK AR  IG  T   + N  +  K++ P+  E   +Y RK +DF+VLD++GHG+K
Sbjct:    7 QALEETKAYTTQSLASVAYQINTLANNVLQMLDIQASQLGKMESAINHISQTVGIHKEKVARREIGILTT--NKNTTRTHKILAPVNPERPVRYVRKPLDFNVLDDIGHGMK 116          
BLAST of Abl interactor 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009021.1 (pep scaffold:Pmarinus_7.0:GL482604:596:7954:-1 gene:ENSPMAG00000008160.1 transcript:ENSPMAT00000009021.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 63.929 bits (154), Expect = 2.174e-11
Identity = 23/50 (46.00%), Postives = 37/50 (74.00%), Query Frame = 1
Query: 1393 YEYQQNKDDELSFQEGELIYVVKKNNDGWWEGVMNGRTGLFPGNYVQNMN 1542
            +++Q+N +DELSF +G++I V +  + GWWEG + GR+G FP NYV+ + 
Sbjct:   16 FDFQRNNEDELSFSKGDVITVTRPEDGGWWEGTLGGRSGWFPSNYVRELK 65          
BLAST of Abl interactor 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008112.1 (pep scaffold:Pmarinus_7.0:GL482163:8897:24902:-1 gene:ENSPMAG00000007333.1 transcript:ENSPMAT00000008112.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 61.6178 bits (148), Expect = 5.845e-11
Identity = 27/57 (47.37%), Postives = 40/57 (70.18%), Query Frame = 1
Query: 1375 CKVITLYEYQQNKDDELSFQEGELIYVVKKN--NDGWWEGVMNGRTGLFPGNYVQNM 1539
            CK +  YE Q N  DELS +EGEL+ ++ K+  + GWWEG +NG+ G+FP N+V+ +
Sbjct:    5 CKALFSYEAQNN--DELSLKEGELVEIIAKDCGDAGWWEGEVNGKRGVFPDNFVKLL 59          
BLAST of Abl interactor 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003067.1 (pep scaffold:Pmarinus_7.0:GL477025:38822:89389:-1 gene:ENSPMAG00000002795.1 transcript:ENSPMAT00000003067.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 62.7734 bits (151), Expect = 8.951e-11
Identity = 23/50 (46.00%), Postives = 35/50 (70.00%), Query Frame = 1
Query: 1393 YEYQQNKDDELSFQEGELIYVVKKNNDGWWEGVMNGRTGLFPGNYVQNMN 1542
            + +Q+  +DELSF++G++I V +  + GWWEG  NG TG FP NYV+ + 
Sbjct:  175 FTFQRTNEDELSFEKGDVITVTRVEHGGWWEGAFNGHTGWFPSNYVRELK 224          
BLAST of Abl interactor 2 vs. Ensembl Yeast
Match: LSB3 (Protein containing a C-terminal SH3 domain; binds Las17p, which is a homolog of human Wiskott-Aldrich Syndrome protein involved in actin patch assembly and actin polymerization; protein abundance increases in response to DNA replication stress; LSB3 has a paralog, YSC84, that arose from the whole genome duplication [Source:SGD;Acc:S000002968])

HSP 1 Score: 56.225 bits (134), Expect = 7.618e-9
Identity = 22/61 (36.07%), Postives = 40/61 (65.57%), Query Frame = 1
Query: 1357 APNQYICKVITLYEYQQNKDDELSFQEGELIYVVKKNN--DGWWEGVMNGRTGLFPGNYVQ 1533
            +P+    K + LY +   +  +L F++G++I ++KK++  + WW G +NGR G+FP NYV+
Sbjct:  397 SPSTSSPKAVALYSFAGEESGDLPFRKGDVITILKKSDSQNDWWTGRVNGREGIFPANYVE 457          
BLAST of Abl interactor 2 vs. Ensembl Yeast
Match: HSE1 (Subunit of the endosomal Vps27p-Hse1p complex; complex is required for sorting of ubiquitinated membrane proteins into intralumenal vesicles prior to vacuolar degradation, as well as for recycling of Golgi proteins and formation of lumenal membranes [Source:SGD;Acc:S000000994])

HSP 1 Score: 55.4546 bits (132), Expect = 1.258e-8
Identity = 22/53 (41.51%), Postives = 36/53 (67.92%), Query Frame = 1
Query: 1372 ICKVITLYEYQQNKDDELSFQEGELIYVVKKNNDGWWEGVMNGRTGLFPGNYV 1530
            + +V  LY+   N+ DELSF++G++I V+++    WW+G + G  G+FP NYV
Sbjct:  219 VRRVRALYDLTTNEPDELSFRKGDVITVLEQVYRDWWKGALRGNMGIFPLNYV 271          
BLAST of Abl interactor 2 vs. Ensembl Yeast
Match: RVS167 (Calmodulin-binding actin-associated protein; roles in endocytic membrane tabulation and constriction, and exocytosis; N-BAR domain protein that interacts with Rvs161p to regulate actin cytoskeleton, endocytosis, and viability following starvation or osmotic stress; recruited to bud tips by Gyl1p and Gyp5p during polarized growth; homolog of mammalian amphiphysin [Source:SGD;Acc:S000002796])

HSP 1 Score: 53.1434 bits (126), Expect = 6.862e-8
Identity = 25/53 (47.17%), Postives = 33/53 (62.26%), Query Frame = 1
Query: 1381 VITLYEYQQNKDDELSFQEGELIYVVKKNND--GWWEGVMNGRTGLFPGNYVQ 1533
            V  LY+YQ     +LSF  G +I +V++  D   WW G  NG+ G+FPGNYVQ
Sbjct:  426 VTALYDYQAQAAGDLSFPAGAVIEIVQRTPDVNEWWTGRYNGQQGVFPGNYVQ 478          
BLAST of Abl interactor 2 vs. Ensembl Yeast
Match: YSC84 (Actin-binding protein; involved in bundling of actin filaments and endocytosis of actin cortical patches; activity stimulated by Las17p; contains SH3 domain similar to Rvs167p; YSC84 has a paralog, LSB3, that arose from the whole genome duplication [Source:SGD;Acc:S000001058])

HSP 1 Score: 51.9878 bits (123), Expect = 1.631e-7
Identity = 21/61 (34.43%), Postives = 38/61 (62.30%), Query Frame = 1
Query: 1357 APNQYICKVITLYEYQQNKDDELSFQEGELIYVVKKNN--DGWWEGVMNGRTGLFPGNYVQ 1533
            A N      + LY +   +  +L+F++G++I ++KK++  + WW G  NG+ G+FP NYV+
Sbjct:  406 ATNSATPTAVALYNFAGEQPGDLAFKKGDVITILKKSDSQNDWWTGRTNGKEGIFPANYVR 466          
BLAST of Abl interactor 2 vs. Ensembl Yeast
Match: PIN3 (Negative regulator of actin nucleation-promoting factor activity; interacts with Las17p, a homolog of human Wiskott-Aldrich Syndrome protein (WASP), via an N-terminal SH3 domain, and along with LSB1 cooperatively inhibits the nucleation of actin filaments; short-lived protein whose levels increase in response to thermal stress; induces the formation of the [PIN+] and [RNQ+] prions when overproduced; PIN3 has a paralog, LSB1, that arose from the whole genome duplication [Source:SGD;Acc:S000006358])

HSP 1 Score: 48.9062 bits (115), Expect = 4.606e-7
Identity = 19/51 (37.25%), Postives = 34/51 (66.67%), Query Frame = 1
Query: 1381 VITLYEYQQNKDDELSFQEGELIYVVKKNNDGWWEGVMNGRTGLFPGNYVQ 1533
            V  LY++   +D +L  + G+ + +++K +  W++G  NGRTG+FP NYV+
Sbjct:   59 VEALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSCNGRTGIFPANYVK 109          
BLAST of Abl interactor 2 vs. Ensembl Nematostella
Match: EDO28105 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T7E6])

HSP 1 Score: 89.3521 bits (220), Expect = 8.607e-21
Identity = 53/160 (33.12%), Postives = 89/160 (55.62%), Query Frame = 1
Query:   61 LLKEDIPNGTEDLINTSKTLEDVADHCLLTYDRS--------------------LEQTVNYTAQALGSVAYKINLLATNFLEVLDKQNIKLNELQTKVNHLNMQVHIHQEKTARLSIGKYTMPRDPNVLKVSKVIEPLTEIQ-GKYKRKEIDFSVLDNVG 477
            L++++IP G + L +  + L  VA++C   Y                       L++T  +T Q+L SVAY+IN LA N L +LD+Q  +L  +++K+N+++  V+IH+EK AR  IG   +    N  +  K+I P  + +  +Y RK ID+S+LD++G
Sbjct:   11 LIEKEIPEGRQALRDGHENLARVANYCQQKYSDCSNRYKTSPDKKKVLEESKAVLDETKQFTTQSLASVAYQINSLAVNMLNLLDQQVSQLQTMESKINYISETVNIHKEKVARREIG--VLATSKNTSRTHKIIAPAKQEKPERYSRKPIDYSILDDIG 168          
BLAST of Abl interactor 2 vs. Ensembl Nematostella
Match: EDO33141 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7ST28])

HSP 1 Score: 88.5817 bits (218), Expect = 1.376e-20
Identity = 52/160 (32.50%), Postives = 88/160 (55.00%), Query Frame = 1
Query:   61 LLKEDIPNGTEDLINTSKTLEDVADHCLLTYDRS--------------------LEQTVNYTAQALGSVAYKINLLATNFLEVLDKQNIKLNELQTKVNHLNMQVHIHQEKTARLSIGKYTMPRDPNVLKVSKVIEPLTEIQ-GKYKRKEIDFSVLDNVG 477
            L++++IP G + L +  + L  VA++C   Y                        ++T  +T Q+L SVAY+IN LA N L +LD+Q  +L  +++K+N+++  V+IH+EK AR  IG   +    N  +  K+I P  + +  +Y RK ID+S+LD++G
Sbjct:    4 LIEKEIPEGRQALRDGHENLAKVANYCQQKYSDCSNRYKTSPDKKKVLEESKAVFDETKQFTTQSLASVAYQINSLAVNMLNLLDQQVSQLQTMESKINYISETVNIHKEKIARREIG--VLATSKNTSRTHKIIAPAKQEKPERYSRKPIDYSILDDIG 161          
BLAST of Abl interactor 2 vs. Ensembl Nematostella
Match: EDO38147 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDP5])

HSP 1 Score: 82.0333 bits (201), Expect = 4.762e-19
Identity = 37/63 (58.73%), Postives = 48/63 (76.19%), Query Frame = 1
Query: 1348 DGWAPNQYICKVITLYEYQQNKDDELSFQEGELIYVVKKNNDGWWEGV-MNGRTGLFPGNYVQ 1533
            DG  P  ++ KVI LY+Y   +DDEL+F E  +IYV+KKN+DGW+EGV  +G TGLFPGNYV+
Sbjct:   36 DGGVPADFLEKVIALYDYNATRDDELTFAENTIIYVIKKNDDGWYEGVTTDGLTGLFPGNYVE 98          
BLAST of Abl interactor 2 vs. Ensembl Nematostella
Match: EDO38999 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBA8])

HSP 1 Score: 63.929 bits (154), Expect = 1.432e-10
Identity = 27/61 (44.26%), Postives = 41/61 (67.21%), Query Frame = 1
Query: 1369 YICKVITLYEYQQNKDDELSFQEGELIYVVKKN----NDGWWEGVMNGRTGLFPGNYVQNM 1539
            Y+C V  LY+Y+   D+ELSF EG+ IYV K++    +DG+WEG ++G  G+FP   V+ +
Sbjct:  650 YLCMVRALYDYEAMSDEELSFNEGDTIYVTKQDDHGVDDGFWEGYIDGHKGVFPSLVVEEI 710          
BLAST of Abl interactor 2 vs. Ensembl Nematostella
Match: EDO42689 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0K6])

HSP 1 Score: 60.4622 bits (145), Expect = 9.379e-10
Identity = 25/54 (46.30%), Postives = 38/54 (70.37%), Query Frame = 1
Query: 1381 VITLYEYQQNKDDELSFQEGELIYVVKKNND-GWWEGVMNGRTGLFPGNYVQNM 1539
            V+ LY+Y+  +DDELSF+ GE++  + + +D GW  G +N RTGLFP  YV+ +
Sbjct:  386 VLALYDYEAAEDDELSFKAGEIVTKLSERDDQGWCRGRINHRTGLFPAEYVEAL 439          
BLAST of Abl interactor 2 vs. Ensembl Medaka
Match: abi2b (abl interactor 2 [Source:NCBI gene;Acc:101169339])

HSP 1 Score: 118.627 bits (296), Expect = 3.668e-29
Identity = 64/151 (42.38%), Postives = 95/151 (62.91%), Query Frame = 1
Query:   58 ILLKEDIPNGTEDLINTSKTLEDVADHCLLTY------DRSLEQTVNYTAQALGSVAYKINLLATNFLEVLDKQNIKLNELQTKVNHLNMQVHIHQEKTARLSIGKYTMPRDPNVLKVSKVIEPLT-EIQGKYKRKEIDFSVLDNVGHGLK 489
            +LL+E+IP G   L+++   LE VA++C   Y       R+LE+T NYT Q+L SVAY IN LA N L++LD Q  +L  +++ +NH++  V IH+EK AR  IG  T   + N  +  K+I P   E   +Y RK +D+S+LD++GHG+K
Sbjct:   37 MLLEEEIPAGRSALLDSFTNLERVAEYCESNYVQSPDKQRALEETKNYTTQSLASVAYLINTLANNVLQMLDIQASQLRRMESSINHISQTVDIHKEKVARREIGILTT--NKNTSRTHKIIAPANPERPVRYIRKPVDYSLLDDMGHGVK 185          
BLAST of Abl interactor 2 vs. Ensembl Medaka
Match: abi2b (abl interactor 2 [Source:NCBI gene;Acc:101169339])

HSP 1 Score: 118.242 bits (295), Expect = 5.872e-28
Identity = 64/151 (42.38%), Postives = 95/151 (62.91%), Query Frame = 1
Query:   58 ILLKEDIPNGTEDLINTSKTLEDVADHCLLTY------DRSLEQTVNYTAQALGSVAYKINLLATNFLEVLDKQNIKLNELQTKVNHLNMQVHIHQEKTARLSIGKYTMPRDPNVLKVSKVIEPLT-EIQGKYKRKEIDFSVLDNVGHGLK 489
            +LL+E+IP G   L+++   LE VA++C   Y       R+LE+T NYT Q+L SVAY IN LA N L++LD Q  +L  +++ +NH++  V IH+EK AR  IG  T   + N  +  K+I P   E   +Y RK +D+S+LD++GHG+K
Sbjct:    6 MLLEEEIPAGRSALLDSFTNLERVAEYCESNYVQSPDKQRALEETKNYTTQSLASVAYLINTLANNVLQMLDIQASQLRRMESSINHISQTVDIHKEKVARREIGILTT--NKNTSRTHKIIAPANPERPVRYIRKPVDYSLLDDMGHGVK 154          

HSP 2 Score: 106.686 bits (265), Expect = 3.618e-24
Identity = 46/83 (55.42%), Postives = 62/83 (74.70%), Query Frame = 1
Query: 1336 SQVDDGWAPNQYICKVITLYEYQQNKDDELSFQEGELIYVVKKNNDGWWEGVMNGRTGLFPGNYVQNMN*SHN*FIIIFYYAD 1584
            ++ D  WAP  Y+ KV+ +Y+Y ++K+DELSFQEG +IYV+KKN+DGW+EGVMNG TGLFPGNYV++          I +YAD
Sbjct:  411 AEEDPPWAPRTYMEKVVAIYDYTRDKEDELSFQEGSIIYVIKKNDDGWFEGVMNGTTGLFPGNYVES----------IMHYAD 483          
BLAST of Abl interactor 2 vs. Ensembl Medaka
Match: ENSORLT00000017876.2 (abl interactor 2 [Source:NCBI gene;Acc:101175519])

HSP 1 Score: 117.472 bits (293), Expect = 9.796e-28
Identity = 65/152 (42.76%), Postives = 96/152 (63.16%), Query Frame = 1
Query:   58 ILLKEDIPNGTEDLINTSKTLEDVADHCLLTYDRS------LEQTVNYTAQALGSVAYKINLLATNFLEVLDKQNIKLNELQTKVNHLNMQVHIHQEKTARLSIGKYTMPRDPNVLKVSKVIEPLT-EIQGKYKRKEIDFSVLDNVGHGLKE 492
            +LL+E+IP G   L+++   LE VA++C   Y +S      LE+T NYT Q+L SVAY IN LA N L++LD Q  +L  +++ VNH++  V IH+EK AR  IG  T   + N  +  K++ P   E   +Y RK ID++VLD++GHG+K+
Sbjct:    6 MLLEEEIPAGRRALLDSFTNLERVAEYCESNYVQSADKQQALEETKNYTTQSLASVAYLINTLANNVLQMLDIQASQLRRMESSVNHISQTVDIHKEKVARREIGILTT--NKNTCRSHKIVAPSNPERPVRYIRKPIDYNVLDDIGHGVKQ 155          

HSP 2 Score: 104.375 bits (259), Expect = 2.131e-23
Identity = 46/83 (55.42%), Postives = 59/83 (71.08%), Query Frame = 1
Query: 1336 SQVDDGWAPNQYICKVITLYEYQQNKDDELSFQEGELIYVVKKNNDGWWEGVMNGRTGLFPGNYVQNMN*SHN*FIIIFYYAD 1584
            ++ D  WAP  Y+ KV+ +Y+Y  +K+DELSFQEG +IYVVKKN DGW+EGVMN  TGLFPGNYV++          I +YAD
Sbjct:  392 AEEDPPWAPRSYVEKVVAIYDYTADKEDELSFQEGAIIYVVKKNEDGWFEGVMNATTGLFPGNYVES----------IMHYAD 464          
BLAST of Abl interactor 2 vs. Ensembl Medaka
Match: ABI1 (abl interactor 1 [Source:NCBI gene;Acc:101170628])

HSP 1 Score: 115.546 bits (288), Expect = 4.304e-27
Identity = 62/152 (40.79%), Postives = 94/152 (61.84%), Query Frame = 1
Query:   58 ILLKEDIPNGTEDLINTSKTLEDVADHCLLTY------DRSLEQTVNYTAQALGSVAYKINLLATNFLEVLDKQNIKLNELQTKVNHLNMQVHIHQEKTARLSIGKYTMPRDPNVLKVSKVIEPL-TEIQGKYKRKEIDFSVLDNVGHGLKE 492
            +LL E+IP G   L+ + + L  VAD+C   Y       ++LE+T  YT Q+L SVAY+IN LA N L++LD Q  +L  +++ +NH++  V IH+EK AR  IG  T   + N  +  K++ P   E   +Y RK +D++VLD+VGHG+K+
Sbjct:    6 MLLDEEIPAGKRALVESYQNLTRVADYCENNYVQAEDKRKALEETKAYTTQSLASVAYQINALANNVLQLLDIQASQLRRMESSINHISQTVDIHKEKVARREIGILTT--NKNTTRTHKIVAPANIERPVRYIRKPVDYTVLDDVGHGIKQ 155          

HSP 2 Score: 99.7525 bits (247), Expect = 6.291e-22
Identity = 46/80 (57.50%), Postives = 57/80 (71.25%), Query Frame = 1
Query: 1345 DDGWAPNQYICKVITLYEYQQNKDDELSFQEGELIYVVKKNNDGWWEGVMNGRTGLFPGNYVQNMN*SHN*FIIIFYYAD 1584
            D  WAP  YI KV+ +Y+Y ++K+DELSF EG +IYVVKKN+DGW+EGV NG TGLFPGNYV+           I +YAD
Sbjct:  396 DPQWAPKNYIEKVVAIYDYAKDKNDELSFLEGAIIYVVKKNDDGWFEGVSNGVTGLFPGNYVEP----------IMHYAD 465          
BLAST of Abl interactor 2 vs. Ensembl Medaka
Match: ABI1 (abl interactor 1 [Source:NCBI gene;Acc:101170628])

HSP 1 Score: 116.701 bits (291), Expect = 4.605e-27
Identity = 62/152 (40.79%), Postives = 94/152 (61.84%), Query Frame = 1
Query:   58 ILLKEDIPNGTEDLINTSKTLEDVADHCLLTY------DRSLEQTVNYTAQALGSVAYKINLLATNFLEVLDKQNIKLNELQTKVNHLNMQVHIHQEKTARLSIGKYTMPRDPNVLKVSKVIEPLT-EIQGKYKRKEIDFSVLDNVGHGLKE 492
            +LL E+IP G   L+ + + L  VAD+C   Y       ++LE+T  YT Q+L SVAY+IN LA N L++LD Q  +L  +++ +NH++  V IH+EK AR  IG  T   + N  +  K++ P   E   +Y RK +D++VLD+VGHG+K+
Sbjct:    6 MLLDEEIPAGKRALVESYQNLTRVADYCENNYVQAEDKRKALEETKAYTTQSLASVAYQINALANNVLQLLDIQASQLRRMESSINHISQTVDIHKEKVARREIGILTT--NKNTTRTHKIVAPANIERPVRYIRKPVDYTVLDDVGHGIKQ 155          
BLAST of Abl interactor 2 vs. Planmine SMEST
Match: SMESG000055438.1 (SMESG000055438.1)

HSP 1 Score: 826.624 bits (2134), Expect = 0.000e+0
Identity = 505/506 (99.80%), Postives = 505/506 (99.80%), Query Frame = 1
Query:   25 MGTEFLPKDYIILLKEDIPNGTEDLINTSKTLEDVADHCLLTYDRSLEQTVNYTAQALGSVAYKINLLATNFLEVLDKQNIKLNELQTKVNHLNMQVHIHQEKTARLSIGKYTMPRDPNVLKVSKVIEPLTEIQGKYKRKEIDFSVLDNVGHGLKEPQLGTSGVFXXXXXXXXXXXXXXXXXXXVYTHSNIGGSISSKAVPDYMKLGKAQTIGRTGGLNINNPSNTIYRAPANLTQRSQIPMPSPNLNSGNGMAAPQALNYGNTMQYXXXXXXXXXXXXXXXXXXXXXXXXXXXKQYQPPANVVSPHKMSVGSIQGNTPPYGYSGMNHPMAHIXXXXXXVVTNQQEQNISPMMRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVDQFQRPVNNEQFQRLPNNEQEYIDKNQGRYISDTVGIAHLQPNPYDVLRVKSQVDDGWAPNQYICKVITLYEYQQNKDDELSFQEGELIYVVKKNNDGWWEGVMNGRTGLFPGNYVQNMN 1542
            MGTEFLPKDYIILLKEDIPNGTEDLINTSKTLEDVADHCLLTYDRSLEQTVNYTAQALGSVAYKINLLATNFLEVLDKQNIKLNELQTKVNHLNMQVHIHQEKTARLSIGKYTMPRDPNVLKVSKVIEPLTEIQGKYKRKEIDFSVLDNVGHGLKEPQLGTSGVFSNTSRRSSTSGSDTHSSSHVYTHSNIGGSISSKAVPDYMKLGKAQTIGRTGGLNINNPSNTIYRAPANLTQRSQIPMPSPNLNSGNGMAAPQALNYGNTMQYQQQISQGTRRSSSTSTSTSGSTQMQQQKQYQPPANVVSPHKMSVGSIQGNTPPYGYSGMNHPMAHIPPPPPPVVTNQQEQNISPMMRYNELPPPPLEPPSPYQQQSQQNMNMLPPPPNVDQFQRPVNNEQFQR PNNEQEYIDKNQGRYISDTVGIAHLQPNPYDVLRVKSQVDDGWAPNQYICKVITLYEYQQNKDDELSFQEGELIYVVKKNNDGWWEGVMNGRTGLFPGNYVQNMN
Sbjct:    1 MGTEFLPKDYIILLKEDIPNGTEDLINTSKTLEDVADHCLLTYDRSLEQTVNYTAQALGSVAYKINLLATNFLEVLDKQNIKLNELQTKVNHLNMQVHIHQEKTARLSIGKYTMPRDPNVLKVSKVIEPLTEIQGKYKRKEIDFSVLDNVGHGLKEPQLGTSGVFSNTSRRSSTSGSDTHSSSHVYTHSNIGGSISSKAVPDYMKLGKAQTIGRTGGLNINNPSNTIYRAPANLTQRSQIPMPSPNLNSGNGMAAPQALNYGNTMQYQQQISQGTRRSSSTSTSTSGSTQMQQQKQYQPPANVVSPHKMSVGSIQGNTPPYGYSGMNHPMAHIPPPPPPVVTNQQEQNISPMMRYNELPPPPLEPPSPYQQQSQQNMNMLPPPPNVDQFQRPVNNEQFQRPPNNEQEYIDKNQGRYISDTVGIAHLQPNPYDVLRVKSQVDDGWAPNQYICKVITLYEYQQNKDDELSFQEGELIYVVKKNNDGWWEGVMNGRTGLFPGNYVQNMN 506          
BLAST of Abl interactor 2 vs. Planmine SMEST
Match: SMESG000055438.1 (SMESG000055438.1)

HSP 1 Score: 818.92 bits (2114), Expect = 0.000e+0
Identity = 501/506 (99.01%), Postives = 504/506 (99.60%), Query Frame = 1
Query:   25 MGTEFLPKDYIILLKEDIPNGTEDLINTSKTLEDVADHCLLTYDRSLEQTVNYTAQALGSVAYKINLLATNFLEVLDKQNIKLNELQTKVNHLNMQVHIHQEKTARLSIGKYTMPRDPNVLKVSKVIEPLTEIQGKYKRKEIDFSVLDNVGHGLKEPQLGTSGVFXXXXXXXXXXXXXXXXXXXVYTHSNIGGSISSKAVPDYMKLGKAQTIGRTGGLNINNPSNTIYRAPANLTQRSQIPMPSPNLNSGNGMAAPQALNYGNTMQYXXXXXXXXXXXXXXXXXXXXXXXXXXXKQYQPPANVVSPHKMSVGSIQGNTPPYGYSGMNHPMAHIXXXXXXVVTNQQEQNISPMMRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVDQFQRPVNNEQFQRLPNNEQEYIDKNQGRYISDTVGIAHLQPNPYDVLRVKSQVDDGWAPNQYICKVITLYEYQQNKDDELSFQEGELIYVVKKNNDGWWEGVMNGRTGLFPGNYVQNMN 1542
            MGTEFLPKDYIILLKEDIPNGTEDLINTSKTLEDVADHCLLTYDRSLEQTVNYTAQALGSVAYKINLLATNFLEVLDKQNIKLNELQTKVNHLNMQVHIHQEKTARLSIGKYTMPRDPNVLKVSKVIEPLTEIQGKYKRKEIDFSVLDNVGHGLKEPQLGTSGVFSNTSRRSSTSGSDTHSSSHVYTHSNIGGSISSKAVPDYMKLGKAQTIGRTGGLNINNPSNTIYRAPANLTQRSQIPMPSPNLNSGNGMAAPQALNYGNTMQYQQQISQGTRRSSSTSTSTSGSTQMQQQKQYQPPANVVSPHKMSVGSIQGNTPPYGYSGMNHPMAHIPPPPPPVVTNQQEQNISPMMRYNELPPPPLEPPSPYQQQSQQNMNMLPPPPNVDQFQRPVNNEQFQR PNNEQEYIDKNQGRYISDTVGIAHLQPNPYDVLRVKSQVDDGWAPNQYICKVITL++Y+QNKDDELSFQEGELIYVVKKN DGWWEGVMNGRTGLFPGNYVQNMN
Sbjct:    1 MGTEFLPKDYIILLKEDIPNGTEDLINTSKTLEDVADHCLLTYDRSLEQTVNYTAQALGSVAYKINLLATNFLEVLDKQNIKLNELQTKVNHLNMQVHIHQEKTARLSIGKYTMPRDPNVLKVSKVIEPLTEIQGKYKRKEIDFSVLDNVGHGLKEPQLGTSGVFSNTSRRSSTSGSDTHSSSHVYTHSNIGGSISSKAVPDYMKLGKAQTIGRTGGLNINNPSNTIYRAPANLTQRSQIPMPSPNLNSGNGMAAPQALNYGNTMQYQQQISQGTRRSSSTSTSTSGSTQMQQQKQYQPPANVVSPHKMSVGSIQGNTPPYGYSGMNHPMAHIPPPPPPVVTNQQEQNISPMMRYNELPPPPLEPPSPYQQQSQQNMNMLPPPPNVDQFQRPVNNEQFQRPPNNEQEYIDKNQGRYISDTVGIAHLQPNPYDVLRVKSQVDDGWAPNQYICKVITLHKYEQNKDDELSFQEGELIYVVKKNIDGWWEGVMNGRTGLFPGNYVQNMN 506          
BLAST of Abl interactor 2 vs. Planmine SMEST
Match: SMESG000032406.1 (SMESG000032406.1)

HSP 1 Score: 62.3882 bits (150), Expect = 8.566e-11
Identity = 26/59 (44.07%), Postives = 40/59 (67.80%), Query Frame = 1
Query: 1363 NQYICKVITLYEYQQNKDDELSFQEGELIYVVKKNNDGWWEGVMNGRTGLFPGNYVQNM 1539
            N+  CK   L++++    +ELSFQEG++I + +K ND WWEG +NG+ GL P +YV  +
Sbjct:  165 NREKCKA--LHDFEARDQEELSFQEGDVITIKRKINDIWWEGELNGKIGLIPKDYVNEL 221          
BLAST of Abl interactor 2 vs. Planmine SMEST
Match: SMESG000073128.1 (SMESG000073128.1)

HSP 1 Score: 59.3066 bits (142), Expect = 6.688e-9
Identity = 25/51 (49.02%), Postives = 36/51 (70.59%), Query Frame = 1
Query: 1381 VITLYEYQQNKDDELSFQEGELIYVVKKNNDGWWEG-VMNGRTGLFPGNYV 1530
            V+ +Y Y   +DDE+SF+EGE IY V + ++GWW+G   +G  G+FP NYV
Sbjct:  645 VVAVYSYHALQDDEISFEEGEHIYNVNQIDEGWWQGETKDGDKGMFPSNYV 695          

HSP 2 Score: 52.373 bits (124), Expect = 8.182e-7
Identity = 26/78 (33.33%), Postives = 42/78 (53.85%), Query Frame = 1
Query: 1303 QPNPYDVLRVKSQVDDGWAPNQYICKVITLYEYQQNKDDELSFQEGELIYVVKKNNDGWWEGV-MNGRTGLFPGNYVQ 1533
            Q N  D   V  +  D   P     K +  +EY+    DE+ F+ GE+I  +++ ++GWW G   +G+ G+FP NYV+
Sbjct:  535 QNNKIDTKSVHLENQDTKTPKTKSAKAV--FEYECQDSDEIDFEVGEIITDIEEIDEGWWIGCNKSGKRGMFPSNYVE 610          
BLAST of Abl interactor 2 vs. Planmine SMEST
Match: SMESG000068232.1 (SMESG000068232.1)

HSP 1 Score: 58.9214 bits (141), Expect = 1.100e-8
Identity = 24/54 (44.44%), Postives = 36/54 (66.67%), Query Frame = 1
Query: 1378 KVITLYEYQQNKDDELSFQEGELIYVVKKNNDGWWEGVMNGRTGLFPGNYVQNM 1539
            +V  LY Y+    DELS   G++I +V+++N+GWW G +  RTGL P NYV+ +
Sbjct: 1050 RVEALYAYEATDTDELSIYPGDIIELVREDNEGWWTGKIGNRTGLIPSNYVKKI 1103          
The following BLAST results are available for this feature:
BLAST of Abl interactor 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ABI29.032e-2842.38abl interactor 2 [Source:HGNC Symbol;Acc:HGNC:2401... [more]
ABI21.037e-2742.38abl interactor 2 [Source:HGNC Symbol;Acc:HGNC:2401... [more]
ABI21.084e-2742.38abl interactor 2 [Source:HGNC Symbol;Acc:HGNC:2401... [more]
ABI21.220e-2742.38abl interactor 2 [Source:HGNC Symbol;Acc:HGNC:2401... [more]
ABI21.220e-2742.38abl interactor 2 [Source:HGNC Symbol;Acc:HGNC:2401... [more]
back to top
BLAST of Abl interactor 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
abi-12.434e-1935.33ABl Interactor homolog [Source:UniProtKB/TrEMBL;A... [more]
abi-12.434e-1935.33ABl Interactor homolog [Source:UniProtKB/TrEMBL;A... [more]
hum-12.571e-950.98Heavy chain, Unconventional Myosin [Source:UniPro... [more]
mlk-13.567e-934.78Mitogen-activated protein kinase kinase kinase mlk... [more]
mlk-14.052e-934.78Mitogen-activated protein kinase kinase kinase mlk... [more]
back to top
BLAST of Abl interactor 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Abi3.457e-2539.41gene:FBgn0020510 transcript:FBtr0307077[more]
Abi3.465e-2539.41gene:FBgn0020510 transcript:FBtr0307076[more]
Abi3.465e-2539.41gene:FBgn0020510 transcript:FBtr0337096[more]
Abi3.496e-2539.41gene:FBgn0020510 transcript:FBtr0337097[more]
Abi3.496e-2539.41gene:FBgn0020510 transcript:FBtr0082910[more]
back to top
BLAST of Abl interactor 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
abi2a4.815e-2842.38abl-interactor 2a [Source:ZFIN;Acc:ZDB-GENE-060929... [more]
abi2b8.836e-2843.05abl-interactor 2b [Source:ZFIN;Acc:ZDB-GENE-060519... [more]
abi2b1.112e-2743.05abl-interactor 2b [Source:ZFIN;Acc:ZDB-GENE-060519... [more]
abi2a1.155e-2742.38abl-interactor 2a [Source:ZFIN;Acc:ZDB-GENE-060929... [more]
abi2b1.493e-2743.05abl-interactor 2b [Source:ZFIN;Acc:ZDB-GENE-060519... [more]
back to top
BLAST of Abl interactor 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
abi21.325e-2742.38abl-interactor 2 [Source:NCBI gene;Acc:548798][more]
abi21.448e-2742.38abl-interactor 2 [Source:NCBI gene;Acc:548798][more]
abi21.766e-2742.38abl-interactor 2 [Source:NCBI gene;Acc:548798][more]
abi12.653e-2743.05abl interactor 1 [Source:NCBI gene;Acc:493216][more]
abi22.782e-2742.38abl-interactor 2 [Source:NCBI gene;Acc:548798][more]
back to top
BLAST of Abl interactor 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Abi26.499e-2842.38abl-interactor 2 [Source:MGI Symbol;Acc:MGI:106913... [more]
Abi28.121e-2842.38abl-interactor 2 [Source:MGI Symbol;Acc:MGI:106913... [more]
Abi28.483e-2842.38abl-interactor 2 [Source:MGI Symbol;Acc:MGI:106913... [more]
Abi29.925e-2842.38abl-interactor 2 [Source:MGI Symbol;Acc:MGI:106913... [more]
Abi11.019e-2743.05abl-interactor 1 [Source:MGI Symbol;Acc:MGI:104913... [more]
back to top
BLAST of Abl interactor 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P62484|ABI2_MOUSE5.681e-2742.38Abl interactor 2 OS=Mus musculus OX=10090 GN=Abi2 ... [more]
sp|Q9NYB9|ABI2_HUMAN6.426e-2742.38Abl interactor 2 OS=Homo sapiens OX=9606 GN=ABI2 P... [more]
sp|Q9QZM5|ABI1_RAT1.302e-2643.05Abl interactor 1 OS=Rattus norvegicus OX=10116 GN=... [more]
sp|Q8CBW3|ABI1_MOUSE1.368e-2643.05Abl interactor 1 OS=Mus musculus OX=10090 GN=Abi1 ... [more]
sp|Q8IZP0|ABI1_HUMAN1.466e-2643.05Abl interactor 1 OS=Homo sapiens OX=9606 GN=ABI1 P... [more]
back to top
BLAST of Abl interactor 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3P7BEX13.216e-2967.86SH3 domain-containing protein OS=Schistocephalus s... [more]
A0A183S7K43.620e-2967.86SH3 domain-containing protein OS=Schistocephalus s... [more]
A0A0V0JB583.025e-2867.06Zinc finger protein 330 OS=Schistocephalus solidus... [more]
A0A0V0J3G46.659e-2867.06Zinc finger protein 330 (Fragment) OS=Schistocepha... [more]
A0A0V0J5587.007e-2867.06Zinc finger protein 330 (Fragment) OS=Schistocepha... [more]
back to top
BLAST of Abl interactor 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
abi2b7.338e-2843.05abl interactor 2 [Source:NCBI gene;Acc:103021515][more]
abi2b9.621e-2843.05abl interactor 2 [Source:NCBI gene;Acc:103021515][more]
abi2b1.053e-2743.05abl interactor 2 [Source:NCBI gene;Acc:103021515][more]
abi2b1.140e-2743.05abl interactor 2 [Source:NCBI gene;Acc:103021515][more]
abi2b1.448e-2743.05abl interactor 2 [Source:NCBI gene;Acc:103021515][more]
back to top
BLAST of Abl interactor 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ABI13.780e-2462.12abl interactor 1 [Source:HGNC Symbol;Acc:HGNC:1132... [more]
ABI13.092e-2357.50abl interactor 1 [Source:HGNC Symbol;Acc:HGNC:1132... [more]
ENSPMAT00000009021.12.174e-1146.00pep scaffold:Pmarinus_7.0:GL482604:596:7954:-1 gen... [more]
ENSPMAT00000008112.15.845e-1147.37pep scaffold:Pmarinus_7.0:GL482163:8897:24902:-1 g... [more]
ENSPMAT00000003067.18.951e-1146.00pep scaffold:Pmarinus_7.0:GL477025:38822:89389:-1 ... [more]
back to top
BLAST of Abl interactor 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
LSB37.618e-936.07Protein containing a C-terminal SH3 domain; binds ... [more]
HSE11.258e-841.51Subunit of the endosomal Vps27p-Hse1p complex; com... [more]
RVS1676.862e-847.17Calmodulin-binding actin-associated protein; roles... [more]
YSC841.631e-734.43Actin-binding protein; involved in bundling of act... [more]
PIN34.606e-737.25Negative regulator of actin nucleation-promoting f... [more]
back to top
BLAST of Abl interactor 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO281058.607e-2133.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO331411.376e-2032.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO381474.762e-1958.73Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO389991.432e-1044.26Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO426899.379e-1046.30Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Abl interactor 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
abi2b3.668e-2942.38abl interactor 2 [Source:NCBI gene;Acc:101169339][more]
abi2b5.872e-2842.38abl interactor 2 [Source:NCBI gene;Acc:101169339][more]
ENSORLT00000017876.29.796e-2842.76abl interactor 2 [Source:NCBI gene;Acc:101175519][more]
ABI14.304e-2740.79abl interactor 1 [Source:NCBI gene;Acc:101170628][more]
ABI14.605e-2740.79abl interactor 1 [Source:NCBI gene;Acc:101170628][more]
back to top
BLAST of Abl interactor 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000055438.10.000e+099.80SMESG000055438.1[more]
SMESG000055438.10.000e+099.01SMESG000055438.1[more]
SMESG000032406.18.566e-1144.07SMESG000032406.1[more]
SMESG000073128.16.688e-949.02SMESG000073128.1[more]
SMESG000068232.11.100e-844.44SMESG000068232.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028026 ID=SMED30028026|Name=Abl interactor 2|organism=Schmidtea mediterranea sexual|type=transcript|length=1793bp
AAATAAAATTTAAATAATTTTTCGATGGGTACCGAGTTTTTACCTAAAGA
TTATATAATTTTGCTTAAAGAGGATATACCAAATGGCACTGAAGATTTAA
TTAATACTAGCAAGACACTTGAAGATGTTGCAGATCATTGTTTGTTAACT
TATGATCGATCTTTAGAGCAGACTGTAAATTATACCGCTCAAGCGTTAGG
AAGTGTAGCTTATAAAATTAATTTGTTAGCTACTAATTTTCTTGAGGTTT
TGGATAAACAAAATATTAAGTTAAATGAATTACAAACTAAAGTAAACCAT
TTAAACATGCAAGTACATATTCATCAAGAGAAAACAGCAAGGTTATCTAT
CGGTAAGTACACAATGCCAAGGGATCCTAATGTTCTTAAAGTGTCTAAAG
TTATTGAACCTTTAACTGAAATTCAAGGTAAATATAAAAGAAAAGAAATA
GACTTTTCAGTTTTGGATAATGTTGGTCATGGCCTGAAAGAGCCCCAATT
GGGAACATCAGGAGTGTTCAGCAATACTAGTCGTCGTAGCAGTACCAGTG
GATCAGATACCCATTCATCATCACACGTATATACTCATTCTAACATAGGA
GGGAGTATTAGTTCTAAAGCTGTACCTGATTATATGAAATTAGGCAAAGC
ACAAACAATTGGCCGTACTGGAGGATTAAATATTAACAATCCATCTAATA
CTATATATCGAGCTCCCGCAAATTTAACTCAAAGAAGTCAGATTCCGATG
CCGTCGCCGAACTTAAACAGTGGAAATGGAATGGCTGCACCTCAAGCTCT
AAACTATGGCAACACAATGCAATATCAGCAGCAAATTTCTCAAGGAACAC
GGCGAAGCAGTAGTACGAGTACATCGACAAGCGGCTCGACTCAAATGCAA
CAACAGAAACAGTATCAGCCACCTGCCAATGTTGTATCGCCTCACAAGAT
GTCAGTAGGGTCTATTCAAGGAAACACTCCACCATACGGATATTCCGGGA
TGAATCATCCAATGGCACATATACCTCCTCCACCGCCACCGGTTGTGACA
AATCAACAGGAGCAGAATATTTCCCCTATGATGCGTTATAATGAACTGCC
ACCGCCACCACTTGAACCACCGAGTCCATATCAACAGCAATCACAACAAA
ACATGAATATGTTACCGCCGCCACCGAATGTTGATCAATTCCAGCGTCCT
GTGAATAATGAACAATTCCAACGGCTTCCAAACAATGAACAAGAATACAT
TGATAAGAATCAAGGCCGTTATATTTCCGACACTGTAGGCATTGCACATT
TACAGCCGAATCCATATGATGTTTTACGTGTCAAATCTCAGGTTGATGAC
GGTTGGGCACCTAATCAGTATATTTGCAAAGTGATCACTCTTTATGAATA
CCAACAGAACAAAGATGACGAGTTGAGCTTTCAGGAAGGAGAATTGATAT
ATGTTGTGAAAAAGAATAATGACGGGTGGTGGGAAGGAGTTATGAATGGC
AGAACGGGATTGTTTCCTGGGAATTATGTGCAAAACATGAATTGATCACA
CAACTAATTTATTATAATTTTTTATTATGCTGATAACTTGATGATATATT
TGGCCTTTATTAATTGTGAATTTTCACCAACTGTATTACAAAAATTAATA
CTACTACTACATTTCTTTTATGACTTTTTAATCCTGTTTTACAATTTTTC
ATGTAAGTTATCGTTATTATTATTTTACACTTTTATAATGATTTTAAGTG
GTTAATTTATCAATAGACCAATCAATTTGTTTGTGTTAAATGT
back to top

protein sequence of SMED30028026-orf-1

>SMED30028026-orf-1 ID=SMED30028026-orf-1|Name=SMED30028026-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=507bp
MGTEFLPKDYIILLKEDIPNGTEDLINTSKTLEDVADHCLLTYDRSLEQT
VNYTAQALGSVAYKINLLATNFLEVLDKQNIKLNELQTKVNHLNMQVHIH
QEKTARLSIGKYTMPRDPNVLKVSKVIEPLTEIQGKYKRKEIDFSVLDNV
GHGLKEPQLGTSGVFSNTSRRSSTSGSDTHSSSHVYTHSNIGGSISSKAV
PDYMKLGKAQTIGRTGGLNINNPSNTIYRAPANLTQRSQIPMPSPNLNSG
NGMAAPQALNYGNTMQYQQQISQGTRRSSSTSTSTSGSTQMQQQKQYQPP
ANVVSPHKMSVGSIQGNTPPYGYSGMNHPMAHIPPPPPPVVTNQQEQNIS
PMMRYNELPPPPLEPPSPYQQQSQQNMNMLPPPPNVDQFQRPVNNEQFQR
LPNNEQEYIDKNQGRYISDTVGIAHLQPNPYDVLRVKSQVDDGWAPNQYI
CKVITLYEYQQNKDDELSFQEGELIYVVKKNNDGWWEGVMNGRTGLFPGN
YVQNMN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0008154actin polymerization or depolymerization
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000101muscle cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR028457ABI
IPR028455ABI3
IPR036028SH3-like_dom_sf
IPR001452SH3_domain
IPR012849Abl-interactor_HHR_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 76..103
NoneNo IPR availablePRINTSPR00499P67PHOXcoord: 350..367
score: 27.78
coord: 453..473
score: 34.52
coord: 473..489
score: 26.47
coord: 489..502
score: 32.14
NoneNo IPR availableGENE3DG3DSA:2.30.30.40coord: 432..506
e-value: 8.7E-25
score: 88.0
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 160..185
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 158..185
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 267..303
NoneNo IPR availableCDDcd11826SH3_Abicoord: 452..503
e-value: 1.13985E-27
score: 102.785
IPR001452SH3 domainPRINTSPR00452SH3DOMAINcoord: 493..505
score: 44.27
coord: 482..491
score: 34.01
coord: 465..480
score: 37.89
IPR001452SH3 domainSMARTSM00326SH3_2coord: 451..506
e-value: 5.2E-20
score: 82.5
IPR001452SH3 domainPFAMPF14604SH3_9coord: 456..503
e-value: 4.6E-17
score: 61.6
IPR001452SH3 domainPROSITEPS50002SH3coord: 448..506
score: 25.566
IPR012849Abl-interactor, homeo-domain homologous domainPFAMPF07815Abi_HHRcoord: 94..157
e-value: 3.2E-14
score: 52.8
IPR028457ABI familyPANTHERPTHR10460ABL INTERACTOR FAMILY MEMBERcoord: 14..504
IPR028455ABI gene family member 3PANTHERPTHR10460:SF7ABI GENE FAMILY MEMBER 3coord: 14..504
IPR036028SH3-like domain superfamilySUPERFAMILYSSF50044SH3-domaincoord: 446..503