adenylate kinase 7

Overview
Nameadenylate kinase 7
Smed IDSMED30028023
Length (bp)2270
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of adenylate kinase 7 (SMED30028023) t-SNE clustered cells

Violin plots show distribution of expression levels for adenylate kinase 7 (SMED30028023) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of adenylate kinase 7 (SMED30028023) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for adenylate kinase 7 (SMED30028023) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028023

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30028023SMESG000075900.1 SmedASXL_011767SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30028023SMESG000075900.1 dd_Smed_v4_7959_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30028023SMESG000075900.1 dd_Smed_v4_7959_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30028023SMESG000075900.1 dd_Smed_v4_7959_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30028023SMESG000075900.1 dd_Smed_v4_7959_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30028023SMESG000075900.1 dd_Smed_v4_7959_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30028023SMESG000075900.1 dd_Smed_v4_7959_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
Smed sexual biotypeSMED30028023SMESG000075900.1 SMESG000069902.1 SMESG000063146.1 Contig53783newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30028023SMESG000075900.1 SMESG000069902.1 SMESG000063146.1 Contig53783uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30028023SMESG000075900.1 dd_Smed_v6_7959_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30028023SMESG000075900.1 dd_Smed_v4_7959_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of adenylate kinase 7 vs. Ensembl Human
Match: AK7 (adenylate kinase 7 [Source:HGNC Symbol;Acc:HGNC:20091])

HSP 1 Score: 435.261 bits (1118), Expect = 7.444e-142
Identity = 283/734 (38.56%), Postives = 432/734 (58.86%), Query Frame = 2
Query:   26 VESKRIFINHVDSYVGLSLANYLSNCVVGSTLDXXXXXXXXXXXXXXGFI---SKKNADGLFEIHGTFXXXXXXXXXXXXAILKYDTRDEFFEHIVESDVIVYDITEDINQIEEALYVANALHDHFQWLEKEVVFILLSSVMTWAKTKPADADDEEASFNEEDYRRRKPHPNFKEHFNAXXXXXXXXXXXXXXXXMYVLGAGILYGAGENILHDFFKQSW-NNAPESVIYDKGTNVIPTIHVNDLAGVIQNIADSKPVSKYILAVDDSKSTLEDVVKIISQKLSFGKVIRIPKEQVLMENIVQPNDLEILLVNIRLDAMVIKE-MKIKWVAEAGLVENIDTVINEYKTYRNLLPIKVCILGPPCTGKTYYSDKIASKYQLKNMKITEVIADYMKYLEATINYPSILSENIEKEKARNLIQNEEDPDPDFGVXXXXXXXXXXXXXXXXXXXXLQNLTENQGKLYDEDLAMIYKETLLSKECQNHGFVLDGFPETKEQAKLLFSPXXXXXXXXXVKNL-GYNRLITPQHVFVVKVSDKFLEIR-----NSILKSNDSFDEDFRNRLKLYRSVNDDLAEVDEETVLSFFDFREIHPIILQIEEDLSK-DGEENRINLLNEIYYELGEPHTYGPNDEEKILINIKEQEAAXXXXXXXXXXXXXXXXXMLTIRKHNQSEWNENLELVRQQQYEYLETHNLPLRNYLMHLVMPVLTDGLMDCSKVRTEDPIDYLSEFILR 2191
            + ++R+FIN +DSY   ++  +LSNCVVG++L+E   EEEE        +   S K  +G F+I GT  K  S +P          +R++    ++E DVI+Y+ITE   Q+EEA++  +AL +     EK  +FILLS+VMTWA++K  D +D E  F EEDYRRRK HPNF +H NAEK +LK  KK +     YV+ AG+ YGA   +LH FFK +W    P   ++  GTNVIPTIHV DLAGVIQN+ D  P   Y++AVD+S  TLED+VK IS+    GK+ +IP+E   +   +  + L+ LLVN+R++A+ +KE   I+W A+ G VENI+T++ EYK  R L+PIK+CILGPP  GK+  + ++A+ Y+L ++++ +VI++ +  LEA +    +     E E+       E+  +   G++                    +++ +N G+L D+ +    KE L S  C+N G++LDGFP+T +QAK LF+ +++EEE++    +  +++LI P+ V  +  SD+FL+ R      SI+       + F   L  YR +N     +D+ETV ++FD  EIHPI +    D+ K +  +NR+  + ++  E+GEP  YG  DEEK     K  E    +   E   ++ +EA  +  +     EWN+ LE V++++ E LE  ++PLRNYLM  VMP L  GL +C  VR EDP+D+L+E++ +
Sbjct:   15 IRTQRVFINLLDSYSSGNIGKFLSNCVVGASLEEITEEEEEEDENKSAMLEASSTKVKEGTFQIVGTLSKPDSPRPDFAVETYSAISREDLLMRLLECDVIIYNITESSQQMEEAIWAVSALSEEVSHFEKRKLFILLSTVMTWARSKALDPEDSEVPFTEEDYRRRKSHPNFLDHINAEKMVLKFGKKARKFAA-YVVAAGLQYGAEGGMLHTFFKMAWLGEIPALPVFGDGTNVIPTIHVLDLAGVIQNVIDHVPKPHYLVAVDESVHTLEDIVKCISKNTGPGKIQKIPRENAYLTKDLTQDCLDHLLVNLRMEALFVKENFNIRWAAQTGFVENINTILKEYKQSRGLMPIKICILGPPAVGKSSIAKELANYYKLHHIQLKDVISEAIAKLEAIVAPNDVGEGEEEVEEEEEEENVEDAQELLDGIK--------------------ESMEQNAGQLDDQYIIRFMKEKLKSMPCRNQGYILDGFPKTYDQAKDLFNQEDEEEEDDVRGRMFPFDKLIIPEFVCALDASDEFLKERVINLPESIVAGTHYSQDRFLRALSNYRDIN-----IDDETVFNYFDELEIHPIHI----DVGKLEDAQNRL-AIKQLIKEIGEPRNYGLTDEEKAEEERKAAEERLAREAAEEAEREHQEAVEMAEKIARWEEWNKRLEEVKREERELLEAQSIPLRNYLMTYVMPTLIQGLNECCNVRPEDPVDFLAEYLFK 717          
BLAST of adenylate kinase 7 vs. Ensembl Human
Match: AK7 (adenylate kinase 7 [Source:HGNC Symbol;Acc:HGNC:20091])

HSP 1 Score: 69.707 bits (169), Expect = 2.344e-13
Identity = 47/120 (39.17%), Postives = 69/120 (57.50%), Query Frame = 2
Query: 1814 ENRINLLNEIYYELGEPHTYGPNDEEKILINIKEQEAAXXXXXXXXXXXXXXXXXMLTIRKHNQSEWNENLELVRQQQYEYLETHNLPLRNYLMHLVMPVLTDGLMDCSKVRTEDPIDYL 2173
            +NR+ +  ++  E+GEP  YG  DEEK     K  E    +   E   ++ +EA  +  +     EWN+ LE V++++ E LE  ++PLRNYLM  VMP L  GL +C  VR EDP+D+L
Sbjct:   15 QNRLAI-KQLIKEIGEPRNYGLTDEEKAEEERKAAEERLAREAAEEAEREHQEAVEMAEKIARWEEWNKRLEEVKREERELLEAQSIPLRNYLMTYVMPTLIQGLNECCNVRPEDPVDFL 133          
BLAST of adenylate kinase 7 vs. Ensembl Celegans
Match: dpy-30 (Dosage compensation protein dpy-30 [Source:UniProtKB/Swiss-Prot;Acc:Q10661])

HSP 1 Score: 46.9802 bits (110), Expect = 4.314e-6
Identity = 21/53 (39.62%), Postives = 34/53 (64.15%), Query Frame = 2
Query: 2063 THNLPLRNYLMHLVMPVLTDGLMDCSKVRTEDPIDYLSEFILRYDNRKHADEK 2221
            T  +P R YL   V+P+L  GL   +K R E+PI++L+ F+LR  +R +A+ +
Sbjct:   65 TSTVPTRQYLDSTVVPILLQGLGALAKDRPENPIEFLANFLLREKDRYNAENQ 117          
BLAST of adenylate kinase 7 vs. Ensembl Celegans
Match: dpy-30 (Dosage compensation protein dpy-30 [Source:UniProtKB/Swiss-Prot;Acc:Q10661])

HSP 1 Score: 46.9802 bits (110), Expect = 4.314e-6
Identity = 21/53 (39.62%), Postives = 34/53 (64.15%), Query Frame = 2
Query: 2063 THNLPLRNYLMHLVMPVLTDGLMDCSKVRTEDPIDYLSEFILRYDNRKHADEK 2221
            T  +P R YL   V+P+L  GL   +K R E+PI++L+ F+LR  +R +A+ +
Sbjct:   65 TSTVPTRQYLDSTVVPILLQGLGALAKDRPENPIEFLANFLLREKDRYNAENQ 117          
BLAST of adenylate kinase 7 vs. Ensembl Fly
Match: Dpy-30L1 (gene:FBgn0032293 transcript:FBtr0080112)

HSP 1 Score: 46.9802 bits (110), Expect = 6.739e-6
Identity = 19/47 (40.43%), Postives = 30/47 (63.83%), Query Frame = 2
Query: 2060 ETHNLPLRNYLMHLVMPVLTDGLMDCSKVRTEDPIDYLSEFILRYDN 2200
            ET+N+P R YL   V PVL  G+   ++ R  DPI +L+ ++L++ N
Sbjct:   72 ETNNMPTRQYLDQTVAPVLLHGMQALARERPTDPIQFLASYLLKHSN 118          
BLAST of adenylate kinase 7 vs. Ensembl Fly
Match: Dpy-30L2 (gene:FBgn0035491 transcript:FBtr0073281)

HSP 1 Score: 45.8246 bits (107), Expect = 8.289e-6
Identity = 21/68 (30.88%), Postives = 36/68 (52.94%), Query Frame = 2
Query: 2000 NQSEWNENLELVRQQQYEYLETHNLPLRNYLMHLVMPVLTDGLMDCSKVRTEDPIDYLSEFILRYDNR 2203
            N  +  + ++     Q    +T ++P+R YL   V P+L  GL   ++ R  DPI YL+ ++L+  NR
Sbjct:   22 NSQQSVDGIDAFAACQKPRPDTSSMPVRQYLDQTVAPILLHGLQALARDRPSDPISYLATYLLKNKNR 89          
BLAST of adenylate kinase 7 vs. Ensembl Fly
Match: Dpy-30L2 (gene:FBgn0035491 transcript:FBtr0332981)

HSP 1 Score: 45.8246 bits (107), Expect = 8.289e-6
Identity = 21/68 (30.88%), Postives = 36/68 (52.94%), Query Frame = 2
Query: 2000 NQSEWNENLELVRQQQYEYLETHNLPLRNYLMHLVMPVLTDGLMDCSKVRTEDPIDYLSEFILRYDNR 2203
            N  +  + ++     Q    +T ++P+R YL   V P+L  GL   ++ R  DPI YL+ ++L+  NR
Sbjct:   22 NSQQSVDGIDAFAACQKPRPDTSSMPVRQYLDQTVAPILLHGLQALARDRPSDPISYLATYLLKNKNR 89          
BLAST of adenylate kinase 7 vs. Ensembl Zebrafish
Match: ak7b (adenylate kinase 7b [Source:ZFIN;Acc:ZDB-GENE-050309-170])

HSP 1 Score: 415.231 bits (1066), Expect = 1.239e-134
Identity = 268/742 (36.12%), Postives = 428/742 (57.68%), Query Frame = 2
Query:   11 MSEEKVESKRIFINHVDSYVGLSLANYLSNCVVGSTLDXXXXXXXXXXXXXXGFISKKNADGLFEIHGTFXXXXXXXXXXXXAILKYDT-RDEFFEHIVESDVIVYDITEDINQIEEALYVANALHDHFQWLEKEVVFILLSSVMTWAKTKPADADDEEASFNEEDYRRRKPHPNFKEHFNAXXXXXXXXXXXXXXXXMYVLGAGILYGAGENILHDFFKQSWNNAPESV-IYDKGTNVIPTIHVNDLAGVIQNIADSKPVSKYILAVDDSKSTLEDVVKIISQKLSFGKVIRIPKEQV-LMENIVQPNDLEILLVNIRLDAMVIKE-MKIKWVAEAGLVENIDTVINEYKTYRNLLPIKVCILGPPCTGKTYYSDKIASKYQLKNMKITEVIADYMKYLEATINYPSILSENIEKEKARNLIQNEEDPDPDFGVXXXXXXXXXXXXXXXXXXXXLQNLTENQGKLYDEDLAMIYKETLLSKECQNHGFVLDGFPETKEQAKLLFSPXXXXXXXXXVKNLGYNRLITPQHVFVVKVSDKFLEIR-----NSILKSNDSFDEDFRNRLKLYRSVNDDLAEVDEETVLSFFDFREIHPIILQIEEDLSKDGEENRINLLNEIYYELGEPHTYGP---NDEEKILINIKE---QEAAXXXXXXXXXXXXXXXXXMLTIRKHNQSEWNENLELVRQQQYEYLETHNLPLRNYLMHLVMPVLTDGLMDCSKVRTEDPIDYLSEFILR 2191
            + E    S+R+FIN+VD+Y   ++A +L  CVVG++L      + E   +       +  DG F+I GT   +T +K   +     + T R++   H+++ DVI+YD+T+  +QI+EA +  +AL++          FIL+S+V+TWA TKPAD D  E    + +YRRRK HPNF  H + EK ++KL K   S+   YV+ +G+ YG  E++ H FFK SW      V I+  G+N+IPTIH+NDLAG+IQN+ D KP  +Y +AVDDSK+T+ED++K I+  L  GK   + KE++ L++N+ Q  +++ LLVN+ ++A  +K+   I+WV+E G+V+NI+ VI EYK  R LLPI++CI+GPP  GK+  ++KI   Y L ++K+ E IA+ ++ LE  +      ++  + ++  + ++                                +N+ EN G+L D+ +  I K+ L +K C N GFVLDGFP+T EQAK LF+ D + E+ E+     +   I P+ VF V  +D FL+ R      ++++      E F  RL  +R  N     V++E  L++F+  EIHP  L+I  D   D E   I  +++I  ++G+P  YGP     EE+    +KE   ++AA+R     RE ++ +       R     EW+++L  V++Q+ + LE+ + PLR+YLM  VMP LT GL++C ++R +DPID+L+E++L+
Sbjct:    5 IDERPQNSRRVFINNVDAYTSKNIARFLDLCVVGASLVFAGEADVEEEDDRLHDDQAEIKDGTFQIVGTVSSQTEEKCSFIAEQYSHHTKREDLLHHLLKCDVIIYDVTQHADQIDEAQWAVSALYEEMDRFPAAKTFILVSTVLTWAMTKPADKDYPETPLTDSNYRRRKAHPNFHRHISLEKLVVKLGKTKSSRFSTYVVASGLQYGMEEHVFHLFFKMSWMGEVSHVPIFGDGSNIIPTIHINDLAGIIQNVIDHKPKVQYFVAVDDSKNTMEDIIKAITLMLGPGKTRNVSKEEIYLIQNLTQ-TEIDSLLVNLPIEAPYLKDNFNIQWVSETGMVQNIEQVIEEYKESRGLLPIRMCIVGPPAVGKSTIAEKICKHYNLHHIKLKEAIAEALENLELCVRTEDEENDQDDDQEFWDTLR--------------------------------ENMNENGGRLDDQYVIRIMKDKLRTKPCMNQGFVLDGFPKTCEQAKELFTGDGEPEDLES----KHATKIIPEFVFSVNATDDFLKNRVLNLPETVVEGTSYMPEQFLQRLARFRDRN-----VEDEMPLNYFEDLEIHPEHLEITSD--NDNEYQLI--IDKICKKVGKPRNYGPILEKVEEEKRRQVKERLNEQAAQRVEEERREEEEAQH------RDQRWGEWSQHLVEVKRQELDLLESQSEPLRDYLMQDVMPTLTQGLIECCRLRPDDPIDFLAEYLLQ 694          
BLAST of adenylate kinase 7 vs. Ensembl Zebrafish
Match: ak7a (adenylate kinase 7a [Source:ZFIN;Acc:ZDB-GENE-040724-122])

HSP 1 Score: 368.622 bits (945), Expect = 7.715e-117
Identity = 258/748 (34.49%), Postives = 403/748 (53.88%), Query Frame = 2
Query:   11 MSEEKVESKRIFINHVDSYVGLSLANYLSNCVVGSTLDXXXXXXXXXXXXXXGFISKKNADGLFEIHGTFXXXXXXXXXXXXAILKYDTRDEFFEHIVESDVIVYDITEDINQIEEALYVANALHDHFQWLEKEVVFILLSSVMTWAKTKPADADDEEASFNEEDYRRRKPHPNFKEHFNAXXXXXXXXXXXXXXXXMYVLGAGILYGAGENILHDFFKQSWNNAPESV-IYDKGTNVIPTIHVNDLAGVIQNIADSKPVSKYILAVDDSKSTLEDVVKIISQKLSFGKVIRIPKEQVLMENIVQPNDLEILLVNIRLDAMVIKE-MKIKWVAEAGLVENIDTVINEYKTYRNLLPIKVCILGPPCTGKTYYSDKIASKYQLKNMKITEVIADYMKYLEATINYPSILSENIE----KEKARNLIQNEEDPDPDFGVXXXXXXXXXXXXXXXXXXXXLQNLTENQGKLYDEDLAMIYKETLLSKECQNHGFVLDGFPETKEQAKLLFSPXXXXXXXXXVKNLGYNRLITPQHVFVVKVSDKFLEIRNSILKSNDS-----FDEDFRNRLKLYRSVNDDLAEVDEETVLSFFDFREIHPIILQIEEDLSKDGEENRINLLNEIYYELGEPHTYGPNDEEKILI----------NIKEQEAAXXXXXXXXXXXXXXXXXMLTIRKHNQSEWNENLELVRQQQYEYLETHNLPLRNYLMHLVMPVLTDGLMDCSKVRTEDPIDYLSEFILR 2191
            M+  +  + R+F+N++DSY   ++A +LS+CVVG++L E E E++             + +  F+I GT   K +K+           +RDE  + ++  DVIVY+ITE  + I+EA +  +ALH      E   +FILLS ++TWA TKP D DD +    EEDY++R+PHPNFKEH + E+ +LKL K  KS +  Y++ +G+ YG GEN+ H FF+ +W     SV I+  GTN IP +HV+DLA V+Q I D KP + Y +AVDDSKST ED+VK I+  +  G+  ++ KE     NI +  +L  L VN+R++++ IKE + I    E+G+V+NI  V+ E+K  R LLPIK+C+LGPP  GK+  ++++   Y+L ++ + E +++ ++ LE  +      +EN E     E+    I+N                                ++ +N G+L ++ +  I  E L S  C+N GFVLDG+P+T  QA  LF  +N E E+       YN+++ P+ VF +  +D FL+ R   L  N +       E+F + L  +R     LAE  +E+VL +FD  EIHP  +  E           + ++ +I   +G P  YG + EE               +K++EA  +       +K                EWN N   V +Q++E LE  ++P+R+YLM  VMP +  GL+DC KV+ +DP+D+L+E + R
Sbjct:    4 MANSERRATRVFLNNIDSYSSKNIAQFLSSCVVGASLGEGEEEDKH---------DASSDEPCFQIVGTVANKDAKQESFASEQYWSLSRDELLQCLMRCDVIVYNITEHTDLIDEATWAISALHSEIGHFESPKIFILLSPILTWAMTKPPDPDDPDIPLTEEDYKKRRPHPNFKEHTSTERLVLKLGKTKKSILGTYIVTSGLQYGMGENMFHFFFQTAWLGKLSSVPIFGPGTNNIPAVHVHDLARVVQKIIDHKPKTHYFIAVDDSKSTFEDIVKAIASAVGPGQTEKVLKEDA-SGNITE-TELLYLSVNLRIESVFIKERLNINLDFESGIVDNIVRVVEEFKQTRKLLPIKICLLGPPAVGKSTVAEELCKYYKLNHVTVDEAVSEKIRQLEELLERNEKTAENEELLSAAEEKLKAIKN--------------------------------SMLQNGGQLDNQQIIHIIMEKLNSMPCRNQGFVLDGYPKTYSQANELFQDENMEVEDGRATEPKYNKVMIPEFVFSLDATDDFLKARVRSLPQNVAEMKHYTQEEFTDSLAKFRQT---LAE--DESVLDYFDELEIHPEHIDCE----------NVAVVEKIIKTVGRPMNYGLSPEEMEEEKKRKEHERHQQLKQEEAENKLRETMENDKFASLL----------EEWNRNTAEVEKQEHELLEARSVPMRHYLMKYVMPTVVQGLVDCCKVKPDDPVDFLAEHLFR 683          
BLAST of adenylate kinase 7 vs. Ensembl Zebrafish
Match: ak7a (adenylate kinase 7a [Source:ZFIN;Acc:ZDB-GENE-040724-122])

HSP 1 Score: 160.614 bits (405), Expect = 1.475e-43
Identity = 107/315 (33.97%), Postives = 170/315 (53.97%), Query Frame = 2
Query:  656 DFFKQSWNNAPESV-IYDKGTNVIPTIHVNDLAGVIQNIADSKPVSKYILAVDDSKSTLEDVVKIISQKLSFGKVIRIPKEQVLMENIVQPNDLEILLVNIRLDAMVIKE-MKIKWVAEAGLVENIDTVINEYKTYRNLLPIKVCILGPPCTGKTYYSDKIASKYQLKNMKITEVIADYMKYLEATINYPSILSENIE----KEKARNLIQNEEDPDPDFGVXXXXXXXXXXXXXXXXXXXXLQNLTENQGKLYDEDLAMIYKETLLSKECQNHGFVLDGFPETKEQAKLLFSPXXXXXXXXXVKNLGYNRLITP 1582
            +  + +W     SV I+  GTN IP +HV+DLA V+Q I D KP + Y +AVDDSKST ED+VK I+  +  G+  ++ KE     NI +  +L  L VN+R++++ IKE + I    E+G+V+NI  V+ E+K  R LLPIK+C+LGPP  GK+  ++++   Y+L ++ + E +++ ++ LE  +      +EN E     E+    I+N                                ++ +N G+L ++ +  I  E L S  C+N GFVLDG+P+T  QA  LF  +N E E+       YN+++ P
Sbjct:   27 NIAQTAWLGKLSSVPIFGPGTNNIPAVHVHDLARVVQKIIDHKPKTHYFIAVDDSKSTFEDIVKAIASAVGPGQTEKVLKEDA-SGNITE-TELLYLSVNLRIESVFIKERLNINLDFESGIVDNIVRVVEEFKQTRKLLPIKICLLGPPAVGKSTVAEELCKYYKLNHVTVDEAVSEKIRQLEELLERNEKTAENEELLSAAEEKLKAIKN--------------------------------SMLQNGGQLDNQQIIHIIMEKLNSMPCRNQGFVLDGYPKTYSQANELFQDENMEVEDGRATEPKYNKVMIP 307          
BLAST of adenylate kinase 7 vs. Ensembl Xenopus
Match: sesn1 (sestrin 1 [Source:Xenbase;Acc:XB-GENE-491636])

HSP 1 Score: 451.44 bits (1160), Expect = 2.813e-148
Identity = 287/736 (38.99%), Postives = 428/736 (58.15%), Query Frame = 2
Query:   14 SEEKVESKRIFINHVDSYVGLSLANYLSNCVVGSTLDXXXXXXXXXXXXXXGF-ISKKNADGLFEIHGTFXXXXXXXXXXXXAILKYDTRDEFFEHIVESDVIVYDITEDINQIEEALYVANALHDHFQWLEKEVVFILLSSVMTWAKTKPADADDEEASFNEEDYRRRKPHPNFKEHFNAXXXXXXXXXXXXXXXXMYVLGAGILYGAGENILHDFFKQSW-NNAPESVIYDKGTNVIPTIHVNDLAGVIQNIADSKPVSKYILAVDDSKSTLEDVVKIISQKLSFGKVIRIPKEQVLMENIVQPNDLEILLVNIRLDAMVIKE-MKIKWVAEAGLVENIDTVINEYKTYRNLLPIKVCILGPPCTGKTYYSDKIASKYQLKNMKITEVIADYMKYLEATINYPSILSENIEKEKARNLIQNEEDPDPDFGVXXXXXXXXXXXXXXXXXXXXLQNLTENQGKLYDEDLAMIYKETLLSKECQNHGFVLDGFPETKEQAKLLFS-PXXXXXXXXXVKNLGYNRLITPQHVFVVKVSDKFLEIR------NSILKSNDSFDEDFRNRLKLYRSVNDDLAEVDEETVLSFFDFREIHPIILQIEEDLSKDGEENRINLLNEIYYELGEPHTYGPNDEEKILINIKEQEAAXXXXXXXXXXXXXXXXXMLTIRKHNQSEWNENLELVRQQQYEYLETHNLPLRNYLMHLVMPVLTDGLMDCSKVRTEDPIDYLSEFILR 2191
             E+ V  KRIFIN +DS+VG ++  YLS C+VG+TL++   E EE   +        K  +GLF+I GT      KK           +R+E    ++E DVIVY+ITEDI+Q+++A +  +ALH      E   +FIL+S+++TWA++KP D DD +  F E+DYRRRK H NFK+H   EK  +KL K +K K   YV+ +G+ YGA E ILH FF+++W    P   ++  G+N IP IH++DLAGV+QNIAD +P + Y++AVDDS  T E++VK IS  L  GK+ ++PKE   ++  ++  D++ LLVN+RL+A+ +KE   I WV + GLVENI+ VI EYK  R LLPI++CILGPP  GKT  ++ I   Y+L ++KI +VI D ++ LE  +       E   +E   N  +                            + + +N+ +N G+L D  +    +E L S  CQN G+VLDG+P+T EQAK LF+  + +EEEE   K   +++ ITP  VF +  SD FL+ R      N ++ ++ + D   R+ L ++R +N      ++ETVL++FD  EIHP+ +    D++KD + +  +++ +I   +GEP  YG   EE     +K  E +       +   + KEAE    +     EWN  L+ V++Q+ E LE  ++PLRNYLM  VMP L  GL +C K+R  DP+D+L+E+I R
Sbjct:    5 GEKTVRPKRIFINQIDSFVGKNIGKYLSGCIVGATLEQPAEEAEEDDNKSVNEDTPSKPKEGLFQIVGTLSNPNGKKLNFPAETYTVSSREELLGRLLECDVIVYNITEDISQLDDASWAVSALHTEIDNFENPKMFILISTILTWARSKPIDPDDPDIPFTEDDYRRRKCHMNFKDHLAVEKLAIKLGKSNKGKFSTYVVASGLPYGAEEGILHTFFREAWLGETPALQVFGDGSNYIPLIHISDLAGVVQNIADQRPRTHYLVAVDDSVHTFEEIVKCISTNLGPGKIQKVPKENAFLKKYLKQLDIDYLLVNLRLEAVFLKENFNISWVTQTGLVENIELVIKEYKQTRGLLPIRICILGPPAVGKTTVAELICKHYKLHHIKIKDVITDAIEKLERLVKASEEEEEEEGEEPTENWQE--------------------------LLDSVKENMDQNGGRLDDTYVIKFMREKLKSMPCQNQGYVLDGYPKTYEQAKELFNVEEGEEEEESRGKAPPFDKTITPDFVFSLDASDDFLKNRVINLPENVVVGTHYAQDRFLRS-LAMFRDLN-----TEDETVLNYFDEAEIHPLHI----DVTKDDDPHYKDVVKQICKAVGEPRNYGLTPEELAEQELKVSEQSLALEAERKAELERKEAEEAAEKVARWEEWNRRLDEVKRQEQELLEAQSVPLRNYLMKNVMPTLMQGLNECCKIRPHDPVDFLAEYIFR 704          
BLAST of adenylate kinase 7 vs. Ensembl Xenopus
Match: sesn1 (sestrin 1 [Source:Xenbase;Acc:XB-GENE-491636])

HSP 1 Score: 450.284 bits (1157), Expect = 8.862e-148
Identity = 286/736 (38.86%), Postives = 428/736 (58.15%), Query Frame = 2
Query:   14 SEEKVESKRIFINHVDSYVGLSLANYLSNCVVGSTLDXXXXXXXXXXXXXXGF-ISKKNADGLFEIHGTFXXXXXXXXXXXXAILKYDTRDEFFEHIVESDVIVYDITEDINQIEEALYVANALHDHFQWLEKEVVFILLSSVMTWAKTKPADADDEEASFNEEDYRRRKPHPNFKEHFNAXXXXXXXXXXXXXXXXMYVLGAGILYGAGENILHDFFKQSW-NNAPESVIYDKGTNVIPTIHVNDLAGVIQNIADSKPVSKYILAVDDSKSTLEDVVKIISQKLSFGKVIRIPKEQVLMENIVQPNDLEILLVNIRLDAMVIKE-MKIKWVAEAGLVENIDTVINEYKTYRNLLPIKVCILGPPCTGKTYYSDKIASKYQLKNMKITEVIADYMKYLEATINYPSILSENIEKEKARNLIQNEEDPDPDFGVXXXXXXXXXXXXXXXXXXXXLQNLTENQGKLYDEDLAMIYKETLLSKECQNHGFVLDGFPETKEQAKLLFS-PXXXXXXXXXVKNLGYNRLITPQHVFVVKVSDKFLEIR------NSILKSNDSFDEDFRNRLKLYRSVNDDLAEVDEETVLSFFDFREIHPIILQIEEDLSKDGEENRINLLNEIYYELGEPHTYGPNDEEKILINIKEQEAAXXXXXXXXXXXXXXXXXMLTIRKHNQSEWNENLELVRQQQYEYLETHNLPLRNYLMHLVMPVLTDGLMDCSKVRTEDPIDYLSEFILR 2191
             E+ V  KRIFIN +DS+ G +++ YLS C+VG+TL++   E EE   +        K  +GLF+I GT      KK           +R+E    ++E DVIVY+ITEDI+Q+++A +  +ALH      E   +FIL+S+++TWA++KP D DD +  F E+DYRRRK H NFK+H   EK  +KL K +K K   YV+ +G+ YGA E ILH FF+++W    P   ++  G+N IP IH++DLAGV+QNIAD +P + Y++AVDDS  T E++VK IS  L  GK+ ++PKE   ++  ++  D++ LLVN+RL+A+ +KE   I WV + GLVENI+ VI EYK  R LLPI++CILGPP  GKT  ++ I   Y+L ++KI +VI D ++ LE  +       E   +E   N  +                            + + +N+ +N G+L D  +    +E L S  CQN G+VLDG+P+T EQAK LF+  + +EEEE   K   +++ ITP  VF +  SD FL+ R      N ++ ++ + D   R+ L ++R +N      ++ETVL++FD  EIHP+ +    D++KD + +  +++ +I   +GEP  YG   EE     +K  E +       +   + KEAE    +     EWN  L+ V++Q+ E LE  ++PLRNYLM  VMP L  GL +C K+R  DP+D+L+E+I R
Sbjct:    5 GEKTVRPKRIFINQIDSFTGKNISKYLSGCIVGATLEQPAEEAEEDDNKSVNEDTPSKPKEGLFQIVGTLSNPNGKKLNFPAETYTVSSREELLGRLLECDVIVYNITEDISQLDDASWAVSALHTEIDNFENPKMFILISTILTWARSKPIDPDDPDIPFTEDDYRRRKCHMNFKDHLAVEKLAIKLGKSNKGKFSTYVVASGLPYGAEEGILHTFFREAWLGETPALQVFGDGSNYIPLIHISDLAGVVQNIADQRPRTHYLVAVDDSVHTFEEIVKCISTNLGPGKIQKVPKENAFLKKYLKQLDIDYLLVNLRLEAVFLKENFNISWVTQTGLVENIELVIKEYKQTRGLLPIRICILGPPAVGKTTVAELICKHYKLHHIKIKDVITDAIEKLERLVKASEEEEEEEGEEPTENWQE--------------------------LLDSVKENMDQNGGRLDDTYVIKFMREKLKSMPCQNQGYVLDGYPKTYEQAKELFNVEEGEEEEESRGKAPPFDKTITPDFVFSLDASDDFLKNRVINLPENVVVGTHYAQDRFLRS-LAMFRDLN-----TEDETVLNYFDEAEIHPLHI----DVTKDDDPHYKDVVKQICKAVGEPRNYGLTPEELAEQELKVSEQSLALEAERKAELERKEAEEAAEKVARWEEWNRRLDEVKRQEQELLEAQSVPLRNYLMKNVMPTLMQGLNECCKIRPHDPVDFLAEYIFR 704          
BLAST of adenylate kinase 7 vs. Ensembl Xenopus
Match: sesn1 (sestrin 1 [Source:Xenbase;Acc:XB-GENE-491636])

HSP 1 Score: 423.705 bits (1088), Expect = 1.151e-137
Identity = 273/714 (38.24%), Postives = 410/714 (57.42%), Query Frame = 2
Query:   80 LANYLSNCVVGSTLDXXXXXXXXXXXXXXGF-ISKKNADGLFEIHGTFXXXXXXXXXXXXAILKYDTRDEFFEHIVESDVIVYDITEDINQIEEALYVANALHDHFQWLEKEVVFILLSSVMTWAKTKPADADDEEASFNEEDYRRRKPHPNFKEHFNAXXXXXXXXXXXXXXXXMYVLGAGILYGAGENILHDFFKQSW-NNAPESVIYDKGTNVIPTIHVNDLAGVIQNIADSKPVSKYILAVDDSKSTLEDVVKIISQKLSFGKVIRIPKEQVLMENIVQPNDLEILLVNIRLDAMVIKE-MKIKWVAEAGLVENIDTVINEYKTYRNLLPIKVCILGPPCTGKTYYSDKIASKYQLKNMKITEVIADYMKYLEATINYPSILSENIEKEKARNLIQNEEDPDPDFGVXXXXXXXXXXXXXXXXXXXXLQNLTENQGKLYDEDLAMIYKETLLSKECQNHGFVLDGFPETKEQAKLLFS-PXXXXXXXXXVKNLGYNRLITPQHVFVVKVSDKFLEIR------NSILKSNDSFDEDFRNRLKLYRSVNDDLAEVDEETVLSFFDFREIHPIILQIEEDLSKDGEENRINLLNEIYYELGEPHTYGPNDEEKILINIKEQEAAXXXXXXXXXXXXXXXXXMLTIRKHNQSEWNENLELVRQQQYEYLETHNLPLRNYLMHLVMPVLTDGLMDCSKVRTEDPIDYLSEFILR 2191
            L  YLS C+VG+TL++   E EE   +        K  +GLF+I GT      KK           +R+E    ++E DVIVY+ITEDI+Q+++A +  +ALH      E   +FIL+S+++TWA++KP D DD +  F E+DYRRRK H NFK+H  A +++     K  SK   YV+ +G+ YGA E ILH FF+++W    P   ++  G+N IP IH++DLAGV+QNIAD +P + Y++AVDDS  T E++VK IS  L  GK+ ++PKE   ++  ++  D++ LLVN+RL+A+ +KE   I WV + GLVENI+ VI EYK  R LLPI++CILGPP  GKT  ++ I   Y+L ++KI +VI D ++ LE  +       E   +E   N  +                            + + +N+ +N G+L D  +    +E L S  CQN G+VLDG+P+T EQAK LF+  + +EEEE   K   +++ ITP  VF +  SD FL+ R      N ++ ++ + D   R+ L ++R +N      ++ETVL++FD  EIHP+ +    D++KD + +  +++ +I   +GEP  YG   EE     +K  E +       +   + KEAE    +     EWN  L+ V++Q+ E LE  ++PLRNYLM  VMP L  GL +C K+R  DP+D+L+E+I R
Sbjct:   15 LRYYLSGCIVGATLEQPAEEAEEDDNKSVNEDTPSKPKEGLFQIVGTLSNPNGKKLNFPAETYTVSSREELLGRLLECDVIVYNITEDISQLDDASWAVSALHTEIDNFENPKMFILISTILTWARSKPIDPDDPDIPFTEDDYRRRKCHMNFKDHL-AVEKLAIKLGKSVSKFSTYVVASGLPYGAEEGILHTFFREAWLGETPALQVFGDGSNYIPLIHISDLAGVVQNIADQRPRTHYLVAVDDSVHTFEEIVKCISTNLGPGKIQKVPKENAFLKKYLKQLDIDYLLVNLRLEAVFLKENFNISWVTQTGLVENIELVIKEYKQTRGLLPIRICILGPPAVGKTTVAELICKHYKLHHIKIKDVITDAIEKLERLVKASEEEEEEEGEEPTENWQE--------------------------LLDSVKENMDQNGGRLDDTYVIKFMREKLKSMPCQNQGYVLDGYPKTYEQAKELFNVEEGEEEEESRGKAPPFDKTITPDFVFSLDASDDFLKNRVINLPENVVVGTHYAQDRFLRS-LAMFRDLN-----TEDETVLNYFDEAEIHPLHI----DVTKDDDPHYKDVVKQICKAVGEPRNYGLTPEELAEQELKVSEQSLALEAERKAELERKEAEEAAEKVARWEEWNRRLDEVKRQEQELLEAQSVPLRNYLMKNVMPTLMQGLNECCKIRPHDPVDFLAEYIFR 691          
BLAST of adenylate kinase 7 vs. Ensembl Xenopus
Match: sesn1 (sestrin 1 [Source:Xenbase;Acc:XB-GENE-491636])

HSP 1 Score: 421.009 bits (1081), Expect = 1.832e-136
Identity = 278/737 (37.72%), Postives = 421/737 (57.12%), Query Frame = 2
Query:   14 SEEKVESKRIFINHVDSYVGLSLANYLSNCVVGSTLDXXXXXXXXXXXXXXGF-ISKKNADGLFEIHGTFXXXXXXXXXXXXAILKYDTRDEFFEHIVESDVIVYDITEDINQIEEALYVANALHDHFQWLEKEVVFILLSSVMTWAKTKPADADDEEASFNEEDYRRRKPHPNFKEHFNAXXXXXXXXXXXXXXXXM-YVLGAGILYGAGENILHDFFKQSW-NNAPESVIYDKGTNVIPTIHVNDLAGVIQNIADSKPVSKYILAVDDSKSTLEDVVKIISQKLSFGKVIRIPKEQVLMENIVQPNDLEILLVNIRLDAMVIKE-MKIKWVAEAGLVENIDTVINEYKTYRNLLPIKVCILGPPCTGKTYYSDKIASKYQLKNMKITEVIADYMKYLEATINYPSILSENIEKEKARNLIQNEEDPDPDFGVXXXXXXXXXXXXXXXXXXXXLQNLTENQGKLYDEDLAMIYKETLLSKECQNHGFVLDGFPETKEQAKLLFS-PXXXXXXXXXVKNLGYNRLITPQHVFVVKVSDKFLEIR------NSILKSNDSFDEDFRNRLKLYRSVNDDLAEVDEETVLSFFDFREIHPIILQIEEDLSKDGEENRINLLNEIYYELGEPHTYGPNDEEKILINIKEQEAAXXXXXXXXXXXXXXXXXMLTIRKHNQSEWNENLELVRQQQYEYLETHNLPLRNYLMHLVMPVLTDGLMDCSKVRTEDPIDYLSEFILR 2191
             E+ V  KRIFIN +DS+ G +++ YLS C+VG+TL++   E EE   +        K  +GLF+I GT      KK           +R+E    ++E DVIVY+ITEDI+Q+++A +  +ALH      E   +FIL+S+++TWA++KP D DD +  F E+DYRRRK H NFK+H   EK  +KL K   + + M  V G G +    +  L+  +K++W    P   ++  G+N IP IH++DLAGV+QNIAD +P + Y++AVDDS  T E++VK IS  L  GK+ ++PKE   ++  ++  D++ LLVN+RL+A+ +KE   I WV + GLVENI+ VI EYK  R LLPI++CILGPP  GKT  ++ I   Y+L ++KI +VI D ++ LE  +       E   +E   N  +                            + + +N+ +N G+L D  +    +E L S  CQN G+VLDG+P+T EQAK LF+  + +EEEE   K   +++ ITP  VF +  SD FL+ R      N ++ ++ + D   R+ L ++R +N      ++ETVL++FD  EIHP+ +    D++KD + +  +++ +I   +GEP  YG   EE     +K  E +       +   + KEAE    +     EWN  L+ V++Q+ E LE  ++PLRNYLM  VMP L  GL +C K+R  DP+D+L+E+I R
Sbjct:    5 GEKTVRPKRIFINQIDSFTGKNISKYLSGCIVGATLEQPAEEAEEDDNKSVNEDTPSKPKEGLFQIVGTLSNPNGKKLNFPAETYTVSSREELLGRLLECDVIVYNITEDISQLDDASWAVSALHTEIDNFENPKMFILISTILTWARSKPIDPDDPDIPFTEDDYRRRKCHMNFKDHLAVEKLAIKLGKSVSNVLFMIQVSGIGYICNLIKESLY-IYKEAWLGETPALQVFGDGSNYIPLIHISDLAGVVQNIADQRPRTHYLVAVDDSVHTFEEIVKCISTNLGPGKIQKVPKENAFLKKYLKQLDIDYLLVNLRLEAVFLKENFNISWVTQTGLVENIELVIKEYKQTRGLLPIRICILGPPAVGKTTVAELICKHYKLHHIKIKDVITDAIEKLERLVKASEEEEEEEGEEPTENWQE--------------------------LLDSVKENMDQNGGRLDDTYVIKFMREKLKSMPCQNQGYVLDGYPKTYEQAKELFNVEEGEEEEESRGKAPPFDKTITPDFVFSLDASDDFLKNRVINLPENVVVGTHYAQDRFLRS-LAMFRDLN-----TEDETVLNYFDEAEIHPLHI----DVTKDDDPHYKDVVKQICKAVGEPRNYGLTPEELAEQELKVSEQSLALEAERKAELERKEAEEAAEKVARWEEWNRRLDEVKRQEQELLEAQSVPLRNYLMKNVMPTLMQGLNECCKIRPHDPVDFLAEYIFR 704          
BLAST of adenylate kinase 7 vs. Ensembl Mouse
Match: Ak7 (adenylate kinase 7 [Source:MGI Symbol;Acc:MGI:1926051])

HSP 1 Score: 452.21 bits (1162), Expect = 1.427e-148
Identity = 295/740 (39.86%), Postives = 437/740 (59.05%), Query Frame = 2
Query:   14 SEEKVESKRIFINHVDSYVGLSLANYLSNCVVGSTLDXXXXXXXXXXXXXXGFI----SKKNADGLFEIHGTFXXXXXXXXXXXXAILKYDTRDEFFEHIVESDVIVYDITEDINQIEEALYVANALHDHFQWLEKEVVFILLSSVMTWAKTKPADADDEEASFNEEDYRRRKPHPNFKEHFNAXXXXXXXXXXXXXXXXMYVLGAGILYGAGENILHDFFKQSW-NNAPESVIYDKGTNVIPTIHVNDLAGVIQNIADSKPVSKYILAVDDSKSTLEDVVKIISQKLSFGKVIRIPKEQVLMENIVQPNDLEILLVNIRLDAMVIKE-MKIKWVAEAGLVENIDTVINEYKTYRNLLPIKVCILGPPCTGKTYYSDKIASKYQLKNMKITEVIADYMKYLEATINYPSILSENIEKEKARNLIQNEEDPDPDF-GVXXXXXXXXXXXXXXXXXXXXLQNLTENQGKLYDEDLAMIYKETLLSKECQNHGFVLDGFPETKEQAKLLFSPXXXXXXXX-XVKNLGYNRLITPQHVFVVKVSDKFLEIR-----NSILKSNDSFDEDFRNRLKLYRSVNDDLAEVDEETVLSFFDFREIHPIILQIEEDLSK-DGEENRINLLNEIYYELGEPHTYGPNDEEKILINIKEQEAAXXXXXXXXXXXXXXXXXMLTIRKHNQSEWNENLELVRQQQYEYLETHNLPLRNYLMHLVMPVLTDGLMDCSKVRTEDPIDYLSEFILR 2191
            +E+ ++ +R+FINH+D+Y   ++  +L+NCV G++L+E   EEEE             + K  +G F+I GT  K  S KP       K  +R++   H++E D ++Y+ITE++ Q+EEAL+  +AL++     EK  VFILLS+VMTWA++KP D DD E  F EEDYRRRK HPNF +H NAEK +LK  K  K     YV+ +G+ YGA   ILH FFK +W    P   ++  GTN IP IHV DLAGVIQNI D  P   Y++AVD++  TLED+VK IS+    GK+ ++PKE   +   +    L+ LLVN+R++A+ +KE   I+WVA+ G VENI++++ EYK  R LLPIK+CILGPP  GK+  S+++A  Y+L ++K+ +VIA+ +  LEA +  P    E  E+ +     +N +D      G++                    +++ +N G+L D+ +    KE L S  C+N GF+LDGFP+T +QAK LF+ + +EEEEE   K   Y++LITP+ V  +  SD+FL+ R      S++       + F   L  YR +N      D+ETV ++FD  EIHPI +    D+ K +  +NR+  + ++  E+G+P  YG  DEEK     K  E    +   +    + KEA  +  +     EWN+ LE V++++ E LE  ++PLRNYLM  VMP L  GL +C KVR EDP+D+L+E++ +
Sbjct:   10 TEKVLKIQRVFINHLDTYSSGNIGKFLANCVAGASLEEIGEEEEEEDETKSAVAPEAPTTKVKEGTFQIVGTLVKPESVKPDFAVEAYKGISREDLLSHLMECDAVIYNITENVQQVEEALWAVSALNEEISHFEKRKVFILLSTVMTWARSKPLDPDDNEVPFTEEDYRRRKHHPNFLDHINAEKIVLKFGKNAKKFAT-YVVASGLQYGAEGGILHTFFKMAWLGEVPALPVFGDGTNCIPAIHVVDLAGVIQNIIDHVPKLHYLVAVDEAVHTLEDLVKCISKNTGPGKIQKVPKENAFLTKDLTQEYLDHLLVNLRMEALFVKENFNIRWVAQTGFVENINSILKEYKQSRGLLPIKICILGPPAVGKSSISEELAKYYKLHHIKMKDVIAEAIAKLEAIVA-PKDSVEGEEEGEEEEEEENVDDAQELLDGIK--------------------ESMEQNAGRLEDQYIIRFVKEKLKSMPCRNQGFILDGFPKTYDQAKDLFNQEEEEEEEEIRGKIFPYDKLITPEFVCGLDASDEFLKERVMNLPESVVAGTHYSQDRFLRSLSHYRDIN-----TDDETVFNYFDELEIHPIHI----DVGKLEDAQNRL-AIKQLIKEIGKPRNYGLTDEEKAEEEKKAAEERLAKEAAQTAELEHKEAMEMAEKIARWEEWNKRLEEVKREERELLEVQSVPLRNYLMTYVMPTLMQGLNECCKVRPEDPVDFLAEYLFK 717          
BLAST of adenylate kinase 7 vs. UniProt/SwissProt
Match: sp|Q96M32|KAD7_HUMAN (Adenylate kinase 7 OS=Homo sapiens OX=9606 GN=AK7 PE=1 SV=3)

HSP 1 Score: 435.261 bits (1118), Expect = 3.575e-141
Identity = 283/734 (38.56%), Postives = 432/734 (58.86%), Query Frame = 2
Query:   26 VESKRIFINHVDSYVGLSLANYLSNCVVGSTLDXXXXXXXXXXXXXXGFI---SKKNADGLFEIHGTFXXXXXXXXXXXXAILKYDTRDEFFEHIVESDVIVYDITEDINQIEEALYVANALHDHFQWLEKEVVFILLSSVMTWAKTKPADADDEEASFNEEDYRRRKPHPNFKEHFNAXXXXXXXXXXXXXXXXMYVLGAGILYGAGENILHDFFKQSW-NNAPESVIYDKGTNVIPTIHVNDLAGVIQNIADSKPVSKYILAVDDSKSTLEDVVKIISQKLSFGKVIRIPKEQVLMENIVQPNDLEILLVNIRLDAMVIKE-MKIKWVAEAGLVENIDTVINEYKTYRNLLPIKVCILGPPCTGKTYYSDKIASKYQLKNMKITEVIADYMKYLEATINYPSILSENIEKEKARNLIQNEEDPDPDFGVXXXXXXXXXXXXXXXXXXXXLQNLTENQGKLYDEDLAMIYKETLLSKECQNHGFVLDGFPETKEQAKLLFSPXXXXXXXXXVKNL-GYNRLITPQHVFVVKVSDKFLEIR-----NSILKSNDSFDEDFRNRLKLYRSVNDDLAEVDEETVLSFFDFREIHPIILQIEEDLSK-DGEENRINLLNEIYYELGEPHTYGPNDEEKILINIKEQEAAXXXXXXXXXXXXXXXXXMLTIRKHNQSEWNENLELVRQQQYEYLETHNLPLRNYLMHLVMPVLTDGLMDCSKVRTEDPIDYLSEFILR 2191
            + ++R+FIN +DSY   ++  +LSNCVVG++L+E   EEEE        +   S K  +G F+I GT  K  S +P          +R++    ++E DVI+Y+ITE   Q+EEA++  +AL +     EK  +FILLS+VMTWA++K  D +D E  F EEDYRRRK HPNF +H NAEK +LK  KK +     YV+ AG+ YGA   +LH FFK +W    P   ++  GTNVIPTIHV DLAGVIQN+ D  P   Y++AVD+S  TLED+VK IS+    GK+ +IP+E   +   +  + L+ LLVN+R++A+ +KE   I+W A+ G VENI+T++ EYK  R L+PIK+CILGPP  GK+  + ++A+ Y+L ++++ +VI++ +  LEA +    +     E E+       E+  +   G++                    +++ +N G+L D+ +    KE L S  C+N G++LDGFP+T +QAK LF+ +++EEE++    +  +++LI P+ V  +  SD+FL+ R      SI+       + F   L  YR +N     +D+ETV ++FD  EIHPI +    D+ K +  +NR+  + ++  E+GEP  YG  DEEK     K  E    +   E   ++ +EA  +  +     EWN+ LE V++++ E LE  ++PLRNYLM  VMP L  GL +C  VR EDP+D+L+E++ +
Sbjct:   15 IRTQRVFINLLDSYSSGNIGKFLSNCVVGASLEEITEEEEEEDENKSAMLEASSTKVKEGTFQIVGTLSKPDSPRPDFAVETYSAISREDLLMRLLECDVIIYNITESSQQMEEAIWAVSALSEEVSHFEKRKLFILLSTVMTWARSKALDPEDSEVPFTEEDYRRRKSHPNFLDHINAEKMVLKFGKKARKFAA-YVVAAGLQYGAEGGMLHTFFKMAWLGEIPALPVFGDGTNVIPTIHVLDLAGVIQNVIDHVPKPHYLVAVDESVHTLEDIVKCISKNTGPGKIQKIPRENAYLTKDLTQDCLDHLLVNLRMEALFVKENFNIRWAAQTGFVENINTILKEYKQSRGLMPIKICILGPPAVGKSSIAKELANYYKLHHIQLKDVISEAIAKLEAIVAPNDVGEGEEEVEEEEEEENVEDAQELLDGIK--------------------ESMEQNAGQLDDQYIIRFMKEKLKSMPCRNQGYILDGFPKTYDQAKDLFNQEDEEEEDDVRGRMFPFDKLIIPEFVCALDASDEFLKERVINLPESIVAGTHYSQDRFLRALSNYRDIN-----IDDETVFNYFDELEIHPIHI----DVGKLEDAQNRL-AIKQLIKEIGEPRNYGLTDEEKAEEERKAAEERLAREAAEEAEREHQEAVEMAEKIARWEEWNKRLEEVKREERELLEAQSIPLRNYLMTYVMPTLIQGLNECCNVRPEDPVDFLAEYLFK 717          
BLAST of adenylate kinase 7 vs. UniProt/SwissProt
Match: sp|Q9D2H2|KAD7_MOUSE (Adenylate kinase 7 OS=Mus musculus OX=10090 GN=Ak7 PE=1 SV=1)

HSP 1 Score: 414.461 bits (1064), Expect = 1.798e-134
Identity = 263/640 (41.09%), Postives = 383/640 (59.84%), Query Frame = 2
Query:  302 VESDVIVYDITEDINQIEEALYVANALHDHFQWLEKEVVFILLSSVMTWAKTKPADADDEEASFNEEDYRRRKPHPNFKEHFNAXXXXXXXXXXXXXXXXMYVLGAGILYGAGENILHDFFKQSW-NNAPESVIYDKGTNVIPTIHVNDLAGVIQNIADSKPVSKYILAVDDSKSTLEDVVKIISQKLSFGKVIRIPKEQVLMENIVQPNDLEILLVNIRLDAMVIKE-MKIKWVAEAGLVENIDTVINEYKTYRNLLPIKVCILGPPCTGKTYYSDKIASKYQLKNMKITEVIADYMKYLEATINYPSILSENIEKEKARNLIQNEEDPDPDF-GVXXXXXXXXXXXXXXXXXXXXLQNLTENQGKLYDEDLAMIYKETLLSKECQNHGFVLDGFPETKEQAKLLFSPXXXXXXXX-XVKNLGYNRLITPQHVFVVKVSDKFLEIR-----NSILKSNDSFDEDFRNRLKLYRSVNDDLAEVDEETVLSFFDFREIHPIILQIEEDLSK-DGEENRINLLNEIYYELGEPHTYGPNDEEKILINIKEQEAAXXXXXXXXXXXXXXXXXMLTIRKHNQSEWNENLELVRQQQYEYLETHNLPLRNYLMHLVMPVLTDGLMDCSKVRTEDPIDYLSEFILR 2191
            +E D ++Y+ITE++ Q+EEAL+  +AL++     EK  VFILLS+VMTWA++KP D DD E  F EEDYRRRK HPNF +H NAEK +LK  K  K     YV+ +G+ YGA   ILH FFK +W    P   ++  GTN IP IHV DLAGVIQNI D  P   Y++AVD++  TLED+VK IS+    GK+ ++PKE   +   +    L+ LLVN+R++A+ +KE   I+WVA+ G VENI++++ EYK  R LLPIK+CILGPP  GK+  S+++A  Y+L ++K+ +VIA+ +  LEA +  P    E  E+ +     +N +D      G++                    +++ +N G+L D+ +    KE L S  C+N GF+LDGFP+T +QAK LF+ + +EEEEE   K   Y++LITP+ V  +  SD+FL+ R      S++       + F   L  YR +N      D+ETV ++FD  EIHPI +    D+ K +  +NR+  + ++  E+G+P  YG  DEEK     K  E    +   +    + KEA  +  +     EWN+ LE V++++ E LE  ++PLRNYLM  VMP L  GL +C KVR EDP+D+L+E++ +
Sbjct:    1 MECDAVIYNITENVQQVEEALWAVSALNEEISHFEKRKVFILLSTVMTWARSKPLDPDDNEVPFTEEDYRRRKHHPNFLDHINAEKIVLKFGKNAKKFAT-YVVASGLQYGAEGGILHTFFKMAWLGEVPALPVFGDGTNCIPAIHVVDLAGVIQNIIDHVPKLHYLVAVDEAVHTLEDLVKCISKNTGPGKIQKVPKENAFLTKDLTQEYLDHLLVNLRMEALFVKENFNIRWVAQTGFVENINSILKEYKQSRGLLPIKICILGPPAVGKSSISEELAKYYKLHHIKMKDVIAEAIAKLEAIVA-PKDSVEGEEEGEEEEEEENVDDAQELLDGIK--------------------ESMEQNAGRLEDQYIIRFVKEKLKSMPCRNQGFILDGFPKTYDQAKDLFNQEEEEEEEEIRGKIFPYDKLITPEFVCGLDASDEFLKERVMNLPESVVAGTHYSQDRFLRSLSHYRDIN-----TDDETVFNYFDELEIHPIHI----DVGKLEDAQNRL-AIKQLIKEIGKPRNYGLTDEEKAEEEKKAAEERLAKEAAQTAELEHKEAMEMAEKIARWEEWNKRLEEVKREERELLEVQSVPLRNYLMTYVMPTLMQGLNECCKVRPEDPVDFLAEYLFK 608          
BLAST of adenylate kinase 7 vs. UniProt/SwissProt
Match: sp|Q95JP6|KAD7_MACFA (Adenylate kinase 7 (Fragment) OS=Macaca fascicularis OX=9541 GN=AK7 PE=2 SV=2)

HSP 1 Score: 311.612 bits (797), Expect = 5.115e-96
Identity = 202/539 (37.48%), Postives = 317/539 (58.81%), Query Frame = 2
Query:  605 YVLGAGILYGAGENILHDFFKQSW-NNAPESVIYDKGTNVIPTIHVNDLAGVIQNIADSKPVSKYILAVDDSKSTLEDVVKIISQKLSFGKVIRIPKEQVLMENIVQPNDLEILLVNIRLDAMVIKE-MKIKWVAEAGLVENIDTVINEYKTYRNLLPIKVCILGPPCTGKTYYSDKIASKYQLKNMKITEVIADYMKYLEATINYPSILSENIEKEKARNLIQNEEDPDPDF-GVXXXXXXXXXXXXXXXXXXXXLQNLTENQGKLYDEDLAMIYKETLLSKECQNHGFVLDGFPETKEQAKLLFSPXXXXXXXXXVKNL-GYNRLITPQHVFVVKVSDKFLEIR-----NSILKSNDSFDEDFRNRLKLYRSVNDDLAEVDEETVLSFFDFREIHPIILQIEEDLSK-DGEENRINLLNEIYYELGEPHTYGPNDEEKILINIKEQEAAXXXXXXXXXXXXXXXXXMLTIRKHNQSEWNENLELVRQQQYEYLETHNLPLRNYLMHLVMPVLTDGLMDCSKVRTEDPIDYLSEFILR 2191
            YV+ AG+ YGA   +LH FFK +W    P   ++  GTNVIPTIHV DLAGVIQN+ D  P   Y++AVD+S  TLED+VK IS+    GK+ +IP+E   +   +  + L+ LLVN+R++A+ +KE   I+WVA+ G VENI++++ EYK  R L+P+K+CILGPP  GK+  ++++A  Y+L ++++ +VI++ +  LE TI  P  + E  E+ +     +N ED      G++                    +++ +N G+L D+ +    KE L S  C+N G++LDGFP+T +QAK LF+ +++EEE+E    +  +++LI P+ V  +  SD+FL+ R       I+       + F   L  YR +N     +++ETV ++FD  EIHPI +    D+ K +  +NR+  + ++  E+GEP  YG  DEEK     K  E    +   E   ++ +EA  +  +     EWN+ LE V++++ E LE  ++PLRNYLM  VMP L  GL +C  VR EDP+D+L+E++ +
Sbjct:   20 YVVAAGLQYGAEGGMLHTFFKMAWLGEIPALPVFGDGTNVIPTIHVLDLAGVIQNVIDHTPKPHYLVAVDESVHTLEDIVKCISKNTGPGKIQKIPRENAYLTKDLTQDCLDHLLVNLRMEALFVKENFNIRWVAQTGFVENINSILKEYKQSRGLMPVKICILGPPAVGKSSIAEELAKYYKLHHIQLKDVISEAIAKLE-TIVAPKDIGEGKEEVEEEEEEENVEDAQELLDGIK--------------------ESMEQNAGQLDDQYIIRFMKEKLKSMPCRNQGYILDGFPKTYDQAKDLFNQEDEEEEDEVRGRMFPFDKLIIPEFVCALDASDEFLKERVINLPERIVAGTHYSQDRFLRALSNYRDIN-----IEDETVFNYFDEIEIHPIHI----DVGKLEDAQNRL-AIKQLIKEIGEPRNYGLTDEEKAEEERKAAEERLAREAAEEAEREHQEAVEMAEKIARWEEWNKRLEEVKREERELLEAQSIPLRNYLMTYVMPTLIQGLNECCNVRPEDPVDFLAEYLFK 527          
BLAST of adenylate kinase 7 vs. TrEMBL
Match: K1QJQ6 (Putative adenylate kinase 7 OS=Crassostrea gigas OX=29159 GN=CGI_10017168 PE=4 SV=1)

HSP 1 Score: 545.043 bits (1403), Expect = 0.000e+0
Identity = 319/731 (43.64%), Postives = 478/731 (65.39%), Query Frame = 2
Query:   17 EEKVESKRIFINHVDSYVGLSLANYLSNCVVGSTLDXXXXXXXXXXXXXXGFISKKNADGLFEIHGTFXXXXXXXXXXXXAILKYDTRDEFFEHIVESDVIVYDITEDINQIEEALYVANALHDHFQWLEKEVVFILLSSVMTWAKTKPADADDEEASFNEEDYRRRKPHPNFKEHFNAXXXXXXXXXXXXXXXXMYVLGAGILYGAGENILHDFFKQSWNNAPESVIYDKGTNVIPTIHVNDLAGVIQNIADSKPVSKYILAVDDSKSTLEDVVKIISQKLSFGKVIRIPKEQVLMENIVQPNDLEILLVNIRLDAMVIKE-MKIKWVAEAGLVENIDTVINEYKTYRNLLPIKVCILGPPCTGKTYYSDKIASKYQLKNMKITEVIADYMKYLEATINYPSILSENIEKEKARNLIQNEEDPDPDFGVXXXXXXXXXXXXXXXXXXXXLQNLTENQGKLYDEDLAMIYKETLLSKECQNHGFVLDGFPETKEQAKLLFSPXXXXXXXXXVKNLGYNRLITPQHVFVVKVSDKFLEIR-----NSILKSNDSFDEDFRNRLKLYRSVNDDLAEVDEETVLSFFDFREIHPIILQIEEDLSKDGEENRINLLNEIYYELGEPHTYGPNDEEKILINIKEQEAAXXXXXXXXXXXXXXXXXMLTIRKHNQSEWNENLELVRQQQYEYLETHNLPLRNYLMHLVMPVLTDGLMDCSKVRTEDPIDYLSEFILR 2191
            EEK +SKRIFINHVD Y G +L+ ++S CVVG++L+E E E++  +       S K  +G +E+ GT K + + KP  +K ++K+D +D+ +EH+VE D+IVYDITED +QI+EA++  + +H   + +EK  +FIL+S+VMTWAK+KP D DD E  F E+DYRRRKPHPNFKEH +AEK ++KL K +K+K+  YV+ +G+ YGA E+I H  FK +W+NAP    +  G NV+PTIH+ DLA VIQNIADS+P  +Y++A DD+++TLE++VK IS KL  GKV  I KE+ L+   ++ +D + LLVN+R+DA+ +KE M+I WV+EAG+VENID +I EYK  R L P+++CILGPP +GKT    K+   Y+L ++KI +VI + ++ L+        LS   + E       ++ED D             KA  A+E   ++ Q+  +  GK+ D  +   +++ L SK CQN GF+LDGFP+T EQA  LF+ + +++ EE+     +++LI P +VF ++ +D+FL  R      S++    + +E    RL+LYRS+N+D     EETVL++FD +E HP  L    D++KD      + + +I   +GEP  YGP  EE   +  +E+EA  ++ + E++ K+ +EAE  ++RK  Q EW + L  V+++++E LE  ++PLRNYLM  VMP LT GL+DC K R EDPIDY++EF+ +
Sbjct:    6 EEKPKSKRIFINHVDQYQGKNLSKFISRCVVGASLEEPEEEDDARSTTSSIIASPK--EGCYEVVGTVKDRDAPKPDFMKEVIKFDNKDQLYEHLVECDIIVYDITEDPDQIDEAVWAVSEIHSDLEKIEKPKMFILISTVMTWAKSKPLDPDDPEIPFTEDDYRRRKPHPNFKEHISAEKTVIKLGKTNKAKLVTYVVASGLTYGAEEHIFHYLFKSAWHNAPFLQCFGSGQNVVPTIHIKDLAAVIQNIADSRPKVRYLIAKDDTQTTLEEIVKAISDKLGKGKVKNITKEEALLSKDIEQSDFDQLLVNLRMDAVFVKENMRIMWVSEAGMVENIDQIIKEYKDSRKLQPLRICILGPPASGKTTVCQKLCEFYKLHHIKIKDVIEEAIEELQT-------LSRRADSE-------DQEDDD------------GKAQDAQELLNEIEQSKNQETGKIEDPHVIKFFRDKLHSKPCQNQGFILDGFPKTIEQANELFATEEEDDAEESA-TTKFDKLIMPDYVFCLEANDEFLRNRVMNLPESVVHGTHNDEEGLMKRLELYRSLNND-----EETVLNYFDEKEFHPEKL----DVTKDDSPMMRDTVEKIKKTIGEPRNYGPTPEELEEMKRQEEEARLKKEMEEKQEKERQEAEEASLRKQRQEEWTQRLNEVKREEFELLEAQSIPLRNYLMKHVMPTLTQGLIDCCKTRPEDPIDYIAEFLFQ 698          
BLAST of adenylate kinase 7 vs. TrEMBL
Match: A0A210Q4I7 (Adenylate kinase 7 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT09342 PE=4 SV=1)

HSP 1 Score: 526.939 bits (1356), Expect = 1.834e-174
Identity = 309/730 (42.33%), Postives = 463/730 (63.42%), Query Frame = 2
Query:   20 EKVESKRIFINHVDSYVGLSLANYLSNCVVGSTLDXXXXXXXXXXXXXXGFISKKNADGLFEIHGTFXXXXXXXXXXXXAILKYDTRDEFFEHIVESDVIVYDITEDINQIEEALYVANALHDHFQWLEKEVVFILLSSVMTWAKTKPADADDEEASFNEEDYRRRKPHPNFKEHFNAXXXXXXXXXXXXXXXXMYVLGAGILYGAGENILHDFFKQSWNNAPESVIYDKGTNVIPTIHVNDLAGVIQNIADSKPVSKYILAVDDSKSTLEDVVKIISQKLSFGKVIRIPKEQVLMENIVQPNDLEILLVNIRLDAMVIKE-MKIKWVAEAGLVENIDTVINEYKTYRNLLPIKVCILGPPCTGKTYYSDKIASKYQLKNMKITEVIADYMKYLEATINYPSILSENIEKEKARNLIQNEEDPDPDFGVXXXXXXXXXXXXXXXXXXXXLQNLTENQGKLYDEDLAMIYKETLLSKECQNHGFVLDGFPETKEQAKLLFSPXXXXXXXXXVKNLGYNRLITPQHVFVVKVSDKFLEIR-----NSILKSNDSFDEDFRNRLKLYRSVNDDLAEVDEETVLSFFDFREIHPIILQIEEDLSKDGEENRINLLNEIYYELGEPHTYGPNDEEKILINIKEQEAAXXXXXXXXXXXXXXXXXMLTIRKHNQSEWNENLELVRQQQYEYLETHNLPLRNYLMHLVMPVLTDGLMDCSKVRTEDPIDYLSEFILR 2191
            EK +SKR+F+NHVD Y G ++  YLS CVVGS+L+E E E++  +      I   N +G +E+ GT K + + KP  VK I++++ +D+ +EH+VE DVI+YDITED +QI+EA++  + +H     +EK  +FIL+S+VMTWAK+KP D DD E  F E+DYRRRKPHPN KEH +AEK ++K+ K +K+K+  YV+ +G+ YGA ENI H  FK +W+NAP+ + +  G NVIPTIH+ DLAGVIQNIADS+P  +Y++A DD+++TLE++VK +SQ L  GKV  I KE+ L+   ++ +D + LLVN+R+DA+ +KE M++ W AE GLVENI  +I EYK  R L P++VC++GPP +GK+    ++   Y+L ++KI +VI + M  L  T       SE+ E+E  +   Q+ +D                        +++ +   +  G+L D+ +   +K+ LLS  CQN GF++DGFP+T EQAK LF+ ++DEE EE  K   YN+L+ P+ VF ++ +D FL  R      S++    + +E    RL  YRS+N+     ++ETVL++FD  E HP  +    D++KD      + + ++   +G P  YGP  EE   +   E+EA  +    ER+ ++ +EAE   +RK  Q EW + L  V++++YE LE  ++PLRNYLM  VMP LT GL+DC K R +DPID L+E++ +
Sbjct:    6 EKPKSKRVFVNHVDQYQGKNIGKYLSRCVVGSSLEEPEEEDDAMSTTSS--IPLINKEGCYEVVGTLKDREAPKPDYVKEIIQFENKDQLYEHLVECDVILYDITEDPDQIDEAVWAVSEIHSDLDKIEKPKMFILISTVMTWAKSKPLDPDDPEIPFTEDDYRRRKPHPNNKEHISAEKTVIKMGKTNKAKLVTYVVASGLTYGAEENIFHYLFKSAWHNAPQLLCFGNGQNVIPTIHIKDLAGVIQNIADSRPKVRYLIAKDDAQNTLEEIVKAVSQNLGTGKVKMITKEEALLSKDIEQSDFDQLLVNLRMDAVNVKENMRVNWAAETGLVENIQQIIKEYKDSRRLQPLRVCVVGPPASGKSTVVQQLCEFYKLHHIKIKDVIDEAMDNLTTTARRAD--SEDQEEEDGK--AQDAQD----------------------LIDRINEGKDQTTGRLEDQHVIQFFKDKLLSMSCQNQGFIIDGFPKTIEQAKELFASEDDEEPEEAAKAGSYNKLLMPEFVFNLESNDDFLHNRVMNLPESVVNGTHNTEEGLIRRLDQYRSINN-----EDETVLNYFDEIEFHPEKV----DVTKDDSHMMKDTVEKLKKVIGAPRNYGPTAEELEEMKRVEEEAHLKHETEERQERERREAEESALRKQRQEEWTQRLNEVKREEYELLEAQSIPLRNYLMKHVMPTLTQGLIDCCKTRPDDPIDALAEYLFQ 698          
BLAST of adenylate kinase 7 vs. TrEMBL
Match: A0A1S3I4J7 (adenylate kinase 7 OS=Lingula unguis OX=7574 GN=LOC106160653 PE=4 SV=1)

HSP 1 Score: 516.538 bits (1329), Expect = 1.825e-170
Identity = 304/732 (41.53%), Postives = 469/732 (64.07%), Query Frame = 2
Query:   20 EKVESKRIFINHVDSYVGLSLANYLSNCVVGSTLDXXXXXXXXXXXXXXGFISKKNADGLFEIHGTFXXXXXXXXXXXXAILKYDTRDEFFEHIVESDVIVYDITEDINQIEEALYVANALHDHFQWLEKEVVFILLSSVMTWAKTKPADADDEEASFNEEDYRRRKPHPNFKEHFNAXXXXXXXXXXXXXXXXMYVLGAGILYGAGENILHDFFKQSWNNAPESVIYDKGTNVIPTIHVNDLAGVIQNIADSKPVSKYILAVDDSKSTLEDVVKIISQKLSFGKVIRIPKEQVLMENIVQPNDLEILLVNIRLDAMVIKE-MKIKWVAEAGLVENIDTVINEYKTYRNLLPIKVCILGPPCTGKTYYSDKIASKYQLKNMKITEVIADYMKYLEATINYPSILSENIEKEKARNLIQNEEDPDPDFGVXXXXXXXXXXXXXXXXXXXXLQNLTENQGKLYDEDLAMIYKETLLSKECQNHGFVLDGFPETKEQAKLLFSPXXXXXXXXXVKNLGYNRLITPQHVFVVKVSDKFLEIR-----NSILKSNDSFDEDFRNRLKLYRSVNDDLAEVDEETVLSFFDFREIHPIILQIEEDLSKDGEENRINLLNEIYYELGEPHTYGPNDEEKILINIKEQEAAXXXXXXXXXXXXXXXXXMLTIRKHNQSEWNENLELVRQQQYEYLETHNLPLRNYLMHLVMPVLTDGLMDCSKVRTEDPIDYLSEFILRYD 2197
            EK +SKR+FINHVD Y G ++A +LS+CVVG++L+E E EEE+A +     +++   +G +EI GT K K +KKP  VK I+ Y+T+++ +EH+VE D+IVYDITED +QI+EA +  + +H   + ++K+++F+L+S+VMTWA++KP D DD E  F E+DYRRRKPHPNFKEH +AEK ++KL K +K K+  YV+ +G+ YG GENI H  FK +W+NA +   +  G NV+PTIH+ DLAGVIQN+ DS+P  +YI+AVDDS++TLE++VK +S  L  GK+  I KE+ L+   ++  D ++LLVN+R+DA+ +KE M+I+WVAE GL+EN+  VI EYK  R L+P++ C+LGPP +GKT    ++   Y+L ++KI +VI + M  L  +    +  +    + +  +  + +ED +    +                     +   +N G++ D+ +   +K+ L S  CQN GF+LDGFP+T+EQA  LF+ +++EE EE  K   +++ I P+ V  +  +D+FL  R      S++    + +E    RL  YR++N      ++ETVL++FD  EIHP  +    D++KD  +   + + ++   +G P  YGP  EE   +  KE+EA  ++   E+  K+ KEAE    RK  Q EW E L+ V++++Y+ LET + PLRNYLM  VMP LT  L+DC KVR +D IDY++E++ +++
Sbjct:    6 EKPKSKRLFINHVDCYEGRNIAKFLSSCVVGASLEEMEEEEEDARSVDSATLARPK-EGCYEIIGTLKNKEAKKPDFVKEIIYYETKEQLYEHLVECDIIVYDITEDPDQIDEATWAVSEIHSDLEKIDKQILFLLISTVMTWARSKPLDPDDPEIPFTEDDYRRRKPHPNFKEHISAEKTVIKLGKTNKQKLVTYVVASGLTYGGGENIFHYLFKAAWHNASQLQCFGPGGNVVPTIHIKDLAGVIQNVVDSRPKVRYIVAVDDSQTTLEEIVKAVSINLGTGKIKHISKEEALLSKDIEQADFDMLLVNLRMDAVYVKENMRIRWVAETGLMENVIPVIKEYKESRGLMPMRACVLGPPASGKTTIVKELCDSYKLHHIKIKDVIEEAMDALTKS----AARANQEPEGEEEDDGKAQEDQELLDAIN--------------------EGKEQNNGRIEDQYVIKFFKQKLHSMPCQNQGFILDGFPKTREQATELFAAEDEEEAEEESKG-SFDKAIMPEVVVCLDATDEFLRARVMNLPESVVAGTHNTEEGLMRRLTEYRAING-----EDETVLNYFDELEIHPDKI----DVTKDSSKMMADTVEKVKKMMGPPRNYGPTAEELAEMRQKEEEAHIKREAEEKAEKERKEAEEAAERKRRQDEWAERLDQVKREEYDMLETQSQPLRNYLMKHVMPTLTQALIDCVKVRPDDAIDYMAEYLFQHN 702          
BLAST of adenylate kinase 7 vs. TrEMBL
Match: A0A267F0T8 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig018534g1 PE=4 SV=1)

HSP 1 Score: 513.842 bits (1322), Expect = 1.902e-169
Identity = 311/733 (42.43%), Postives = 454/733 (61.94%), Query Frame = 2
Query:   11 MSEEKVESKRIFINHVDSYVGLSLANYLSNCVVGSTLDXXXXXXXXXXXXXXGFISKKNADGLFEIHGTFXXXXXXXXXXXXAILKYDTRDEFFEHIVESDVIVYDITEDINQIEEALYVANALHDHFQWLEKEVVFILLSSVMTWAKTKPADADDEEASFNEEDYRRRKPHPNFKEHFNAXXXXXXXXXXXXXXXXMYVLGAGILYGAGENILHDFFKQSWNNAPESVIYDKGTNVIPTIHVNDLAGVIQNIADSKPVSKYILAVDDSKSTLEDVVKIISQKLSFGKVIRIPKEQVLMENIVQPNDLEILLVNIRLDAMVIKE-MKIKWVAEAGLVENIDTVINEYKTYRNLLPIKVCILGPPCTGKTYYSDKIASKYQLKNMKITEVIADYMKYLEATINYPSILSENIEKEKARNLIQNEEDPDPDFGVXXXXXXXXXXXXXXXXXXXXLQNLTENQGKLYDEDLAMIYKETLLSKECQNHGFVLDGFPETKEQAKLLFSPXXXXXXXXXVKNLGYNRLITPQHVFVVKVSDKFLEIR-----NSILKSNDSFDEDFRNRLKLYRSVNDDLAEVDEETVLSFFDFREIHPIILQIEEDLSKDGEENRINLLNEIYYELGEPHTYGPNDEEKILINIKEQEAAXXXXXXXXXXXXXXXXXMLTIRKHNQSEWNENLELVRQQQYEYLETHNLPLRNYLMHLVMPVLTDGLMDCSKVRTEDPIDYLSEFILR 2191
            M+ E  +  RIF+NHVD Y G  ++ YLS C VG+TL+++E EEEEA + + G    K  +G +EIHGT KK  +K+P+ VK IL YDTR++ +EH+VE DVIVYDIT+D +QIEEA++    LH   + LE + VFILLS+VMTWAK+KPAD +D E+   EEDYR+RKPH N+KEH  AEK  +K  K  KS++  Y++ +G+ YG GENI H FFK +W+NA    +Y  G NV+P IH+ DLA V+QNIADSKP  KY++AVDDS++ L++VVK +S  L  GK+  + KE+  +   +    L+ L++++RLDA+ +KE  KI W  E G+VENID +I EYK  R L PIK CILGPP +GK+    ++   Y+L +++  +VI + +               N+++  AR   + E+D             + KA    ET E++ +N+ EN  +L D  +   ++E L SK CQN GF+LDGFP+TK+QA+ LF+PD D+EEE       +N+ + P  +FV++  D FL+ R      +++    + +E    RL  YR++N      ++++V+ +FD +EIHP +     D+SKD       L+  I   +G+P  YG   EE+  I  +E+         ER+ ++ +E +    RK  Q EW   LE V+++++E LE  + PLRNYLM  VMP LT GLM+C+KVR +D IDYL+E++ R
Sbjct:    1 MAAEATKPVRIFVNHVDEYQGYHISKYLSQCAVGATLEDNEEEEEEAGSVLSGDFPVKPKEGCYEIHGTLKKTGAKQPEFVKEILSYDTREQMYEHLVECDVIVYDITQDPDQIEEAMWALTELHQDIEKLESQKVFILLSTVMTWAKSKPADEEDLESPLTEEDYRKRKPHQNYKEHLAAEKAAVKYGKTKKSRLTTYIVASGLTYGCGENIFHSFFKAAWHNAFTLPVYGNGQNVLPMIHIRDLAAVLQNIADSKPKVKYLVAVDDSQNMLDEVVKAVSVGLCTGKIRTVTKEEAALSKDIDQATLDQLMLSLRLDAIYVKENFKINWACETGIVENIDQIIKEYKKERGLQPIKACILGPPASGKSVIVKQLCDFYKLHHIRAKDVITEAIA--------------NLQRSAARADAEEEDD-------------DGKAAEDAETLEQVNENMAENNDRLDDSFVIRFFREKLASKACQNQGFILDGFPKTKQQAEDLFAPDEDDEEEGEDGGGPFNKRLMPDQLFVLEAGDDFLKRRVMQLPEAVVAGTHNTEEGLLRRLSEYRAIN-----TEDDSVVMYFDEKEIHPDVF----DVSKDDSTMHAALVERIKKAIGKPRNYGLTPEEQEEIRRREETERLENEKRERDERERRERQEADERKRRQEEWAARLEEVKREEHELLEIRSEPLRNYLMKHVMPNLTKGLMECAKVRPDDAIDYLAEYLFR 697          
BLAST of adenylate kinase 7 vs. TrEMBL
Match: A0A267FNY3 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig018534g3 PE=4 SV=1)

HSP 1 Score: 513.072 bits (1320), Expect = 3.674e-169
Identity = 311/733 (42.43%), Postives = 454/733 (61.94%), Query Frame = 2
Query:   11 MSEEKVESKRIFINHVDSYVGLSLANYLSNCVVGSTLDXXXXXXXXXXXXXXGFISKKNADGLFEIHGTFXXXXXXXXXXXXAILKYDTRDEFFEHIVESDVIVYDITEDINQIEEALYVANALHDHFQWLEKEVVFILLSSVMTWAKTKPADADDEEASFNEEDYRRRKPHPNFKEHFNAXXXXXXXXXXXXXXXXMYVLGAGILYGAGENILHDFFKQSWNNAPESVIYDKGTNVIPTIHVNDLAGVIQNIADSKPVSKYILAVDDSKSTLEDVVKIISQKLSFGKVIRIPKEQVLMENIVQPNDLEILLVNIRLDAMVIKE-MKIKWVAEAGLVENIDTVINEYKTYRNLLPIKVCILGPPCTGKTYYSDKIASKYQLKNMKITEVIADYMKYLEATINYPSILSENIEKEKARNLIQNEEDPDPDFGVXXXXXXXXXXXXXXXXXXXXLQNLTENQGKLYDEDLAMIYKETLLSKECQNHGFVLDGFPETKEQAKLLFSPXXXXXXXXXVKNLGYNRLITPQHVFVVKVSDKFLEIR-----NSILKSNDSFDEDFRNRLKLYRSVNDDLAEVDEETVLSFFDFREIHPIILQIEEDLSKDGEENRINLLNEIYYELGEPHTYGPNDEEKILINIKEQEAAXXXXXXXXXXXXXXXXXMLTIRKHNQSEWNENLELVRQQQYEYLETHNLPLRNYLMHLVMPVLTDGLMDCSKVRTEDPIDYLSEFILR 2191
            M+ E  +  RIF+NHVD Y G  ++ YLS C VG+TL+++E EEEEA + + G    K  +G +EIHGT KK  +K+P+ VK IL YDTR++ +EH+VE DVIVYDIT+D +QIEEA++    LH   + LE + VFILLS+VMTWAK+KPAD +D E+   EEDYR+RKPH N+KEH  AEK  +K  K  KS++  Y++ +G+ YG GENI H FFK +W+NA    +Y  G NV+P IH+ DLA V+QNIADSKP  KY++AVDDS++ L++VVK +S  L  GK+  + KE+  +   +    L+ L++++RLDA+ +KE  KI W  E G+VENID +I EYK  R L PIK CILGPP +GK+    ++   Y+L +++  +VI + +               N+++  AR   + E+D             + KA    ET E++ +N+ EN  +L D  +   ++E L SK CQN GF+LDGFP+TK+QA+ LF+PD D+EEE       +N+ + P  +FV++  D FL+ R      +++    + +E    RL  YR++N      ++++V+ +FD +EIHP +     D+SKD       L+  I   +G+P  YG   EE+  I  +E+         ER+ ++ +E +    RK  Q EW   LE V+++++E LE  + PLRNYLM  VMP LT GLM+C+KVR +D IDYL+E++ R
Sbjct:    1 MAAEATKPVRIFVNHVDEYQGYHISKYLSQCAVGATLEDNEEEEEEAGSVLSGDFPVKPKEGCYEIHGTLKKTEAKQPEFVKEILSYDTREQMYEHLVECDVIVYDITQDPDQIEEAMWALTELHQDIEKLESQKVFILLSTVMTWAKSKPADEEDLESPLTEEDYRKRKPHQNYKEHLAAEKAAVKYGKTKKSRLTTYIVASGLTYGCGENIFHSFFKAAWHNAFTLPVYGNGQNVLPMIHIRDLAAVLQNIADSKPKVKYLVAVDDSQNMLDEVVKAVSVGLCTGKIRTVTKEEAALSKDIDQATLDQLMLSLRLDAIYVKENFKINWACETGIVENIDQIIKEYKKERGLQPIKACILGPPASGKSVIVKQLCDFYKLHHIRAKDVITEAIA--------------NLQRSAARADAEEEDD-------------DGKAAEDAETLEQVNENMAENNDRLDDSFVIRFFREKLASKACQNQGFILDGFPKTKQQAEDLFAPDEDDEEEGEDGGGPFNKRLMPDQLFVLEAGDDFLKRRVMQLPEAVVAGTHNTEEGLLRRLGEYRAIN-----TEDDSVVMYFDEKEIHPDVF----DVSKDDSTMHAALVERIKKAIGKPRNYGLTPEEQEEIRRREETERLENEKRERDERERRERQEADERKRRQEEWAARLEEVKREEHELLEIRSEPLRNYLMKHVMPNLTKGLMECAKVRPDDAIDYLAEYLFR 697          
BLAST of adenylate kinase 7 vs. Ensembl Cavefish
Match: ak7b (adenylate kinase 7 [Source:NCBI gene;Acc:103041221])

HSP 1 Score: 429.483 bits (1103), Expect = 4.270e-140
Identity = 270/726 (37.19%), Postives = 413/726 (56.89%), Query Frame = 2
Query:   38 RIFINHVDSYVGLSLANYLSNCVVGSTL-DXXXXXXXXXXXXXXGFISKKNADGLFEIHGTFXXXXXXXXXXXXAILKYDTRDEFFEHIVESDVIVYDITEDINQIEEALYVANALHDHFQWLEKEVVFILLSSVMTWAKTKPADADDEEASFNEEDYRRRKPHPNFKEHFNAXXXXXXXXXXXXXXXXMYVLGAGILYGAGENILHDFFKQSWNNAPESV-IYDKGTNVIPTIHVNDLAGVIQNIADSKPVSKYILAVDDSKSTLEDVVKIISQKLSFGKVIRIPKEQVLMENIVQPNDLEILLVNIRLDAMVIKE-MKIKWVAEAGLVENIDTVINEYKTYRNLLPIKVCILGPPCTGKTYYSDKIASKYQLKNMKITEVIADYMKYLEATINYPSILSENIEKEKARNLIQNEEDPDPDFGVXXXXXXXXXXXXXXXXXXXXLQNLTENQGKLYDEDLAMIYKETLLSKECQNHGFVLDGFPETKEQAKLLFSPXXXXXXXXXVKNLGYNRLITPQHVFVVKVSDKFLEIR-----NSILKSNDSFDEDFRNRLKLYRSVNDDLAEVDEETVLSFFDFREIHPIILQIEEDLSKDGEENRINLLNEIYYELGEPHTYGPNDEEKILINIKEQEAAXXXXXXXXXXXXXXXXXMLTIRKHNQSEWNENLELVRQQQYEYLETHNLPLRNYLMHLVMPVLTDGLMDCSKVRTEDPIDYLSEFILR 2191
            RI+IN++ SY    ++ YLS+C  G++L D +  E E    +       K  +G F+I GT   K  +K     A     T+ E   H++E DVI Y+ITE  +QI EA +  +ALH          +FIL+S+VMTWA +KP D DD E  F EEDYRRRK HPNFK+H   EK ++KL K ++S+   YV+ AG+ YG  E + H FFK++W      V ++  G+N++PT+HV DLA ++QNI D KP  +Y LAVDDSK T+E++V+ I+  L  GK   +PK+ + +   +   D++ L V++R++A  +KE   ++W++E G+VENI+ V  EYK  R LLP+++C+LGPP  GK+  ++KI   Y+L ++++ E IA+ +  LEA      I  +  E E A +    +E                         E L +N+ +N G L D+ +  I K+ L SK C N GFVLDGFP+T +QAK LFS + DE E+   K   +N+ I P+ +F +  +D FL+ R      S+++      E F  RL  +R  N      ++ETVL+FFD  EI   +  IE  ++   + + + ++ ++   +G+P  YGP+ EE  L   ++ E   R+    +   +  EAE    R     EW+  LE +++Q+ E LE  ++PLR YLM  VMP LT GL++C ++R EDP+D+L+E++L+
Sbjct:   14 RIYINNIHSYSSKHISQYLSSCRFGASLVDPEVDEREGVQDDQTN--EAKAKEGTFQIVGTTSGKAEQKCSFAAAEYNNLTQTELLHHLMECDVIFYNITEHADQIAEASWAVSALHKEIDEFTGPKMFILISTVMTWALSKPVDPDDPEIPFTEEDYRRRKAHPNFKDHIALEKLVVKLGKTNRSQFCTYVVAAGLQYGLEEQVFHLFFKKAWLGEAGGVPVFGDGSNIVPTVHVTDLARIVQNIIDRKPNPQYFLAVDDSKHTMEEIVRAIANNLGSGKTQTVPKDDLYLTQDLTQADIDSLFVSLRMEAAFLKENFNMRWISETGIVENIERVTEEYKLSRGLLPVRICLLGPPAVGKSTVAEKICKHYKLHHVRLKETIAETLANLEA-----GIYQDEGENEGAESSGGAQE-----------------------FLETLRENMEQNGGLLDDQFIIQIMKDKLKSKPCTNQGFVLDGFPKTYDQAKELFSAEEDELEDARSKIPPHNKKIIPEFIFSLDATDAFLKKRVLNLPESVVEGTSYSQEKFLRRLASFRENNS-----EDETVLNFFDELEIP--LEHIE--ITSSDDLDYLLVMEKVSKCVGQPRNYGPSSEEVELEERRQVEIRIREEAALQAEMERNEAEEAAQRTQKWEEWSRRLEEIQRQEDELLEAESVPLRQYLMRDVMPTLTQGLIECCRIRPEDPVDFLAEYLLK 700          
BLAST of adenylate kinase 7 vs. Ensembl Cavefish
Match: ak7a (adenylate kinase 7a [Source:ZFIN;Acc:ZDB-GENE-040724-122])

HSP 1 Score: 378.252 bits (970), Expect = 3.830e-121
Identity = 229/652 (35.12%), Postives = 377/652 (57.82%), Query Frame = 2
Query:  275 TRDEFFEHIVESDVIVYDITEDINQIEEALYVANALHDHFQWLEKEVVFILLSSVMTWAKTKPADADDEEASFNEEDYRRRKPHPNFKEHFNAXXXXXXXXXXXXXXXXMYVLGAGILYGAGENILHDFFKQSWNNAPESV-IYDKGTNVIPTIHVNDLAGVIQNIADSKPVSKYILAVDDSKSTLEDVVKIISQKLSFGKVIRIPKEQVLMENIVQPNDLEILLVNIRLDAMVIKE-MKIKWVAEAGLVENIDTVINEYKTYRNLLPIKVCILGPPCTGKTYYSDKIASKYQLKNMKITEVIADYMKYLEATINYPSILSENIEK-EKARNLIQNEEDPDPDFGVXXXXXXXXXXXXXXXXXXXXLQNLTENQGKLYDEDLAMIYKETLLSKECQNHGFVLDGFPETKEQAKLLFSPXXXXXXXXXVKNLGYNRLITPQHVFVVKVSDKFLEIRNSILKSNDS-----FDEDFRNRLKLYRSVNDDLAEVDEETVLSFFDFREIHPIILQIEEDLSKDGEENRINLLNEIYYELGEPHTYGPNDEEKI-----LINIKEQEAAXXXXXXXXXXXXXXXXXMLTIRKHNQSEWNENLELVRQQQYEYLETHNLPLRNYLMHLVMPVLTDGLMDCSKVRTEDPIDYLSEFILR 2191
            +RDE  + + + DVIVY+I+ED + I+EA +  +ALH     ++   VFIL+S++MTWA TKPAD DD E    E+DYRR++ HPNFK   +AEK +LKL K  KSK+  Y++ AG+ YG GE++ H FFK SW     S+ +   GTN++PTIH+ DLAG++QNI D KP + Y +AVD+SK+TLED+VK I+ +L  G+V ++PKE   +       +LE+ ++N+R++ +++++   ++WV E+G+++NI +V+ EYK  R LLPIK+C+LGPP  GKT  + ++ + Y+L ++++ E I + +K+LE  +      ++N E  ++A+ L+ + +D                              +++N  +L ++ +    +ETL SK C+N GFVLDG+P T EQAK +F  +   + +   K           ++F +  +D+FL+ R   L  N +       ++F   L  +R+ N      ++ETVL++FD  EIHP  ++I   +  D E   +    +I   +G    YGP  EEK      +  +++Q+ A+                    R   ++E    +  V+QQ+ E L+  +LPLR+YLM  V+P +T+GL++C K + +DP+D+L+E++LR
Sbjct:   51 SRDELLQCLKKCDVIVYNISEDTDVIDEATWAISALHSEINHIKLPKVFILVSTLMTWAMTKPADPDDPEVPLLEDDYRRKRSHPNFKAQASAEKLVLKLGKTKKSKLTTYIVAAGLQYGMGESMFHIFFKASWLGEMSSIPVLGSGTNIVPTIHIYDLAGIVQNIIDHKPKAHYFVAVDNSKNTLEDIVKAIAFELGPGRVTKVPKEHPFI-----TQELEVCILNLRIEQVLLRDTFDLRWVCESGIIDNISSVVEEYKQTRRLLPIKICLLGPPAVGKTLVALQLCNHYKLHHIRVQEAIEEKIKHLEEVLQGSDRENDNEEVLQEAQELLDSLKD-----------------------------CVSQNTEQLNNQGVLRTIRETLNSKPCRNQGFVLDGYPTTTEQAKEIFYGETQLQMKHAFK----------WYIFSLDATDEFLKERVLELPQNLAEEMHYTQDEFLQCLSTFRAQN-----TEDETVLNYFDELEIHPEHIEINSTI--DSENKAVT--EKIIQIVGGAMNYGPTPEEKAEEQQKIALLRDQQLAQEAAD----------------RGLREAEKKARISEVKQQECELLDARSLPLRHYLMKHVIPTVTEGLVECCKAKPDDPLDFLAEYLLR 633          
BLAST of adenylate kinase 7 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004607.1 (pep scaffold:Pmarinus_7.0:GL477409:196306:217011:1 gene:ENSPMAG00000004138.1 transcript:ENSPMAT00000004607.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 431.024 bits (1107), Expect = 5.349e-141
Identity = 282/749 (37.65%), Postives = 425/749 (56.74%), Query Frame = 2
Query:   32 SKRIFINHVDSYVGLSLANYLSNCVVGSTLDXXXXXXXXXXXXXXGFISKKNADG-----------LFEIHGTFXXXXXXXXXXXXAILKYDTRDEFFEHIVESDVIVYDITEDINQIEEALYVANALHDHFQWLEKEVVFILLSSVMTWAKTKPADADDEEASFNEEDYRRRKPHPNFKEHFNAXXXXXXXXXXXXXXXXMYVLGAGILYGAGENILHDFFKQSWNNAPESV-IYDKGTNVIPTIHVNDLAGVIQNIADSKPVSKYILAVDDSKSTLEDVVKIISQKLSFGKVIRIPKEQVLMENIVQPNDLEILLVNIRLDAMVIK-EMKIKWVAEAGLVENIDTVINEYKTYRNLLPIKVCILGPPCTGKTYYSDKIASKYQLKNMKITEVIADYMKYLEATINYPSILSENIEKEKARNLIQNEEDPDPDFGVXXXXXXXXXXXXXXXXXXXXLQNLTENQGKLYDEDLAMIYKETLLSKECQNHGFVLDGFPETKEQAKLLFSPXXXXXXXXXV---KNLGYNRLITPQHVFVVKVSDKFLEIR-----NSILKSNDSFDEDFRNRLKLYRSVNDDLAEVDEETVLSFFDFREIHPIILQIEEDLSKDGEENRINLLNEIYYELGEPHTYGPNDEEKILINIKEQEAAXXXXXXXXXXXXXXXXXMLTIRKHNQSEWNENLELVRQQQYEYLETHNLPLRNYLMHLVMPVLTDGLMDCSKVRTEDPIDYLSEFILRYDNRKHAD 2215
            ++R+FIN VDS++G SLA +LS CVVG++L+  E  EEE   E           G            +++ GT ++  S +P  V+ I+K  +R++   H++E D+IVY+ITED +Q EEA +    +H+  +  E   VF+LLS++MTWA+T+P D DD E  F EEDYRRRKPHPNF +  + E+ ++KL K +K+    +VL  G++YG GE++ H FFK +W     ++ IY  G+N++PTIHV D+AGV+QNI D KP   Y+LA D S  TLE++VK IS+ L  GK I++PKE+ L+   +  +D + LLVN+R DA  ++  M I WVAE GLVENI T++ EYK  R LLP++ C+LGPP  GKT   +K+   Y+L ++K  +VI + ++ LE                    +    +    +    E  E E +   A+E  E + ++L +N G+L D  L   +KE L S  CQN GF+LDGFP+T  QAK LF+ ++D EEEE+    K   Y++ I P  V  ++  D+FL  R      +++      +E    RL  +R+ N     VD ET+L++F+ +     +     D++K+  E  + L++++   +GEP  YG   EE+  I  +  E   RQ   +    +  E      R+   +EW   LE  R+++ E L    +PLR YL+  VMP LT GL++C  VR  DP+D+L+E+I  + N   AD
Sbjct:   20 ARRVFINRVDSFLGRSLARHLSGCVVGASLESMEGMEEEDEEEEAHDEMDGEGSGQGPSKAARVKMTYQVVGTLRQPESPEPDFVQQIVKPSSREDLLYHLMECDIIVYNITEDADQTEEASWAVTEIHEKLKSFENPKVFVLLSTIMTWARTRPLDPDDPELDFTEEDYRRRKPHPNFTQEIDVERLVIKLGKTNKTTFSTFVLACGLMYGMGESVFHHFFKTAWLGELSALPIYGPGSNIVPTIHVKDVAGVVQNILDRKPKVHYLLATDSSNHTLEEIVKAISKHLGPGKTIKVPKEEALLLRDLMQSDYDHLLVNLRFDAQFLRGGMNIHWVAEGGLVENIATIVREYKEIRGLLPMRGCVLGPPAVGKTSLVEKLCKHYRLHHIKAKDVIDEAIERLE-------------------RIAARAQKEGEEEEHRETGEEEQEDEDAQELLEAVKESLEQNNGRLEDTYLVRFFKEKLRSMSCQNQGFILDGFPKTYAQAKELFTGEDDAEEEEDAISGKENYYDKSIIPDLVVSLEAPDEFLRDRVMNLPEAVVAGTHYTEEATLRRLAAFRAHNT----VD-ETILNYFEEQS----VAVAHYDVTKEDAEFLL-LVHQLLKRMGEPRNYGLTAEEREEIFRRAAEERMRQEAEKWAEWERHEVVEAAERERKLNEWQAKLEAERRREQELLARETVPLREYLLAHVMPTLTTGLIECCSVRPPDPVDFLAEYI--FKNNPQAD 737          
BLAST of adenylate kinase 7 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005320.1 (pep scaffold:Pmarinus_7.0:GL477536:369:14184:1 gene:ENSPMAG00000004809.1 transcript:ENSPMAT00000005320.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 384.8 bits (987), Expect = 1.367e-124
Identity = 236/654 (36.09%), Postives = 374/654 (57.19%), Query Frame = 2
Query:  275 TRDEFFEHIVESDVIVYDITEDINQIEEALYVANALHDHFQWLEKEVVFILLSSVMTWAKTKPADADDEEASFNEEDYRRRKPHPNFKEHFNAXXXXXXXXXXXXXXXXMYVLGAGILYGAGENILHDFFKQSW-NNAPESVIYDKGTNVIPTIHVNDLAGVIQNIADSKPVSKYILAVDDSKSTLEDVVKIISQKLSFGKVIRIPKEQVLMENIVQPNDLEILLVNIRLDAMVIK-EMKIKWVAEAGLVENIDTVINEYKTYRNLLPIKVCILGPPCTGKTYYSDKIASKYQLKNMKITEVIADYMKYLEATINYPSILSENIEKEKARNLIQNEEDPDPDFGVXXXXXXXXXXXXXXXXXXXXLQNLTENQGKLYDEDLAMIYKETLLSKECQNHGFVLDGFPETKEQAKLLFSPXXXXXXXXXVKNLG--YNRLITPQHVFVVKVSD-----KFLEIRNSILKSNDSFDEDFRNRLKLYRSVNDDLAEVDEETVLSFFDFREIHPIILQIEEDLSKDGE-ENRINLLNEIYYELGEPHTYGPNDEEKILINIKEQEAAXXXXXXXXXXXXXXXXXMLTIRKHNQSEWNENLELVRQQQYEYLETHNLPLRNYLMHLVMPVLTDGLMDCSKVRTEDPIDYLSEFILRYDNRK 2206
            +R+E    ++  D+IVYDI E  + ++EA +V +ALH   +  +   +FIL+SS MTW  TKP D DD E  F ++D+R+R+PHP FK+H   EK ++KL K  K K   YV+ +G+ YG GE   H FFK +W   +P   + D+GTNV+PTIH+ DLAGVIQNIAD KP ++YILAVD+ K T  +V + IS++L  G++  I K + L      P+ +E LL+++  +A+ +K E+ ++WVAEAGL+ N++ V+ E++  R L PI++CILGPP TGKT  +  +   Y++ ++ + +VI + +  LE  +   S   E    E+       +     DF                   E L +N+ +N+G+L D  L  +YKETL S  CQN GFVLDGFP+T  QA  LF  +++E+ EE  K     +++ I P+ V  +   D     + + +    +   D  +E  R RL  + + +      +++TVL +FD  EIHP    I+  + +  + + RI  L      +GEP  YGP+ EE++ +  + +   + +    R ++ + +++    R   + EW+   E V++Q++E +   +LPLRNYLM  VMP L  GL +C KV+  DPID+++E++L+Y+  K
Sbjct:    3 SREELKSFLLGCDIIVYDIRETADLLDEAAWVHSALHAEIENFKDPKIFILISSFMTWTLTKPVDPDDPEVPFTDDDHRKRRPHPAFKDHVALEKLVMKLGKTSKKKFIGYVVSSGLPYGMGEEPFHFFFKTAWLGESPAVPVIDRGTNVLPTIHIRDLAGVIQNIADHKPKTRYILAVDEGKHTQLEVAQAISKRLGTGRISHISKHEALSNKDCLPHHVEQLLLDVCAEAVFVKEELNVRWVAEAGLLANLERVVREFRATRKLQPIRICILGPPVTGKTTVAQMLCKHYKIHHVNMKDVITEALSKLERIVGSASRKEETEWHEEDVEAFTEDVQEAQDF------------------LEALRENMLQNEGRLEDSYLVRLYKETLSSPPCQNQGFVLDGFPKTFSQAVQLFGVEDEEDGEELNKRKVPLFDKSIIPELVVSLDAEDDVVLHRAMALPECAVLEADLTEERVRRRLAEFHARHS-----EDDTVLDYFDELEIHPD--HIDVSVCEVAQIKRRIRKL------IGEPRNYGPSAEEQLELAQRAEAKQREREARRRVDQLLLDSQQAAQRLCQEEEWHACWEEVKRQEHEAMGARHLPLRNYLMKYVMPPLAQGLDECCKVKPHDPIDFVAEYLLQYNCDK 625          
BLAST of adenylate kinase 7 vs. Ensembl Nematostella
Match: EDO36546 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIC3])

HSP 1 Score: 434.491 bits (1116), Expect = 2.016e-142
Identity = 276/726 (38.02%), Postives = 434/726 (59.78%), Query Frame = 2
Query:   38 RIFINHVDSYVGLSLANYLSNCVVGSTLDXXXXXXXXXXXXXXGFISKKNADGLFEIHGTFXXXXXXXXXXXXAILKYDTRDEFFEHIVESDVIVYDITEDINQIEEALYVANALHDHFQWLEKEVVFILLSSVMTWAKTKPADADDEEASFNEEDYRRRKPHPNFKEHFNAXXXXXXXXXXXXXXXXMYVLGAGILYGAGENILHDFFKQSWNNA-PESVIYDKGTNVIPTIHVNDLAGVIQNIADSKPVSKYILAVDDSKSTLEDVVKIISQKLSFGKVIRIPKEQVLMENIVQPNDLEILLVNIRLDAMVIKE-MKIKWVAEAGLVENIDTVINEYKTYRNLLPIKVCILGPPCTGKTYYSDKIASKYQLKNMKITEVIADYMKYLEATINYPSILSENIEKEKARNLIQNEEDPDPDFGVXXXXXXXXXXXXXXXXXXXXLQNLTENQGKLYDEDLAMIYKETLLSKECQNHGFVLDGFPETKEQAKLLFSPXXXXXXXXXVKNLGYNRLITPQHVFVVKVSDKFLEIR-----NSILKSNDSFDEDFRNRLKLYRSVNDDLAEVDEETVLSFFDFREIHPIILQIEEDLSKDGEENRI-NLLNEIYYELGEPHTYGPNDEEKILINIKEQEAAXXXXXXXXXXXXXXXXXMLTIRKHNQSEWNENLELVRQQQYEYLETHNLPLRNYLMHLVMPVLTDGLMDCSKVRTEDPIDYLSEFILR 2191
            R+F+NHVD+Y   +++  L+  VVG+T DE+E  ++E+ A  E  I     D  ++I GT +  T  KP  V  + +Y T++E   H++  D+++YDI    +Q+++A +  +AL+   +      VFI +S++MTWA++KP D DD E  F E+DYRRR+ HPNFK H +AEK ++K  K +K+K   YV+ +G+ YG+GE+I H  FK +W+   P    +  G N++PTIH++DLA ++ NI D  P  +Y++AVD+SK+TLE++VK +S  L  GKV +I KE+ L+   ++  D ++LLVN+R++A  IKE M I WV+E G+V+NI+ VI EYK  R LLP++ CILGPP +GKT    ++ + Y+L +++I  VI + ++ L+ +       +++ +  KA      +ED +                      E LL++  +N G+  D+ +   Y+E L S  CQN GF+LDG+P+T EQAK LF+   + EE E+   L Y++L  P+ V  +  SD FL+ R      S++    + +E    RL  YR+VN      ++ETVL+FFD  EIHP  +    D+S+D  + ++   + +I   +GEP  YGP  EE   +  KE E    +   ERE ++ +EAE   +R   + EW   L+ V++Q+ E LE  ++PLRNYLM  VMP LT GL++  KVR +DPID+++E++ +
Sbjct:   15 RVFLNHVDAYSSKNISKILARSVVGATADEEEVNDDESQASGEAPI---QTDACYQIVGTMQDPTQPKPNWVDEVFEYKTKEELLPHLLGCDIVLYDINGPPDQVDQATWAVSALYAELENWSGLKVFICMSTIMTWARSKPLDPDDPEIPFTEDDYRRRRAHPNFKPHISAEKLVIKHGKTNKAKFITYVVASGLTYGSGEDIFHFLFKTAWHGQMPALQCFGPGDNIVPTIHISDLASIVLNICDQHPKVRYMVAVDESKNTLEEIVKAVSIYLGTGKVKKISKEEALLIKELEQADFDMLLVNLRMEATFIKEGMNINWVSETGVVDNIEKVIKEYKETRGLLPVRACILGPPASGKTLVVKQLCTHYKLHHIRIQSVIDEAIEKLQQSAARADQDNDDEDDMKA------QEDQE--------------------LLEALLESKEQNNGRYEDQYIIRFYREKLHSMPCQNQGFILDGYPKTYEQAKELFA-AEEGEEAEDESPLAYDKLTMPEVVVSLDASDDFLKTRVMNLPESVVAGTHNTEEGLMRRLSEYRAVN-----TEDETVLNFFDELEIHPDNI----DISQDSNDPKMCATVEQIKKLMGEPRNYGPTPEELAEMERKETEKRLEKERKEREERERREAEEAALRAQREEEWRVRLQEVKKQEQELLENQSIPLRNYLMKHVMPTLTQGLIEACKVRPDDPIDFVAEYLFQ 701          
BLAST of adenylate kinase 7 vs. Ensembl Medaka
Match: ak7b (adenylate kinase 7 [Source:NCBI gene;Acc:101170721])

HSP 1 Score: 337.806 bits (865), Expect = 2.504e-105
Identity = 208/652 (31.90%), Postives = 349/652 (53.53%), Query Frame = 2
Query:  278 RDEFFEHIVESDVIVYDITEDINQIEEALYVANALHDHFQWLEKEVVFILLSSVMTWAKTKPADADDEEASFNEEDYRRRKPHPNFKEHFNAXXXXXXXXXXXXXXXXMYVLGAGILYGAGENILHDFFKQSW-NNAPESVIYDKGTNVIPTIHVNDLAGVIQNIADSKPVSKYILAVDDSKSTLEDVVKIISQKLSFGKVIRIPKEQVLMENIVQPNDLEILLVNIRLDAMVIKEM-KIKWVAEAGLVENIDTVINEYKTYRNLLPIKVCILGPPCTGKTYYSDKIASKYQLKNMKITEVIADYMKYLEATINYPSILSENIEKEKARNLIQNEEDPDPDFGVXXXXXXXXXXXXXXXXXXXXLQNLTENQGKLYDEDLAMIYKETLLSKECQNHGFVLDGFPETKEQAKLLFSPXXXXXXXXXVKNLGYNRLITPQHVFVVKVSDKFLEIR-----NSILKSNDSFDEDFRNRLKLYRSVNDDLAEVDEETVLSFFDFREIHPIILQIEEDLSKDGEENRINLLNEIYYELGEPHTYGPNDEEKILIN-------IKEQEAAXXXXXXXXXXXXXXXXXMLTIRKHNQSEWNENLELVRQQQYEYLETHNLPLRNYLMHLVMPVLTDGLMDCSKVRTEDPIDYLSEFILR 2191
            R+E    +++ D ++Y+++++  Q+EEA +   ALH          +FIL+S+VMTWA +KP D DD    F +E +  RK HPNF  H + EK + K+ K ++     YV+ +G+ YG GEN+ H FFK++W    PE  ++  G N++PTIH+ DLA VIQ++   +P   Y+LAVD S +++E+++K ++  L  GK+ + P E+ L+   +   D++ LLV++R++A+ I+++  I W  E+GLVEN+D V+ EY+  R LLPI++C+LGPP  GK+  S +I   Y+L  + + + +++ +  LE ++N    L    +    ++L+ + +D                         K  ++++ENQ K          KE L+S  C+N GFVLDGFP T EQAK +FS     EE++   +    R + P+ VF +   D  L  R      S+++ ++   E+F  RL  YR +N       EETVL+FF   +I    L+I    +   E     L+ +I   +G P +Y P+ +E            +KE+  AK +       ++        + K     W+  L++VR+Q+ E L+   L   +YL   VMP L   L +C +V+  DP+D+++E++++
Sbjct:   71 REELLSKLMQCDAVIYNVSQETGQVEEAAWAVTALHGLMGSFSGPKMFILISTVMTWASSKPVDPDDPTLPFTDEIFWSRKAHPNFARHIDLEKRVAKMGKTNRELFSTYVVASGLQYGMGENLFHYFFKKAWLGQEPEVSVFGDGDNIVPTIHIRDLASVIQHVIHHRPRPYYLLAVDGSNNSMEEIIKAVASTLGSGKIHKRPIEEALLVQDLSATDIDYLLVSLRMEAVFIRKLFSISWHCESGLVENVDLVVEEYRQTRGLLPIRMCVLGPPAAGKSTVSKQICQHYKLHYITLRDAVSEAIAQLEDSVN----LDPEADDSTMKDLLSSLKD-----------------------SMKHNKDVSENQLK--------ALKEKLMSNPCRNQGFVLDGFPNTYEQAKEVFS---GAEEDDETPHKASFRRVVPEFVFTLDAPDNLLVDRVMNLPESVVQEHNYHPENFTKRLATYRKMN-----TLEETVLTFFTELDIPSWRLEI----TSSKEAYNQPLIQKILQTVGPPRSYSPSRQEVEEEERRKAEEMMKEEALAKAESERREAEEEEARRRASRLEK-----WSRCLKVVRRQKEEPLKAEAL---SYLKREVMPTLVQALSECCRVQPPDPVDFVAEYLIK 667          
BLAST of adenylate kinase 7 vs. Ensembl Medaka
Match: ak7a (adenylate kinase 7 [Source:NCBI gene;Acc:101157414])

HSP 1 Score: 301.597 bits (771), Expect = 2.239e-92
Identity = 216/652 (33.13%), Postives = 336/652 (51.53%), Query Frame = 2
Query:  275 TRDEFFEHIVESDVIVYDITEDI--NQIEEALYVANALHDHFQWLEKEVVFILLSSVMTWAKTKPADADDEEASFNEEDYRRRKPHPNFKEHFNAXXXXXXXXXXXXXXXXMYVLGAGILYGAGENILHDFFKQSWN-NAPESVIYDKGTNVIPTIHVNDLAGVIQNIADSKPVSKYILAVDDSKSTLEDVVKIISQKLSFGKVIRIPKEQVLMENIVQPNDLEILLVNIRLDAMVIKE-MKIKWVAEAGLVENIDTVINEYKTYRNLLPIKVCILGPPCTGKTYYSDKIASKYQLKNMKITEVIADYMKYLEATI------NYPSILSENIEKEKARNLIQNEEDPDPDFGVXXXXXXXXXXXXXXXXXXXXLQNLTENQGKLYDEDLAMIYKETLLSKECQNHGFVLDGFPETKEQAKLLFSPXXXXXXXXXV----KNLGYNRLITPQHVFVVKVSDKFLEIRNSILKSNDS-----FDEDFRNRLKLYRSVNDDLAEVDEETVLSFFDFREIHPIILQIEEDLSKDGEENRINLLNEIYYELGEPHTYGPNDEEKILINIKEQEAAXXXXXXXXXXXXXXXXXMLTIRKHNQSEWNENLELVRQQQYEYLETHNLPLRNYLMHLVMPVLTDGLMDCSKVRTEDPIDYL 2173
            TR+E F+ ++ESDV+VY+++E     Q+EEA +   A        + E +FIL+SSVM WA T      DE+   ++E++ +R+PHP FK H N  ++++    K KSK+K YV+ AG+ YG  ENI H FFK SW    PE  ++ +GTN IPTIHV DL GVIQNI + KP +KY LAVD+SK+TLED+VK                          P +++ L +++RLDA  +   + + W  ++GLV N+++V+ E+K  R L PI++C+LGPP  GKT  ++ I   Y++  +   + I + +  L   +      + P   S     +K   +I+                                Q++  +QG L    L  +  E L SK+C+N GFVLDGFPE+  QA + FS +   + +  V    +   +  ++T  +VF ++ SD FL  R   L  + +       ++F +RL  YR +     E  EETVL FFD  EIHP  L         G   R   + E+   +G P  Y  + EE    +  ++EA +RQ +     ++ +        +H    W+++++ V++Q+ E LE   LPLRNYLM  V+P +T+ +  C  ++ +DPID+L
Sbjct:   36 TREELFQVLLESDVVVYNVSESSLPRQVEEASWAVTASES----FKAEKMFILVSSVMGWATT-----SDEDHLPSDEEFWKRRPHPRFKSH-NTLEKLVIKLSKMKSKLKCYVVAAGLQYGFEENIFHYFFKVSWMLETPEVPVFGQGTNHIPTIHVFDLGGVIQNIIELKPKAKYFLAVDESKNTLEDIVK--------------------------PQEVDCLSIDLRLDAANVNSLLNLSWRCQSGLVLNMESVVQEFKDSRQLQPIRICVLGPPAVGKTTVAEMICKHYKIHYISTGKAIEEKISQLVVPLKEMMSGSQPGDFSAEATAQKELEMIK--------------------------------QSMESSQGLL----LFPVKGEKLNSKQCRNQGFVLDGFPESYSQAAMHFSSEILLDLDLLVAYRWRLFSFTEVLTLYYVFSLEASDDFLTERVRALPQSTAEEAHLVQDEFLSRLSEYRKL-----EEAEETVLDFFDHCEIHPEHL---------GTFCRALRITEV---VGLPKNYSRSYEEHKEEDPLKKEAERRQTLAAERRRRKEAVLAEMAAQHEA--WHKSMQEVQRQEKERLEAQALPLRNYLMEFVVPSITEAMSQCCVLKPDDPIDFL 596          
BLAST of adenylate kinase 7 vs. Planmine SMEST
Match: SMESG000075900.1 (SMESG000075900.1)

HSP 1 Score: 1299.65 bits (3362), Expect = 0.000e+0
Identity = 737/738 (99.86%), Postives = 738/738 (100.00%), Query Frame = 2
Query:   11 MSEEKVESKRIFINHVDSYVGLSLANYLSNCVVGSTLDXXXXXXXXXXXXXXGFISKKNADGLFEIHGTFXXXXXXXXXXXXAILKYDTRDEFFEHIVESDVIVYDITEDINQIEEALYVANALHDHFQWLEKEVVFILLSSVMTWAKTKPADADDEEASFNEEDYRRRKPHPNFKEHFNAXXXXXXXXXXXXXXXXMYVLGAGILYGAGENILHDFFKQSWNNAPESVIYDKGTNVIPTIHVNDLAGVIQNIADSKPVSKYILAVDDSKSTLEDVVKIISQKLSFGKVIRIPKEQVLMENIVQPNDLEILLVNIRLDAMVIKEMKIKWVAEAGLVENIDTVINEYKTYRNLLPIKVCILGPPCTGKTYYSDKIASKYQLKNMKITEVIADYMKYLEATINYPSILSENIEKEKARNLIQNEEDPDPDFGVXXXXXXXXXXXXXXXXXXXXLQNLTENQGKLYDEDLAMIYKETLLSKECQNHGFVLDGFPETKEQAKLLFSPXXXXXXXXXVKNLGYNRLITPQHVFVVKVSDKFLEIRNSILKSNDSFDEDFRNRLKLYRSVNDDLAEVDEETVLSFFDFREIHPIILQIEEDLSKDGEENRINLLNEIYYELGEPHTYGPNDEEKILINIKEQEAAXXXXXXXXXXXXXXXXXMLTIRKHNQSEWNENLELVRQQQYEYLETHNLPLRNYLMHLVMPVLTDGLMDCSKVRTEDPIDYLSEFILRYDNRKHADEKK 2224
            MSEEKVESKRIFINHVDSYVGLSLANYLSNCVVGSTLDEDEPEEEEAAAEIEGFISKKNADGLFEIHGTFKKKTSKKPKSVKAILKYDTRDEFFEHIVESDVIVYDITEDINQIEEALYVANALHDHFQWLEKEVVFILLSSVMTWAKTKPADADDEEASFNEEDYRRRKPHPNFKEHFNAEKEILKLSKKHKSKIKMYVLGAGILYGAGENILHDFFKQSWNNAPESVIYDKGTNVIPTIHVNDLAGVIQNIADSKPVSKYILAVDDSKSTLEDVVKIISQKLSFGKVIRIPKEQVLMENIVQPNDLEILLVNIRLDAMVIKEMKIKWVAEAGLVENIDTVINEYKTYRNLLPIKVCILGPPCTGKTYYSDKIASKYQLKNMKITEVIADYMKYLEATINYPSILSENIEKEKARNLIQNEEDPDPDFGVEELEEAETKATAAKETQEKLLQNLTENQGKLYDEDLAMIYKETLLSKECQNHGFVLDGFPETKEQAKLLFSPDNDEEEEENVKNLGYNRLITPQHVFV+KVSDKFLEIRNSILKSNDSFDEDFRNRLKLYRSVNDDLAEVDEETVLSFFDFREIHPIILQIEEDLSKDGEENRINLLNEIYYELGEPHTYGPNDEEKILINIKEQEAAKRQIIIERENKKIKEAEMLTIRKHNQSEWNENLELVRQQQYEYLETHNLPLRNYLMHLVMPVLTDGLMDCSKVRTEDPIDYLSEFILRYDNRKHADEKK
Sbjct:    1 MSEEKVESKRIFINHVDSYVGLSLANYLSNCVVGSTLDEDEPEEEEAAAEIEGFISKKNADGLFEIHGTFKKKTSKKPKSVKAILKYDTRDEFFEHIVESDVIVYDITEDINQIEEALYVANALHDHFQWLEKEVVFILLSSVMTWAKTKPADADDEEASFNEEDYRRRKPHPNFKEHFNAEKEILKLSKKHKSKIKMYVLGAGILYGAGENILHDFFKQSWNNAPESVIYDKGTNVIPTIHVNDLAGVIQNIADSKPVSKYILAVDDSKSTLEDVVKIISQKLSFGKVIRIPKEQVLMENIVQPNDLEILLVNIRLDAMVIKEMKIKWVAEAGLVENIDTVINEYKTYRNLLPIKVCILGPPCTGKTYYSDKIASKYQLKNMKITEVIADYMKYLEATINYPSILSENIEKEKARNLIQNEEDPDPDFGVEELEEAETKATAAKETQEKLLQNLTENQGKLYDEDLAMIYKETLLSKECQNHGFVLDGFPETKEQAKLLFSPDNDEEEEENVKNLGYNRLITPQHVFVLKVSDKFLEIRNSILKSNDSFDEDFRNRLKLYRSVNDDLAEVDEETVLSFFDFREIHPIILQIEEDLSKDGEENRINLLNEIYYELGEPHTYGPNDEEKILINIKEQEAAKRQIIIERENKKIKEAEMLTIRKHNQSEWNENLELVRQQQYEYLETHNLPLRNYLMHLVMPVLTDGLMDCSKVRTEDPIDYLSEFILRYDNRKHADEKK 738          
BLAST of adenylate kinase 7 vs. Planmine SMEST
Match: SMESG000075409.1 (SMESG000075409.1)

HSP 1 Score: 115.546 bits (288), Expect = 2.192e-26
Identity = 101/283 (35.69%), Postives = 157/283 (55.48%), Query Frame = 2
Query: 1376 TENQGKLYDEDLAMIYKETLLSKECQNHGFVLDGFPETKEQAKLLFSPXXXXXXXXXVKNLG-----YNRLITPQHVFVVKVSDKFL-----EIRNSILKSNDSFDEDFRNRLKLYRSVNDDLAEVDEETVLSFFDFREIHPIILQIEEDLSKDGEENRINLLNEIYYELGEPHTYGPNDEEKILINIKEQEAAXXXXXX-XXXXXXXXXXXMLTIRKHNQSEWNENLELVRQQQYEYLETHNLPLRNYLMHLVMPVLTDGLMDCSKVRTEDPIDYLSEFILR 2191
             EN G++  + +    K+ LLSK  +N GF+LD +P+TKEQA+ LF+   DEEEEE           YN+ + P HVFV+   D+FL     E+   ++    + +E F  RL  YRSVN++     E+TVL++F+   +  I L    DL KD  +    ++ EI   LG    Y P  E +I  + + +E    +      E KK ++ E   +R+  ++ W   LE +++++  +LE  + PLRNYLM  VMPVLT+GL+DC K R ++ ID+L+E++ R
Sbjct:  435 AENNGRIEMQYITKFLKDKLLSKPVRNQGFLLDNYPKTKEQAEDLFNVGEDEEEEEEEAAENEEKPPYNKNLIPTHVFVLDADDEFLKKKIMELPEPLVTGTHNTEEGFLRRLTEYRSVNNE-----EDTVLNYFEDNGVKIIRL----DLMKDEFKTVEKVVAEIAMILGSTRNYYPT-ETQISRDKRTKEIELEKKQSLMSEEKKRRKQEEERMREERKATWTRKLEELKKEEEAFLEEKSQPLRNYLMRHVMPVLTEGLIDCVKHRPDNAIDHLAEYLFR 707          
The following BLAST results are available for this feature:
BLAST of adenylate kinase 7 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
AK77.444e-14238.56adenylate kinase 7 [Source:HGNC Symbol;Acc:HGNC:20... [more]
AK72.344e-1339.17adenylate kinase 7 [Source:HGNC Symbol;Acc:HGNC:20... [more]
back to top
BLAST of adenylate kinase 7 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
dpy-304.314e-639.62Dosage compensation protein dpy-30 [Source:UniPro... [more]
dpy-304.314e-639.62Dosage compensation protein dpy-30 [Source:UniPro... [more]
back to top
BLAST of adenylate kinase 7 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Dpy-30L16.739e-640.43gene:FBgn0032293 transcript:FBtr0080112[more]
Dpy-30L28.289e-630.88gene:FBgn0035491 transcript:FBtr0073281[more]
Dpy-30L28.289e-630.88gene:FBgn0035491 transcript:FBtr0332981[more]
back to top
BLAST of adenylate kinase 7 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ak7b1.239e-13436.12adenylate kinase 7b [Source:ZFIN;Acc:ZDB-GENE-0503... [more]
ak7a7.715e-11734.49adenylate kinase 7a [Source:ZFIN;Acc:ZDB-GENE-0407... [more]
ak7a1.475e-4333.97adenylate kinase 7a [Source:ZFIN;Acc:ZDB-GENE-0407... [more]
back to top
BLAST of adenylate kinase 7 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
sesn12.813e-14838.99sestrin 1 [Source:Xenbase;Acc:XB-GENE-491636][more]
sesn18.862e-14838.86sestrin 1 [Source:Xenbase;Acc:XB-GENE-491636][more]
sesn11.151e-13738.24sestrin 1 [Source:Xenbase;Acc:XB-GENE-491636][more]
sesn11.832e-13637.72sestrin 1 [Source:Xenbase;Acc:XB-GENE-491636][more]
back to top
BLAST of adenylate kinase 7 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Ak71.427e-14839.86adenylate kinase 7 [Source:MGI Symbol;Acc:MGI:1926... [more]
back to top
BLAST of adenylate kinase 7 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|Q96M32|KAD7_HUMAN3.575e-14138.56Adenylate kinase 7 OS=Homo sapiens OX=9606 GN=AK7 ... [more]
sp|Q9D2H2|KAD7_MOUSE1.798e-13441.09Adenylate kinase 7 OS=Mus musculus OX=10090 GN=Ak7... [more]
sp|Q95JP6|KAD7_MACFA5.115e-9637.48Adenylate kinase 7 (Fragment) OS=Macaca fascicular... [more]
back to top
BLAST of adenylate kinase 7 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
K1QJQ60.000e+043.64Putative adenylate kinase 7 OS=Crassostrea gigas O... [more]
A0A210Q4I71.834e-17442.33Adenylate kinase 7 OS=Mizuhopecten yessoensis OX=6... [more]
A0A1S3I4J71.825e-17041.53adenylate kinase 7 OS=Lingula unguis OX=7574 GN=LO... [more]
A0A267F0T81.902e-16942.43Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267FNY33.674e-16942.43Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of adenylate kinase 7 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ak7b4.270e-14037.19adenylate kinase 7 [Source:NCBI gene;Acc:103041221... [more]
ak7a3.830e-12135.12adenylate kinase 7a [Source:ZFIN;Acc:ZDB-GENE-0407... [more]
back to top
BLAST of adenylate kinase 7 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000004607.15.349e-14137.65pep scaffold:Pmarinus_7.0:GL477409:196306:217011:1... [more]
ENSPMAT00000005320.11.367e-12436.09pep scaffold:Pmarinus_7.0:GL477536:369:14184:1 gen... [more]
back to top
BLAST of adenylate kinase 7 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of adenylate kinase 7 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO365462.016e-14238.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of adenylate kinase 7 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ak7b2.504e-10531.90adenylate kinase 7 [Source:NCBI gene;Acc:101170721... [more]
ak7a2.239e-9233.13adenylate kinase 7 [Source:NCBI gene;Acc:101157414... [more]
back to top
BLAST of adenylate kinase 7 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000075900.10.000e+099.86SMESG000075900.1[more]
SMESG000075409.12.192e-2635.69SMESG000075409.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028023 ID=SMED30028023|Name=adenylate kinase 7|organism=Schmidtea mediterranea sexual|type=transcript|length=2270bp
TTAATTTTTAATGTCTGAAGAAAAAGTTGAGAGTAAAAGAATTTTTATAA
ATCATGTTGATAGTTATGTAGGATTGAGTCTAGCTAATTATTTAAGTAAT
TGTGTAGTCGGATCTACTCTAGATGAAGATGAACCAGAAGAAGAAGAAGC
AGCAGCAGAAATTGAAGGTTTTATTTCCAAGAAAAACGCTGACGGTCTTT
TTGAAATACATGGTACTTTTAAAAAAAAAACTTCCAAAAAACCAAAATCT
GTTAAAGCTATATTAAAATATGATACTCGAGATGAGTTTTTCGAACATAT
CGTTGAATCGGATGTCATCGTTTACGATATTACTGAAGACATAAATCAAA
TTGAAGAAGCTCTTTATGTAGCGAATGCATTGCACGATCATTTTCAATGG
TTAGAAAAAGAAGTAGTATTCATCCTTCTCAGTTCAGTGATGACTTGGGC
TAAAACTAAACCCGCTGATGCAGATGATGAAGAAGCGAGTTTCAATGAAG
AGGACTATCGACGTCGAAAGCCGCATCCGAATTTTAAAGAGCATTTTAAT
GCTGAAAAGGAAATTTTAAAGTTAAGCAAAAAACATAAATCAAAAATCAA
AATGTACGTTTTGGGAGCTGGGATTTTGTACGGAGCAGGAGAGAATATTT
TACATGATTTCTTTAAGCAATCCTGGAATAATGCCCCGGAATCAGTGATA
TATGATAAAGGAACAAATGTTATTCCAACGATCCATGTAAACGATCTGGC
TGGGGTCATCCAGAACATTGCTGACAGTAAGCCAGTTAGTAAATATATTT
TAGCCGTAGATGATTCTAAAAGTACATTAGAAGATGTGGTGAAAATAATT
TCCCAAAAATTGTCTTTTGGAAAGGTTATACGAATACCAAAAGAACAAGT
TTTAATGGAAAATATTGTTCAACCAAATGATCTGGAAATTTTGCTAGTTA
ATATACGACTGGACGCGATGGTAATCAAGGAAATGAAAATTAAATGGGTT
GCTGAAGCTGGGTTGGTAGAAAACATTGACACTGTGATCAATGAATATAA
AACATATAGAAATTTATTGCCTATTAAAGTATGTATATTGGGGCCGCCGT
GTACCGGGAAAACGTATTATTCCGACAAAATAGCGAGTAAATATCAATTA
AAGAATATGAAAATCACTGAAGTGATTGCCGATTATATGAAATATCTCGA
AGCCACAATAAACTATCCGTCGATCCTAAGTGAAAATATCGAAAAAGAAA
AAGCCAGAAATTTGATTCAAAATGAAGAGGATCCCGATCCGGATTTCGGG
GTCGAGGAACTCGAAGAAGCGGAAACTAAAGCAACTGCAGCAAAGGAAAC
TCAAGAGAAATTGCTGCAAAATTTGACAGAAAACCAAGGGAAATTGTATG
ACGAAGATTTAGCTATGATTTACAAAGAAACTTTGCTATCAAAAGAATGT
CAAAATCATGGATTTGTTTTAGATGGTTTCCCAGAAACTAAAGAGCAAGC
TAAGCTTTTATTCTCACCTGATAATGATGAGGAAGAAGAGGAAAATGTCA
AAAACCTTGGTTATAATCGTTTAATTACTCCGCAGCATGTGTTTGTTGTT
AAAGTATCTGATAAGTTTTTAGAAATTCGAAATTCTATTTTAAAATCAAA
CGATTCGTTTGATGAAGATTTTAGAAATAGACTAAAACTATACAGAAGTG
TTAATGATGATTTGGCGGAAGTTGATGAAGAAACTGTTCTTAGCTTTTTC
GATTTCCGTGAAATCCATCCTATCATTCTCCAAATTGAAGAAGATTTGTC
AAAAGACGGAGAGGAAAATAGAATTAACCTTCTTAATGAAATCTATTATG
AACTTGGAGAACCTCATACGTATGGTCCCAATGACGAAGAAAAAATTCTT
ATCAACATAAAGGAACAAGAAGCGGCAAAACGTCAAATAATAATAGAGCG
TGAAAATAAAAAAATTAAAGAAGCTGAAATGTTAACCATTCGGAAACATA
ATCAATCTGAATGGAATGAAAATCTTGAGCTAGTTAGACAACAACAATAT
GAATATTTGGAAACCCACAATTTACCTTTGAGGAATTATTTAATGCATCT
TGTTATGCCTGTGCTAACAGATGGCCTAATGGACTGTAGCAAAGTCAGAA
CCGAGGACCCAATAGATTATTTGTCTGAATTTATTTTACGATACGACAAT
CGAAAACATGCTGACGAGAAAAAATGAAATTTTATTTTTCATAATGTATT
GAAATAAATGTATTATTATT
back to top

protein sequence of SMED30028023-orf-1

>SMED30028023-orf-1 ID=SMED30028023-orf-1|Name=SMED30028023-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=739bp
MSEEKVESKRIFINHVDSYVGLSLANYLSNCVVGSTLDEDEPEEEEAAAE
IEGFISKKNADGLFEIHGTFKKKTSKKPKSVKAILKYDTRDEFFEHIVES
DVIVYDITEDINQIEEALYVANALHDHFQWLEKEVVFILLSSVMTWAKTK
PADADDEEASFNEEDYRRRKPHPNFKEHFNAEKEILKLSKKHKSKIKMYV
LGAGILYGAGENILHDFFKQSWNNAPESVIYDKGTNVIPTIHVNDLAGVI
QNIADSKPVSKYILAVDDSKSTLEDVVKIISQKLSFGKVIRIPKEQVLME
NIVQPNDLEILLVNIRLDAMVIKEMKIKWVAEAGLVENIDTVINEYKTYR
NLLPIKVCILGPPCTGKTYYSDKIASKYQLKNMKITEVIADYMKYLEATI
NYPSILSENIEKEKARNLIQNEEDPDPDFGVEELEEAETKATAAKETQEK
LLQNLTENQGKLYDEDLAMIYKETLLSKECQNHGFVLDGFPETKEQAKLL
FSPDNDEEEEENVKNLGYNRLITPQHVFVVKVSDKFLEIRNSILKSNDSF
DEDFRNRLKLYRSVNDDLAEVDEETVLSFFDFREIHPIILQIEEDLSKDG
EENRINLLNEIYYELGEPHTYGPNDEEKILINIKEQEAAKRQIIIERENK
KIKEAEMLTIRKHNQSEWNENLELVRQQQYEYLETHNLPLRNYLMHLVMP
VLTDGLMDCSKVRTEDPIDYLSEFILRYDNRKHADEKK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0046940nucleoside monophosphate phosphorylation
GO:0006139nucleobase-containing compound metabolic process
GO:0016310phosphorylation
GO:0046939nucleotide phosphorylation
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR026867AK7
IPR000850Adenylat/UMP-CMP_kin
IPR036291NAD(P)-bd_dom_sf
IPR027417P-loop_NTPase
IPR016040NAD(P)-bd_dom
IPR007858Dpy-30_motif
Vocabulary: molecular function
TermDefinition
GO:0004017adenylate kinase activity
GO:0004127cytidylate kinase activity
GO:0005524ATP binding
GO:0016301kinase activity
GO:0019205nucleobase-containing compound kinase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 431..454
NoneNo IPR availableGENE3DG3DSA:1.20.890.10coord: 683..736
e-value: 1.5E-11
score: 45.8
NoneNo IPR availableGENE3DG3DSA:3.40.50.720coord: 100..341
e-value: 3.5E-12
score: 48.4
IPR007858Dpy-30 motifPFAMPF05186Dpy-30coord: 689..728
e-value: 2.8E-9
score: 36.5
IPR026867Adenylate kinase 7PANTHERPTHR23359:SF105ADENYLATE KINASE 7coord: 68..728
IPR000850Adenylate kinase/UMP-CMP kinasePANTHERPTHR23359NUCLEOTIDE KINASEcoord: 68..728
IPR036291NAD(P)-binding domain superfamilySUPERFAMILYSSF51735NAD(P)-binding Rossmann-fold domainscoord: 134..293
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 355..576