Polypeptide N-acetylgalactosaminyltransferase

Overview
NamePolypeptide N-acetylgalactosaminyltransferase
Smed IDSMED30028011
Length (bp)1880
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Polypeptide N-acetylgalactosaminyltransferase (SMED30028011) t-SNE clustered cells

Violin plots show distribution of expression levels for Polypeptide N-acetylgalactosaminyltransferase (SMED30028011) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028011

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
cephalic gangliaSMED30028011SMESG000070134.1 dd_Smed_v4_5242_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30028011SMESG000070134.1 dd_Smed_v4_5242_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30028011SMESG000070134.1 OX_Smed_1.0.13437ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Human
Match: GALNT10 (polypeptide N-acetylgalactosaminyltransferase 10 [Source:HGNC Symbol;Acc:HGNC:19873])

HSP 1 Score: 506.138 bits (1302), Expect = 8.456e-173
Identity = 259/541 (47.87%), Postives = 350/541 (64.70%), Query Frame = 1
Query:  229 LVDWHNYTQIEEELKRRGPGEQGSGVRIPKAEEEEQQRIYKENGYDGYASDKISIQRSLRDIRHPACKTLKYLKSLPSVSVIIPFHQEHWSPLIRTVDSVIRRAPLGLIKEVILVDDASRKPFLQKTLEIFLKEHYPIAKVLRTNGRQGLIRTRVLGAKEAIGDVLIFLDSHSEANVNWLPPLLEPIAKNYKTVTCPFIDVINYDTFEYLSQ-DEGARGIFDWNFDYKRIP-RFKSDESHPADPFESPVMAGGLFAISRKWFWELGGYDEGLDIWGGEQYEISFKLWQCGGKMLDIPCSRIGHVYRKYSPFPNNAKGNFISRNFKRVAEVWMDEFKEYLYLRRPTIRNEDPLNLTNQFAIREKLHCKNFSWFMKEVAFDLVNNYPLIEPNPVCSGEIKLSNPNNVSVCIDFKFRDSGYVVGLSPCLSVNHKEG--GEQNFILSWKGEIKPKD----RDMCMDSSDHIPGGSVLLFKCHGGRGNQFFKYKLESQQILFVNSGFCLEGDPASKHIALQTCNETITDQKWIWTSVNMTELKKLH 1827
            L DWH+   I  + +R G GEQG    +  AE  +Q   Y+ENG++ Y SDKIS+ RSL DIRHP C + +YL++LP+ S+IIPFH E WS L+RTV SV+ R+P  L+ E++LVDD S +  L+K LE ++   +P  ++LRT  R+GLIRTR+LGA  A GDV+ FLDSH EANVNWLPPLL+ IA+N KT+ CP IDVI++D F Y +Q  +  RG FDW   YKRIP   +  ++ P+DPFESPVMAGGLFA+ RKWFWELGGYD GL+IWGGEQYEISFK+W CGG+M DIPCSR+GH+YRKY P+   A G  ++RN KRVAEVWMDE+ EY+Y RRP  R+    ++  Q  +R  L+CK+F WFM ++A+DL   YP +EP     GEI+        +C D K    G  + L  C+    +      Q F  +W+ +I+P D    +  C D+  H     V L+ CH  +GNQ +KY+ + + +    SG C++   +   I + TCN +   Q+W++   N T L+K +
Sbjct:   71 LKDWHDKEAIRRDAQRVGNGEQGRPYPMTDAERVDQA--YRENGFNIYVSDKISLNRSLPDIRHPNCNSKRYLETLPNTSIIIPFHNEGWSSLLRTVHSVLNRSPPELVAEIVLVDDFSDREHLKKPLEDYMA-LFPSVRILRTKKREGLIRTRMLGASVATGDVITFLDSHCEANVNWLPPLLDRIARNRKTIVCPMIDVIDHDDFRYETQAGDAMRGAFDWEMYYKRIPIPPELQKADPSDPFESPVMAGGLFAVDRKWFWELGGYDPGLEIWGGEQYEISFKVWMCGGRMEDIPCSRVGHIYRKYVPYKVPA-GVSLARNLKRVAEVWMDEYAEYIYQRRPEYRHLSAGDVAVQKKLRSSLNCKSFKWFMTKIAWDLPKFYPPVEPPAAAWGEIRNV---GTGLCADTKHGALGSPLRLEGCVRGRGEAAWNNMQVFTFTWREDIRPGDPQHTKKFCFDAISHT--SPVTLYDCHSMKGNQLWKYR-KDKTLYHPVSGSCMDCSESDHRIFMNTCNPSSLTQQWLFEHTNSTVLEKFN 601          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Human
Match: GALNTL6 (polypeptide N-acetylgalactosaminyltransferase like 6 [Source:HGNC Symbol;Acc:HGNC:33844])

HSP 1 Score: 501.901 bits (1291), Expect = 1.873e-171
Identity = 253/538 (47.03%), Postives = 344/538 (63.94%), Query Frame = 1
Query:  235 DWHNYTQIEEELKRRGPGEQGSGVRIPKAEEEEQQRIYKENGYDGYASDKISIQRSLRDIRHPACKTLKYLKSLPSVSVIIPFHQEHWSPLIRTVDSVIRRAPLGLIKEVILVDDASRKPFLQKTLEIFLKEHYPIAKVLRTNGRQGLIRTRVLGAKEAIGDVLIFLDSHSEANVNWLPPLLEPIAKNYKTVTCPFIDVINYDTFEYLSQ-DEGARGIFDWNFDYKRIP-RFKSDESHPADPFESPVMAGGLFAISRKWFWELGGYDEGLDIWGGEQYEISFKLWQCGGKMLDIPCSRIGHVYRKYSPFPNNAKGNFISRNFKRVAEVWMDEFKEYLYLRRPTIRNEDPLNLTNQFAIREKLHCKNFSWFMKEVAFDLVNNYPLIEPNPVCSGEIKLSNPNNVSVCIDFKFRDSGYVVGLSPCLSVNHKE--GGEQNFILSWKGEIKPKD----RDMCMDSSDHIPGGSVLLFKCHGGRGNQFFKYKLESQQILFVNSGFCLEGDPASKHIALQTCNETITDQKWIWTSVNMTELKKL 1824
            DWH+Y  I++E  R G GE G     P  EE+     Y+ENG++ + S+ I+++RSL DIRH  CK   YL+ LP+ S+IIPFH E W+ L+RT+ S+I R P  LI E+ILVDD S +  L+  LE ++   +   +++RT  R+GLIRTR+LGA  A G+VL FLDSH E NVNWLPPLL  IA N+KT+ CP IDVI+++ F Y +Q  +  RG FDW   YKRIP   +   + P+DPFESPVMAGGLFA+ RKWFWELGGYD GL+IWGGEQYEISFK+W CGG+M D+PCSR+GH+YRKY P+     G  ++RN KRVAE WMDEF EY+Y RRP  R+    +++ Q  +R++L CK+F WFM  VA+D+   YP +EP P   GEI+    N   +C+D K   +G  + L  C+    +     EQ F   W+ +I+P +    R  C D+  H     V L+ CHG +GNQ + Y+ + + +    S  C++ +PA K I +  C+     Q+WI+  +NMT L+K 
Sbjct:   51 DWHDYESIQKEAMRSGKGEHGKPY--PLTEEDHDDSAYRENGFNIFVSNNIALERSLPDIRHANCKHKMYLERLPNTSIIIPFHNEGWTSLLRTIHSIINRTPGSLIAEIILVDDFSEREHLKDKLEEYMAR-FSKVRIVRTKKREGLIRTRLLGASMARGEVLTFLDSHCEVNVNWLPPLLNQIALNHKTIVCPMIDVIDHNHFGYEAQAGDAMRGAFDWEMYYKRIPIPPELQRADPSDPFESPVMAGGLFAVDRKWFWELGGYDPGLEIWGGEQYEISFKVWMCGGEMFDVPCSRVGHIYRKYVPY-KVPSGTSLARNLKRVAETWMDEFAEYIYQRRPEYRHLSTGDISAQKELRKQLKCKDFKWFMAAVAWDVPKYYPPVEPPPAAWGEIRNVAAN---LCVDSKHGATGTELRLDICVKDGSERTWSHEQLFTFGWREDIRPGEPLHTRKFCFDAISH--NSPVTLYDCHGMKGNQLWGYR-KDRTLFHPVSNSCMDCNPAEKKIFMARCDPLSETQQWIFEHINMTVLEKF 578          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Human
Match: GALNTL6 (polypeptide N-acetylgalactosaminyltransferase like 6 [Source:HGNC Symbol;Acc:HGNC:33844])

HSP 1 Score: 502.671 bits (1293), Expect = 2.212e-171
Identity = 253/538 (47.03%), Postives = 344/538 (63.94%), Query Frame = 1
Query:  235 DWHNYTQIEEELKRRGPGEQGSGVRIPKAEEEEQQRIYKENGYDGYASDKISIQRSLRDIRHPACKTLKYLKSLPSVSVIIPFHQEHWSPLIRTVDSVIRRAPLGLIKEVILVDDASRKPFLQKTLEIFLKEHYPIAKVLRTNGRQGLIRTRVLGAKEAIGDVLIFLDSHSEANVNWLPPLLEPIAKNYKTVTCPFIDVINYDTFEYLSQ-DEGARGIFDWNFDYKRIP-RFKSDESHPADPFESPVMAGGLFAISRKWFWELGGYDEGLDIWGGEQYEISFKLWQCGGKMLDIPCSRIGHVYRKYSPFPNNAKGNFISRNFKRVAEVWMDEFKEYLYLRRPTIRNEDPLNLTNQFAIREKLHCKNFSWFMKEVAFDLVNNYPLIEPNPVCSGEIKLSNPNNVSVCIDFKFRDSGYVVGLSPCLSVNHKE--GGEQNFILSWKGEIKPKD----RDMCMDSSDHIPGGSVLLFKCHGGRGNQFFKYKLESQQILFVNSGFCLEGDPASKHIALQTCNETITDQKWIWTSVNMTELKKL 1824
            DWH+Y  I++E  R G GE G     P  EE+     Y+ENG++ + S+ I+++RSL DIRH  CK   YL+ LP+ S+IIPFH E W+ L+RT+ S+I R P  LI E+ILVDD S +  L+  LE ++   +   +++RT  R+GLIRTR+LGA  A G+VL FLDSH E NVNWLPPLL  IA N+KT+ CP IDVI+++ F Y +Q  +  RG FDW   YKRIP   +   + P+DPFESPVMAGGLFA+ RKWFWELGGYD GL+IWGGEQYEISFK+W CGG+M D+PCSR+GH+YRKY P+     G  ++RN KRVAE WMDEF EY+Y RRP  R+    +++ Q  +R++L CK+F WFM  VA+D+   YP +EP P   GEI+    N   +C+D K   +G  + L  C+    +     EQ F   W+ +I+P +    R  C D+  H     V L+ CHG +GNQ + Y+ + + +    S  C++ +PA K I +  C+     Q+WI+  +NMT L+K 
Sbjct:   68 DWHDYESIQKEAMRSGKGEHGKPY--PLTEEDHDDSAYRENGFNIFVSNNIALERSLPDIRHANCKHKMYLERLPNTSIIIPFHNEGWTSLLRTIHSIINRTPGSLIAEIILVDDFSEREHLKDKLEEYMAR-FSKVRIVRTKKREGLIRTRLLGASMARGEVLTFLDSHCEVNVNWLPPLLNQIALNHKTIVCPMIDVIDHNHFGYEAQAGDAMRGAFDWEMYYKRIPIPPELQRADPSDPFESPVMAGGLFAVDRKWFWELGGYDPGLEIWGGEQYEISFKVWMCGGEMFDVPCSRVGHIYRKYVPY-KVPSGTSLARNLKRVAETWMDEFAEYIYQRRPEYRHLSTGDISAQKELRKQLKCKDFKWFMAAVAWDVPKYYPPVEPPPAAWGEIRNVAAN---LCVDSKHGATGTELRLDICVKDGSERTWSHEQLFTFGWREDIRPGEPLHTRKFCFDAISH--NSPVTLYDCHGMKGNQLWGYR-KDRTLFHPVSNSCMDCNPAEKKIFMARCDPLSETQQWIFEHINMTVLEKF 595          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Human
Match: GALNTL6 (polypeptide N-acetylgalactosaminyltransferase like 6 [Source:HGNC Symbol;Acc:HGNC:33844])

HSP 1 Score: 387.497 bits (994), Expect = 4.485e-129
Identity = 196/417 (47.00%), Postives = 266/417 (63.79%), Query Frame = 1
Query:  598 LQKTLEIFLKEHYPIAKVLRTNGRQGLIRTRVLGAKEAIGDVLIFLDSHSEANVNWLPPLLEPIAKNYKTVTCPFIDVINYDTFEYLSQ-DEGARGIFDWNFDYKRIP-RFKSDESHPADPFESPVMAGGLFAISRKWFWELGGYDEGLDIWGGEQYEISFKLWQCGGKMLDIPCSRIGHVYRKYSPFPNNAKGNFISRNFKRVAEVWMDEFKEYLYLRRPTIRNEDPLNLTNQFAIREKLHCKNFSWFMKEVAFDLVNNYPLIEPNPVCSGEIKLSNPNNVSVCIDFKFRDSGYVVGLSPCLSVNHKE--GGEQNFILSWKGEIKPKD----RDMCMDSSDHIPGGSVLLFKCHGGRGNQFFKYKLESQQILFVNSGFCLEGDPASKHIALQTCNETITDQKWIWTSVNMTELKKL 1824
            L+  LE ++   +   +++RT  R+GLIRTR+LGA  A G+VL FLDSH E NVNWLPPLL  IA N+KT+ CP IDVI+++ F Y +Q  +  RG FDW   YKRIP   +   + P+DPFESPVMAGGLFA+ RKWFWELGGYD GL+IWGGEQYEISFK+W CGG+M D+PCSR+GH+YRKY P+     G  ++RN KRVAE WMDEF EY+Y RRP  R+    +++ Q  +R++L CK+F WFM  VA+D+   YP +EP P   GEI+    N   +C+D K   +G  + L  C+    +     EQ F   W+ +I+P +    R  C D+  H     V L+ CHG +GNQ + Y+ + + +    S  C++ +PA K I +  C+     Q+WI+  +NMT L+K 
Sbjct:    3 LKDKLEEYMAR-FSKVRIVRTKKREGLIRTRLLGASMARGEVLTFLDSHCEVNVNWLPPLLNQIALNHKTIVCPMIDVIDHNHFGYEAQAGDAMRGAFDWEMYYKRIPIPPELQRADPSDPFESPVMAGGLFAVDRKWFWELGGYDPGLEIWGGEQYEISFKVWMCGGEMFDVPCSRVGHIYRKYVPY-KVPSGTSLARNLKRVAETWMDEFAEYIYQRRPEYRHLSTGDISAQKELRKQLKCKDFKWFMAAVAWDVPKYYPPVEPPPAAWGEIRNVAAN---LCVDSKHGATGTELRLDICVKDGSERTWSHEQLFTFGWREDIRPGEPLHTRKFCFDAISH--NSPVTLYDCHGMKGNQLWGYR-KDRTLFHPVSNSCMDCNPAEKKIFMARCDPLSETQQWIFEHINMTVLEKF 411          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Human
Match: GALNT13 (polypeptide N-acetylgalactosaminyltransferase 13 [Source:HGNC Symbol;Acc:HGNC:23242])

HSP 1 Score: 380.178 bits (975), Expect = 2.326e-124
Identity = 213/521 (40.88%), Postives = 302/521 (57.97%), Query Frame = 1
Query:  274 RRGPGEQGSGVRIPKAEEEEQQRIYKENGYDGYASDKISIQRSLRDIRHPACKTLKYLKSLPSVSVIIPFHQEHWSPLIRTVDSVIRRAPLGLIKEVILVDDASRKPFLQKTLEIFLKEHYPIAKVLRTNGRQGLIRTRVLGAKEAIGDVLIFLDSHSEANVNWLPPLLEPIAKNYKTVTCPFIDVINYDTFEYLSQDEGARGIFDWNFDYKRIP-------RFKSDESHPADPFESPVMAGGLFAISRKWFWELGGYDEGLDIWGGEQYEISFKLWQCGGKMLDIPCSRIGHVYRKYSP--FPNNAKGNFISRNFKRVAEVWMDEFKEYLYLRRPTIRNEDPLNLTNQFAIREKLHCKNFSWFMKEVAFDLVNNYPLIEPNPVCSGEIKLSNPNNVSVCIDFKFRDSGYVVGLSPCLSVNHKEGGEQNFILSWKGEIKPKDRDMCMDSSDHIPGGSVLLFKCHGGRGNQFFKYKLESQQILFVNSGFCLEGDPASKHIALQTCNETITDQKWIWTSVNMT 1809
            + GPGE G  V IPK ++E+ + ++K N ++  ASD I++ RSL D+R   CKT  Y   LP+ SV+I FH E WS L+RTV SVI R+P  L+ EVILVDDAS + FL+ TLE ++K      K++R   R GLIR R+ GA  + G V+ FLD+H E  + WL PLL  I ++ KTV CP IDVI+ DTFEY++  +   G F+W  +++  P       R K D + P     +P MAGGLF+I R +F E+G YD G+DIWGGE  E+SF++WQCGG +  + CS +GHV+RK +P  FP    G+ I++N +R+AEVWMDEFK++ Y+  P +   D  +++ +  +RE L CK FSW+++ +  D       I       GEI+    N    C+D   R     VG+  C    H  GG Q F  +   EI+    D+C+D S     G V++ KCH  RGNQ ++Y  E   +  VNS  CL+ +P+ +   + T  +    +   W   NMT
Sbjct:   54 QEGPGEMGKAVLIPKDDQEKMKELFKINQFNLMASDLIALNRSLPDVRLEGCKTKVYPDELPNTSVVIVFHNEAWSTLLRTVYSVINRSPHYLLSEVILVDDASERDFLKLTLENYVKNLEVPVKIIRMEERSGLIRARLRGAAASKGQVITFLDAHCECTLGWLEPLLARIKEDRKTVVCPIIDVISDDTFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPV---RTPTMAGGLFSIDRNYFEEIGTYDAGMDIWGGENLEMSFRIWQCGGSLEIVTCSHVGHVFRKATPYTFP-GGTGHVINKNNRRLAEVWMDEFKDFFYIISPGVVKVDYGDVSVRKTLRENLKCKPFSWYLENIYPD-----SQIPRRYYSLGEIRNVETNQ---CLDNMGRKENEKVGIFNC----HGMGGNQVFSYTADKEIRTD--DLCLDVSRL--NGPVIMLKCHHMRGNQLWEYDAERLTLRHVNSNQCLD-EPSEEDKMVPTMQDCSGSRSQQWLLRNMT 553          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Celegans
Match: gly-10 (Putative polypeptide N-acetylgalactosaminyltransferase 10 [Source:UniProtKB/Swiss-Prot;Acc:O45947])

HSP 1 Score: 582.022 bits (1499), Expect = 0.000e+0
Identity = 283/530 (53.40%), Postives = 366/530 (69.06%), Query Frame = 1
Query:  232 VDWHNYTQIEEELKRRGPGEQGSGVRIPKAEEEEQQ--RIYKENGYDGYASDKISIQRSLRDIRHPACKTLKYLKSLPSVSVIIPFHQEHWSPLIRTVDSVIRRAPLGLIKEVILVDDASRKPFLQKTLEIFLKEHY--PIAKVLRTNGRQGLIRTRVLGAKEAIGDVLIFLDSHSEANVNWLPPLLEPIAKNYKTVTCPFIDVINYDTFEYLSQDEGARGIFDWNFDYKRIPRFKSDESHPADPFESPVMAGGLFAISRKWFWELGGYDEGLDIWGGEQYEISFKLWQCGGKMLDIPCSRIGHVYR-KYSPFPNNAKGNFISRNFKRVAEVWMDEFKEYLYLRRPTIRNEDPLNLTNQFAIREKLHCKNFSWFMKEVAFDLVNNYPLIEPNPVCSGEIKLSNPNNVSVCIDFKFRDSGYVVGLSPCLSVNHKEGGEQNFILSWKGEIKPKDRDMCMDSSDHIPGGSVLLFKCHGGRGNQFFKYKLESQQILFVNSGFCLEGDPASK-HIALQTCNETITDQKWIWTSVN 1803
            + W +    E+E +R GPGE G  V++P+ +E E++   +YK NGY+ Y SD IS+ RS++DIRH  CK + Y   LP+VSVI PFH+EH S L+R+V SVI R+P  L+KE+ILVDD S KP L++ LE FLK++    I KVLRT  R+GLIR R LGA++A G++LIFLD+HSEAN NWLPPLL+PIA++Y+TV CPF+DVI+ +T+E   QDEGARG FDW F+YKR+P  K D   P  PF SPVMAGG FAIS KWFWELGGYDEGLDIWGGEQYE+SFK+WQC G+M+D PCSR+ H+YR KY+PF N   G+F+SRN+KRVAEVWMD++KE LY  RP + N D  +L     IREKL CK+F WFMKE+AFD    YP +EP     GEI+    N    CID +F++     GL  C S +   GGEQ+  L+   +I+PK R +C D S  +    V+LF CH  +GNQ FKY++  +QI    SG CL  D   K  + ++ C+ +   QKW W +V+
Sbjct:  161 IKWEDEAAYEKEKRREGPGEWGKPVKLPEDKEVEKEALSLYKANGYNAYISDMISLNRSIKDIRHKECKNMMYSAKLPTVSVIFPFHEEHNSTLLRSVYSVINRSPPELLKEIILVDDFSEKPALRQPLEDFLKKNKIDHIVKVLRTKKREGLIRGRQLGAQDATGEILIFLDAHSEANYNWLPPLLDPIAEDYRTVVCPFVDVIDCETYEVRPQDEGARGSFDWAFNYKRLPLTKKDRESPTKPFNSPVMAGGYFAISAKWFWELGGYDEGLDIWGGEQYELSFKVWQCHGRMVDAPCSRVAHIYRCKYAPFKNAGMGDFVSRNYKRVAEVWMDDYKETLYKHRPGVGNADAGDLKLMKGIREKLQCKSFDWFMKEIAFDQDKYYPAVEPKASAEGEIRNVGTN---FCIDTQFKEQNQRFGLRKCTSDDKDGGGEQDLRLTRWHDIRPKGRKICFDCSTSVDKAPVILFDCHSMKGNQLFKYRVAQKQIYHPISGQCLTADENGKGFLHMKKCDSSSDLQKWAWQTVD 687          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Celegans
Match: gly-10 (Putative polypeptide N-acetylgalactosaminyltransferase 10 [Source:UniProtKB/Swiss-Prot;Acc:O45947])

HSP 1 Score: 580.867 bits (1496), Expect = 0.000e+0
Identity = 283/530 (53.40%), Postives = 366/530 (69.06%), Query Frame = 1
Query:  232 VDWHNYTQIEEELKRRGPGEQGSGVRIPKAEEEEQQ--RIYKENGYDGYASDKISIQRSLRDIRHPACKTLKYLKSLPSVSVIIPFHQEHWSPLIRTVDSVIRRAPLGLIKEVILVDDASRKPFLQKTLEIFLKEHY--PIAKVLRTNGRQGLIRTRVLGAKEAIGDVLIFLDSHSEANVNWLPPLLEPIAKNYKTVTCPFIDVINYDTFEYLSQDEGARGIFDWNFDYKRIPRFKSDESHPADPFESPVMAGGLFAISRKWFWELGGYDEGLDIWGGEQYEISFKLWQCGGKMLDIPCSRIGHVYR-KYSPFPNNAKGNFISRNFKRVAEVWMDEFKEYLYLRRPTIRNEDPLNLTNQFAIREKLHCKNFSWFMKEVAFDLVNNYPLIEPNPVCSGEIKLSNPNNVSVCIDFKFRDSGYVVGLSPCLSVNHKEGGEQNFILSWKGEIKPKDRDMCMDSSDHIPGGSVLLFKCHGGRGNQFFKYKLESQQILFVNSGFCLEGDPASK-HIALQTCNETITDQKWIWTSVN 1803
            + W +    E+E +R GPGE G  V++P+ +E E++   +YK NGY+ Y SD IS+ RS++DIRH  CK + Y   LP+VSVI PFH+EH S L+R+V SVI R+P  L+KE+ILVDD S KP L++ LE FLK++    I KVLRT  R+GLIR R LGA++A G++LIFLD+HSEAN NWLPPLL+PIA++Y+TV CPF+DVI+ +T+E   QDEGARG FDW F+YKR+P  K D   P  PF SPVMAGG FAIS KWFWELGGYDEGLDIWGGEQYE+SFK+WQC G+M+D PCSR+ H+YR KY+PF N   G+F+SRN+KRVAEVWMD++KE LY  RP + N D  +L     IREKL CK+F WFMKE+AFD    YP +EP     GEI+    N    CID +F++     GL  C S +   GGEQ+  L+   +I+PK R +C D S  +    V+LF CH  +GNQ FKY++  +QI    SG CL  D   K  + ++ C+ +   QKW W +V+
Sbjct:   80 IKWEDEAAYEKEKRREGPGEWGKPVKLPEDKEVEKEALSLYKANGYNAYISDMISLNRSIKDIRHKECKNMMYSAKLPTVSVIFPFHEEHNSTLLRSVYSVINRSPPELLKEIILVDDFSEKPALRQPLEDFLKKNKIDHIVKVLRTKKREGLIRGRQLGAQDATGEILIFLDAHSEANYNWLPPLLDPIAEDYRTVVCPFVDVIDCETYEVRPQDEGARGSFDWAFNYKRLPLTKKDRESPTKPFNSPVMAGGYFAISAKWFWELGGYDEGLDIWGGEQYELSFKVWQCHGRMVDAPCSRVAHIYRCKYAPFKNAGMGDFVSRNYKRVAEVWMDDYKETLYKHRPGVGNADAGDLKLMKGIREKLQCKSFDWFMKEIAFDQDKYYPAVEPKASAEGEIRNVGTN---FCIDTQFKEQNQRFGLRKCTSDDKDGGGEQDLRLTRWHDIRPKGRKICFDCSTSVDKAPVILFDCHSMKGNQLFKYRVAQKQIYHPISGQCLTADENGKGFLHMKKCDSSSDLQKWAWQTVD 606          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Celegans
Match: gly-7 (Probable N-acetylgalactosaminyltransferase 7 [Source:UniProtKB/Swiss-Prot;Acc:O61397])

HSP 1 Score: 386.341 bits (991), Expect = 1.288e-126
Identity = 224/588 (38.10%), Postives = 328/588 (55.78%), Query Frame = 1
Query:   70 FACFAALVYLIVNSVYFRNPNSIENSSNVATTQSVE----LSTEELLISTSEHLESNLVDWHNYTQIEEELKRRGPGEQGSGVRIPKAEEEEQQRIY-KENGYDGYASDKISIQRSLRDIRHPACKTLKYLKSLPSVSVIIPFHQEHWSPLIRTVDSVIRRAPLGLIKEVILVDDASRKPFLQKTLEIFLKEHYPIAKVLRTNGRQGLIRTRVLGAKEAIGDVLIFLDSHSEANVNWLPPLLEPIAKNYKTVTCPFIDVINYDTFEYL----SQDEGARGIFDWNFDYKRIP---RFKSDESHPADPFESPVMAGGLFAISRKWFWELGGYDEGLDIWGGEQYEISFKLWQCGGKMLDIPCSRIGHVYRKYSP--FPNNAKGNFISRNFKRVAEVWMDEFKEYLYLRRPTIRNEDPLNLTNQFAIREKLHCKNFSWFMKEVAFDLVNNYPLIEPNPVCSGEIKLSNPNNVSVCIDFKFRDSGYVVGLSPCLSVNHKEGGEQNFILSWKGEIKPKDRDMCMDSSDHIPGGSVLLFKCHGGRGNQFFKYKLESQQILFVNSGFCLEGDPASKHIALQTCNETITDQKWIW 1791
            + C   LV  +   VY    NS+ +  + +  Q  +    L+ +EL      +      +  NY   E E+    PGE G  V +   E     R   KE G++ Y SD IS+ R++ DIR   CK   Y + LP+VSV++ FH E W+PL+RTV SV+ R+P  LI++V++VDD S KP L++ L+ ++        V+RT  R+GLI  R +GAK + G+V++FLD+H E N NWLPPLL PI +N K +T P ID I+ +++EY     S +    GIF+W   YK      R  +   H + PF SP  AGGLFAI+R WF ELG YDEGL IWGGEQYE+SFK+WQCGG ++ +PCS +GHVYR + P  F   +    IS N  RV + WMD++ +Y   R P   N +P +++ Q A+R+KL CK+F W+M+ VA+D++ +YP++ PN V  GE +  NP     C+D      G  +G + C    H  GG Q   L+ +G++     + C+ ++    G  +    C  G  N F+ Y  +++QI+      C+    +   + LQTC E    QK++W
Sbjct:   24 YICLGVLV--LFGFVYNSKGNSMSSIKSDSAAQQFDDLDDLTNKELPGGPDPNTIFRGSELGNYEPKEPEIPSNQPGEHGKPVPVTDEEGMAAGRAAEKEFGFNTYVSDMISMNRTIPDIRPEECKHWDYPEKLPTVSVVVVFHNEGWTPLLRTVHSVLLRSPPELIEQVVMVDDDSDKPHLKEKLDKYVTRFNGKVIVVRTEQREGLINARSIGAKHSTGEVVLFLDAHCEVNTNWLPPLLAPIKRNRKVMTVPVIDGIDSNSWEYRSVYGSPNAHHSGIFEWGLLYKETQITERETAHRKHNSQPFRSPTHAGGLFAINRLWFKELGYYDEGLQIWGGEQYELSFKIWQCGGGIVFVPCSHVGHVYRSHMPYSFGKFSGKPVISINMMRVVKTWMDDYSKYYLTREPQATNVNPGDISAQLALRDKLQCKSFKWYMENVAYDVLKSYPMLPPNDVW-GEAR--NP-ATGKCLDRMGGIPG-PMGATGC----HGYGGNQLIRLNVQGQM--AQGEWCLTAN----GIRIQANHCVKGTVNGFWSYDRKTKQIIHSQKRQCITVSESGSEVTLQTCTEDNERQKFVW 594          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Celegans
Match: gly-7 (Probable N-acetylgalactosaminyltransferase 7 [Source:UniProtKB/Swiss-Prot;Acc:O61397])

HSP 1 Score: 384.8 bits (987), Expect = 1.619e-126
Identity = 213/526 (40.49%), Postives = 306/526 (58.17%), Query Frame = 1
Query:  244 NYTQIEEELKRRGPGEQGSGVRIPKAEEEEQQRIY-KENGYDGYASDKISIQRSLRDIRHPACKTLKYLKSLPSVSVIIPFHQEHWSPLIRTVDSVIRRAPLGLIKEVILVDDASRKPFLQKTLEIFLKEHYPIAKVLRTNGRQGLIRTRVLGAKEAIGDVLIFLDSHSEANVNWLPPLLEPIAKNYKTVTCPFIDVINYDTFEYL----SQDEGARGIFDWNFDYKRIP---RFKSDESHPADPFESPVMAGGLFAISRKWFWELGGYDEGLDIWGGEQYEISFKLWQCGGKMLDIPCSRIGHVYRKYSP--FPNNAKGNFISRNFKRVAEVWMDEFKEYLYLRRPTIRNEDPLNLTNQFAIREKLHCKNFSWFMKEVAFDLVNNYPLIEPNPVCSGEIKLSNPNNVSVCIDFKFRDSGYVVGLSPCLSVNHKEGGEQNFILSWKGEIKPKDRDMCMDSSDHIPGGSVLLFKCHGGRGNQFFKYKLESQQILFVNSGFCLEGDPASKHIALQTCNETITDQKWIW 1791
            NY   E E+    PGE G  V +   E     R   KE G++ Y SD IS+ R++ DIR   CK   Y + LP+VSV++ FH E W+PL+RTV SV+ R+P  LI++V++VDD S KP L++ L+ ++        V+RT  R+GLI  R +GAK + G+V++FLD+H E N NWLPPLL PI +N K +T P ID I+ +++EY     S +    GIF+W   YK      R  +   H + PF SP  AGGLFAI+R WF ELG YDEGL IWGGEQYE+SFK+WQCGG ++ +PCS +GHVYR + P  F   +    IS N  RV + WMD++ +Y   R P   N +P +++ Q A+R+KL CK+F W+M+ VA+D++ +YP++ PN V  GE +  NP     C+D      G  +G + C    H  GG Q   L+ +G++     + C+ ++    G  +    C  G  N F+ Y  +++QI+      C+    +   + LQTC E    QK++W
Sbjct:   41 NYEPKEPEIPSNQPGEHGKPVPVTDEEGMAAGRAAEKEFGFNTYVSDMISMNRTIPDIRPEECKHWDYPEKLPTVSVVVVFHNEGWTPLLRTVHSVLLRSPPELIEQVVMVDDDSDKPHLKEKLDKYVTRFNGKVIVVRTEQREGLINARSIGAKHSTGEVVLFLDAHCEVNTNWLPPLLAPIKRNRKVMTVPVIDGIDSNSWEYRSVYGSPNAHHSGIFEWGLLYKETQITERETAHRKHNSQPFRSPTHAGGLFAINRLWFKELGYYDEGLQIWGGEQYELSFKIWQCGGGIVFVPCSHVGHVYRSHMPYSFGKFSGKPVISINMMRVVKTWMDDYSKYYLTREPQATNVNPGDISAQLALRDKLQCKSFKWYMENVAYDVLKSYPMLPPNDVW-GEAR--NP-ATGKCLDRMGGIPG-PMGATGC----HGYGGNQLIRLNVQGQM--AQGEWCLTAN----GIRIQANHCVKGTVNGFWSYDRKTKQIIHSQKRQCITVSESGSEVTLQTCTEDNERQKFVW 551          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Celegans
Match: gly-5 (Polypeptide N-acetylgalactosaminyltransferase 5 [Source:UniProtKB/Swiss-Prot;Acc:Q95ZJ1])

HSP 1 Score: 344.354 bits (882), Expect = 5.159e-110
Identity = 203/518 (39.19%), Postives = 293/518 (56.56%), Query Frame = 1
Query:  286 GEQGSGVRIPKAE--EEEQQRIYK---ENGYDGYASDKISIQRSLRDIRHPACKTLKYLKSLPSVSVIIPFHQEHWSPLIRTVDSVIRRAPLGLIKEVILVDDASRKPFLQKTLEIFLKEHYPIAKVLRTNGRQGLIRTRVLGAKEAIGDVLIFLDSHSEANVNWLPPLLEPIAKNYKTVTCPFIDVINYDTFEYLSQDE--GARGIFDW--NFDYKRIP-RFKSDESHPADPFESPVMAGGLFAISRKWFWELGGYDEGLDIWGGEQYEISFKLWQCGGKMLDIPCSRIGHVYRKYSPFPNNAKGNFISRNFKRVAEVWMDEFKEYLYLRRPTIRNE--DPLNLTNQFAIREKLHCKNFSWFMKEVAFDLVNNYPLIEPNPVCSGEIKLSNPNNVSVCIDFKFRDSGYVVGLSPCLSVNHKEGGEQNFILSWKGEIKPKDRDMCMDSSDHIPGGSVLLFKCHGGRGNQFFKYKLESQQILFVNSGFCLEGDPASKHIALQTCNETITDQKWIWTSVN 1803
            GE G  V + K +   EE+ +  K    N ++ YASD IS+ R+L       CKT KY ++LP  SVII FH E WS L+RTV SV+ R P  L++EV+LVDD S     ++ LE ++ +     K+LR   R+GLIR R+ GA  A G+VL +LDSH E    W+ PLL+ I ++  TV CP IDVI+ +TFEY        + G FDW   F++  IP R + + + P DP  SP MAGGLF+I +K+F +LG YD G DIWGGE  E+SFK+W CGG +  +PCS +GHV+RK SP+      N + RN  R+AEVW+D++K Y Y R   I N+  D  +++++  +RE L CK+F W++  +  +L      +    V  GE++ +   N   CID+K    G  VG+  C    H +GG Q ++LS  GEI+  +   C+D +    G  V++F CHG +GNQ ++Y  ++ ++    S  CL        + +  C      Q W +   N
Sbjct:  113 GELGKAVVVDKTKLSTEEKAKYDKGMLNNAFNQYASDMISVHRTLPTNIDAECKTEKYNENLPRTSVIICFHNEAWSVLLRTVHSVLERTPDHLLEEVVLVDDFSDMDHTKRPLEEYMSQFGGKVKILRMEKREGLIRARLRGAAVATGEVLTYLDSHCECMEGWMEPLLDRIKRDPTTVVCPVIDVIDDNTFEYHHSKAYFTSVGGFDWGLQFNWHSIPERDRKNRTRPIDPVRSPTMAGGLFSIDKKYFEKLGTYDPGFDIWGGENLELSFKIWMCGGTLEIVPCSHVGHVFRKRSPYKWRTGVNVLKRNSIRLAEVWLDDYKTYYYER---INNQLGDFGDISSRKKLREDLGCKSFKWYLDNIYPEL-----FVPGESVAKGEMRNAGGKNRQ-CIDYK-PSGGKTVGMYQC----HNQGGNQYWMLSKDGEIRRDES--CVDYA----GSDVMVFPCHGMKGNQEWRYNHDTGRLQHAVSQKCLGMTKDGAKLEMVACQYDDPYQHWKFKEYN 610          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Fly
Match: Pgant6 (gene:FBgn0035375 transcript:FBtr0072973)

HSP 1 Score: 493.041 bits (1268), Expect = 4.820e-167
Identity = 258/533 (48.41%), Postives = 346/533 (64.92%), Query Frame = 1
Query:  235 DWHNYTQIEEELKRRGPGEQGSGVRIP-KAEEEEQQRIYKENGYDGYASDKISIQRSLRDIRHPACKTLKYLKSLPSVSVIIPFHQEHWSPLIRTVDSVIRRAPLGLIKEVILVDDASRKPFLQKTLEIFLKEHYPIAKVLRTNGRQGLIRTRVLGAKEAIGDVLIFLDSHSEANVNWLPPLLEPIAKNYKTVTCPFIDVINYDTFEYLSQDEGARGIFDWNFDYKRIPRFKSDESHPADPFESPVMAGGLFAISRKWFWELGGYDEGLDIWGGEQYEISFKLWQCGGKMLDIPCSRIGHVY---RKYSPFPNNAKGNFISRNFKRVAEVWMDEFKEYLYLRRPTI-RNEDPLNLTNQFAIREKLHCKNFSWFMKEVAFDLVNNYPLIEPNPVCSGEIKLSNPNNVSVCIDFKFRDSGYVVGLSPCLSVNHKEGGEQNFILSWKGEIKPKDRDMCMDSSDHIPGGSVLLFKCHGGRGNQFFKYKLESQQILFVNSG-FCLEGDPASKHIALQTCNETITDQKWIWTSVNMTEL 1815
            DWH+YT +E++ KR G GE G    +  +++ + ++R+  ENG++   SD IS+ RS+ DIRHP C+  +Y+  LP+VSVII F+ E+ S L+R+V S+I R+P  L+KE+ILVDD S + +L K LE ++ EH+   +V+R   R GLI  R  GA+ A  +VLIFLDSH EAN NWLPPLLEPIA N +T  CPFIDVI++  F Y +QDEGARG FDW F YKR+P    D  HPADPF+SP+MAGGLFAISR++FWELGGYDEGLDIWGGEQYE+SFK+W CGG+M D PCSRIGH+Y   R + P P   KG+++ +N+KRVAEVWMDE+K YLY     +  + DP +LT Q AIR KL+CK+F WFM+EVAFDL+  YP ++P     G   L N  N ++C+D   R     +G+  C          Q + LSWK +++ + +  C+D         V L+ CH   GNQ++ Y    +Q+     G  CLE  P S+ +    C+     Q+W + S N T L
Sbjct:  127 DWHDYTFMEKDAKRVGLGEGGKASTLDDESQRDLEKRMSLENGFNALLSDSISVNRSVPDIRHPLCRKKEYVAKLPTVSVIIIFYNEYLSVLMRSVHSLINRSPPELMKEIILVDDHSDREYLGKELETYIAEHFKWVRVVRLPRRTGLIGARAAGARNATAEVLIFLDSHVEANYNWLPPLLEPIALNKRTAVCPFIDVIDHTNFHYRAQDEGARGAFDWEFFYKRLPLLPEDLKHPADPFKSPIMAGGLFAISREFFWELGGYDEGLDIWGGEQYELSFKIWMCGGEMYDAPCSRIGHIYRGPRNHQPSPR--KGDYLHKNYKRVAEVWMDEYKNYLYSHGDGLYESVDPGDLTEQKAIRTKLNCKSFKWFMEEVAFDLMKTYPPVDPPSYAMG--ALQNVGNQNLCLDTLGRKKHNKMGMYACADNIKTPQRTQFWELSWKRDLRLRRKKECLDVQIWDANAPVWLWDCHSQGGNQYWYYDYRHKQLKHGTEGRRCLELLPFSQEVVANKCDTDNRFQQWNFGSFNKTAL 655          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Fly
Match: Pgant6 (gene:FBgn0035375 transcript:FBtr0333442)

HSP 1 Score: 493.041 bits (1268), Expect = 4.820e-167
Identity = 258/533 (48.41%), Postives = 346/533 (64.92%), Query Frame = 1
Query:  235 DWHNYTQIEEELKRRGPGEQGSGVRIP-KAEEEEQQRIYKENGYDGYASDKISIQRSLRDIRHPACKTLKYLKSLPSVSVIIPFHQEHWSPLIRTVDSVIRRAPLGLIKEVILVDDASRKPFLQKTLEIFLKEHYPIAKVLRTNGRQGLIRTRVLGAKEAIGDVLIFLDSHSEANVNWLPPLLEPIAKNYKTVTCPFIDVINYDTFEYLSQDEGARGIFDWNFDYKRIPRFKSDESHPADPFESPVMAGGLFAISRKWFWELGGYDEGLDIWGGEQYEISFKLWQCGGKMLDIPCSRIGHVY---RKYSPFPNNAKGNFISRNFKRVAEVWMDEFKEYLYLRRPTI-RNEDPLNLTNQFAIREKLHCKNFSWFMKEVAFDLVNNYPLIEPNPVCSGEIKLSNPNNVSVCIDFKFRDSGYVVGLSPCLSVNHKEGGEQNFILSWKGEIKPKDRDMCMDSSDHIPGGSVLLFKCHGGRGNQFFKYKLESQQILFVNSG-FCLEGDPASKHIALQTCNETITDQKWIWTSVNMTEL 1815
            DWH+YT +E++ KR G GE G    +  +++ + ++R+  ENG++   SD IS+ RS+ DIRHP C+  +Y+  LP+VSVII F+ E+ S L+R+V S+I R+P  L+KE+ILVDD S + +L K LE ++ EH+   +V+R   R GLI  R  GA+ A  +VLIFLDSH EAN NWLPPLLEPIA N +T  CPFIDVI++  F Y +QDEGARG FDW F YKR+P    D  HPADPF+SP+MAGGLFAISR++FWELGGYDEGLDIWGGEQYE+SFK+W CGG+M D PCSRIGH+Y   R + P P   KG+++ +N+KRVAEVWMDE+K YLY     +  + DP +LT Q AIR KL+CK+F WFM+EVAFDL+  YP ++P     G   L N  N ++C+D   R     +G+  C          Q + LSWK +++ + +  C+D         V L+ CH   GNQ++ Y    +Q+     G  CLE  P S+ +    C+     Q+W + S N T L
Sbjct:  127 DWHDYTFMEKDAKRVGLGEGGKASTLDDESQRDLEKRMSLENGFNALLSDSISVNRSVPDIRHPLCRKKEYVAKLPTVSVIIIFYNEYLSVLMRSVHSLINRSPPELMKEIILVDDHSDREYLGKELETYIAEHFKWVRVVRLPRRTGLIGARAAGARNATAEVLIFLDSHVEANYNWLPPLLEPIALNKRTAVCPFIDVIDHTNFHYRAQDEGARGAFDWEFFYKRLPLLPEDLKHPADPFKSPIMAGGLFAISREFFWELGGYDEGLDIWGGEQYELSFKIWMCGGEMYDAPCSRIGHIYRGPRNHQPSPR--KGDYLHKNYKRVAEVWMDEYKNYLYSHGDGLYESVDPGDLTEQKAIRTKLNCKSFKWFMEEVAFDLMKTYPPVDPPSYAMG--ALQNVGNQNLCLDTLGRKKHNKMGMYACADNIKTPQRTQFWELSWKRDLRLRRKKECLDVQIWDANAPVWLWDCHSQGGNQYWYYDYRHKQLKHGTEGRRCLELLPFSQEVVANKCDTDNRFQQWNFGSFNKTAL 655          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Fly
Match: Pgant6 (gene:FBgn0035375 transcript:FBtr0072972)

HSP 1 Score: 493.041 bits (1268), Expect = 4.820e-167
Identity = 258/533 (48.41%), Postives = 346/533 (64.92%), Query Frame = 1
Query:  235 DWHNYTQIEEELKRRGPGEQGSGVRIP-KAEEEEQQRIYKENGYDGYASDKISIQRSLRDIRHPACKTLKYLKSLPSVSVIIPFHQEHWSPLIRTVDSVIRRAPLGLIKEVILVDDASRKPFLQKTLEIFLKEHYPIAKVLRTNGRQGLIRTRVLGAKEAIGDVLIFLDSHSEANVNWLPPLLEPIAKNYKTVTCPFIDVINYDTFEYLSQDEGARGIFDWNFDYKRIPRFKSDESHPADPFESPVMAGGLFAISRKWFWELGGYDEGLDIWGGEQYEISFKLWQCGGKMLDIPCSRIGHVY---RKYSPFPNNAKGNFISRNFKRVAEVWMDEFKEYLYLRRPTI-RNEDPLNLTNQFAIREKLHCKNFSWFMKEVAFDLVNNYPLIEPNPVCSGEIKLSNPNNVSVCIDFKFRDSGYVVGLSPCLSVNHKEGGEQNFILSWKGEIKPKDRDMCMDSSDHIPGGSVLLFKCHGGRGNQFFKYKLESQQILFVNSG-FCLEGDPASKHIALQTCNETITDQKWIWTSVNMTEL 1815
            DWH+YT +E++ KR G GE G    +  +++ + ++R+  ENG++   SD IS+ RS+ DIRHP C+  +Y+  LP+VSVII F+ E+ S L+R+V S+I R+P  L+KE+ILVDD S + +L K LE ++ EH+   +V+R   R GLI  R  GA+ A  +VLIFLDSH EAN NWLPPLLEPIA N +T  CPFIDVI++  F Y +QDEGARG FDW F YKR+P    D  HPADPF+SP+MAGGLFAISR++FWELGGYDEGLDIWGGEQYE+SFK+W CGG+M D PCSRIGH+Y   R + P P   KG+++ +N+KRVAEVWMDE+K YLY     +  + DP +LT Q AIR KL+CK+F WFM+EVAFDL+  YP ++P     G   L N  N ++C+D   R     +G+  C          Q + LSWK +++ + +  C+D         V L+ CH   GNQ++ Y    +Q+     G  CLE  P S+ +    C+     Q+W + S N T L
Sbjct:  127 DWHDYTFMEKDAKRVGLGEGGKASTLDDESQRDLEKRMSLENGFNALLSDSISVNRSVPDIRHPLCRKKEYVAKLPTVSVIIIFYNEYLSVLMRSVHSLINRSPPELMKEIILVDDHSDREYLGKELETYIAEHFKWVRVVRLPRRTGLIGARAAGARNATAEVLIFLDSHVEANYNWLPPLLEPIALNKRTAVCPFIDVIDHTNFHYRAQDEGARGAFDWEFFYKRLPLLPEDLKHPADPFKSPIMAGGLFAISREFFWELGGYDEGLDIWGGEQYELSFKIWMCGGEMYDAPCSRIGHIYRGPRNHQPSPR--KGDYLHKNYKRVAEVWMDEYKNYLYSHGDGLYESVDPGDLTEQKAIRTKLNCKSFKWFMEEVAFDLMKTYPPVDPPSYAMG--ALQNVGNQNLCLDTLGRKKHNKMGMYACADNIKTPQRTQFWELSWKRDLRLRRKKECLDVQIWDANAPVWLWDCHSQGGNQYWYYDYRHKQLKHGTEGRRCLELLPFSQEVVANKCDTDNRFQQWNFGSFNKTAL 655          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Fly
Match: Pgant4 (gene:FBgn0051956 transcript:FBtr0333248)

HSP 1 Score: 449.899 bits (1156), Expect = 1.497e-150
Identity = 233/541 (43.07%), Postives = 340/541 (62.85%), Query Frame = 1
Query:  235 DWHNYTQIEEELKRRGPGEQGSGVRIPKAEEEE-QQRIYKENGYDGYASDKISIQRSLRDIRHPACKTLKYLKSLPSVSVIIPFHQEHWSPLIRTVDSVIRRAPLGLIKEVILVDDASRKPFLQKTLEIFLKEHYP-IAKVLRTNGRQGLIRTRVLGAKEAIGDVLIFLDSHSEANVNWLPPLLEPIAKNYKTVTCPFIDVINYDTFEYLSQD-EGARGIFDWNFDYKRIPRFKSDESHPADPFESPVMAGGLFAISRKWFWELGGYDEGLDIWGGEQYEISFKLWQCGGKMLDIPCSRIGHVYRKYSPFPNNAKG-NFISRNFKRVAEVWMDEFKEYLYLRRP-TIRNEDPLNLTNQFAIREKLHCKNFSWFMKEVAFDLVNNYPLIEPNPVCSGEIKLSNPNNVSVCIDFKFRDSGYVVGLSPCLSVNHKEGGEQNFILSWKGEIKPKDRD-MCMDSSDHIPGGSVLLFKCHGGRGNQFFKYKLESQQILF-VNSGFCLEG--DPASKHIALQTCNETITDQKWIWTSVNMTELKKLHD 1830
            DWH+Y  +E + KR G GE G  V+I   +E++ ++  Y+ NG++G  SD+IS+ RS+ D+R  ACKT KYL  LP++SVI  F  EH++ L+R++ SVI R P  L+K+++LVDD S    L++ L+ ++++H+P +  ++R   RQGLI  R+ GAK A+G V++F DSH E N NWLPPL+EPIA N K  TCP +D I+++ F Y S + +GARG FDW   YK++P    D    + P+ SPVM GGLFAI+  +FW+LGGYD+ LDIWGGEQYE+SFK+W CGG +LD+PCSR+ H++R       N +G NF+++N KRVAEVWMDE+K+Y+Y R P T  N D  +LT Q  +RE+L CK+F WFM EVA D +  +P +EP    +G I+  N  N   C+D   + +   VG+  C          Q + LS   +++ K  D +C+D  +  P  +V ++ CH   GNQF+ Y  ++Q+++   N+  CLEG  +     +   +C      Q+W +  VN T L   +D
Sbjct:  103 DWHDYAAMEADRKRSGFGEHGVAVKIENPDEKQLEKEHYEMNGFNGLISDRISVNRSVPDLRLEACKTRKYLAKLPNISVIFIFFNEHFNTLLRSIYSVINRTPPELLKQIVLVDDGSEWDVLKQPLDDYVQQHFPHLVTIVRNPERQGLIGARIAGAKVAVGQVMVFFDSHIEVNYNWLPPLIEPIAINPKISTCPMVDTISHEDFSYFSGNKDGARGGFDWKMLYKQLPVLPEDALDKSMPYRSPVMMGGLFAINTDFFWDLGGYDDQLDIWGGEQYELSFKIWMCGGMLLDVPCSRVAHIFRGPMKPRGNPRGHNFVAKNHKRVAEVWMDEYKQYVYKRDPKTYDNLDAGDLTRQRGVRERLKCKSFHWFMTEVAPDFLVKFPPVEPPSYAAGIIQ--NVANPVYCLDNMGKSTEEAVGMFSCADNRTHPQPNQFWELSIFRDLRMKGFDSVCLDVHEGPPNATVWMWSCHSQGGNQFWYYDRQTQRLVHGENNKRCLEGFVENGIAKVVANSCENGNDRQRWEFGFVNHTMLDTFYD 641          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Fly
Match: Pgant4 (gene:FBgn0051956 transcript:FBtr0114524)

HSP 1 Score: 449.899 bits (1156), Expect = 1.497e-150
Identity = 233/541 (43.07%), Postives = 340/541 (62.85%), Query Frame = 1
Query:  235 DWHNYTQIEEELKRRGPGEQGSGVRIPKAEEEE-QQRIYKENGYDGYASDKISIQRSLRDIRHPACKTLKYLKSLPSVSVIIPFHQEHWSPLIRTVDSVIRRAPLGLIKEVILVDDASRKPFLQKTLEIFLKEHYP-IAKVLRTNGRQGLIRTRVLGAKEAIGDVLIFLDSHSEANVNWLPPLLEPIAKNYKTVTCPFIDVINYDTFEYLSQD-EGARGIFDWNFDYKRIPRFKSDESHPADPFESPVMAGGLFAISRKWFWELGGYDEGLDIWGGEQYEISFKLWQCGGKMLDIPCSRIGHVYRKYSPFPNNAKG-NFISRNFKRVAEVWMDEFKEYLYLRRP-TIRNEDPLNLTNQFAIREKLHCKNFSWFMKEVAFDLVNNYPLIEPNPVCSGEIKLSNPNNVSVCIDFKFRDSGYVVGLSPCLSVNHKEGGEQNFILSWKGEIKPKDRD-MCMDSSDHIPGGSVLLFKCHGGRGNQFFKYKLESQQILF-VNSGFCLEG--DPASKHIALQTCNETITDQKWIWTSVNMTELKKLHD 1830
            DWH+Y  +E + KR G GE G  V+I   +E++ ++  Y+ NG++G  SD+IS+ RS+ D+R  ACKT KYL  LP++SVI  F  EH++ L+R++ SVI R P  L+K+++LVDD S    L++ L+ ++++H+P +  ++R   RQGLI  R+ GAK A+G V++F DSH E N NWLPPL+EPIA N K  TCP +D I+++ F Y S + +GARG FDW   YK++P    D    + P+ SPVM GGLFAI+  +FW+LGGYD+ LDIWGGEQYE+SFK+W CGG +LD+PCSR+ H++R       N +G NF+++N KRVAEVWMDE+K+Y+Y R P T  N D  +LT Q  +RE+L CK+F WFM EVA D +  +P +EP    +G I+  N  N   C+D   + +   VG+  C          Q + LS   +++ K  D +C+D  +  P  +V ++ CH   GNQF+ Y  ++Q+++   N+  CLEG  +     +   +C      Q+W +  VN T L   +D
Sbjct:  103 DWHDYAAMEADRKRSGFGEHGVAVKIENPDEKQLEKEHYEMNGFNGLISDRISVNRSVPDLRLEACKTRKYLAKLPNISVIFIFFNEHFNTLLRSIYSVINRTPPELLKQIVLVDDGSEWDVLKQPLDDYVQQHFPHLVTIVRNPERQGLIGARIAGAKVAVGQVMVFFDSHIEVNYNWLPPLIEPIAINPKISTCPMVDTISHEDFSYFSGNKDGARGGFDWKMLYKQLPVLPEDALDKSMPYRSPVMMGGLFAINTDFFWDLGGYDDQLDIWGGEQYELSFKIWMCGGMLLDVPCSRVAHIFRGPMKPRGNPRGHNFVAKNHKRVAEVWMDEYKQYVYKRDPKTYDNLDAGDLTRQRGVRERLKCKSFHWFMTEVAPDFLVKFPPVEPPSYAAGIIQ--NVANPVYCLDNMGKSTEEAVGMFSCADNRTHPQPNQFWELSIFRDLRMKGFDSVCLDVHEGPPNATVWMWSCHSQGGNQFWYYDRQTQRLVHGENNKRCLEGFVENGIAKVVANSCENGNDRQRWEFGFVNHTMLDTFYD 641          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Zebrafish
Match: GALNTL6 (si:ch211-15e22.3 [Source:ZFIN;Acc:ZDB-GENE-090312-115])

HSP 1 Score: 496.508 bits (1277), Expect = 3.182e-169
Identity = 257/544 (47.24%), Postives = 345/544 (63.42%), Query Frame = 1
Query:  235 DWHNYTQIEEELKRRGPGEQGSGVRIPKAEEEEQQRIYKENGYDGYASDKISIQRSLRDIRHPACKTLKYLKSLPSVSVIIPFHQEHWSPLIRTVDSVIRRAPLGLIKEVILVDDASRKPFLQKTLEIFLKEHYPIAKVLRTNGRQGLIRTRVLGAKEAIGDVLIFLDSHSEANVNWLPPLLEPIAKNYKTVTCPFIDVINYDTFEYLSQ-DEGARGIFDWNFDYKRIPRFKSDES-HPADPFESPVMAGGLFAISRKWFWELGGYDEGLDIWGGEQYEISFKLWQCGGKMLDIPCSRIGHVYRKYSPFPNNAKGNFISRNFKRVAEVWMDEFKEYLYLRRPTIRNEDPLNLTNQFAIREKLHCKNFSWFMKEVAFDLVNNYPLIEPNPVCSGEIKLSNPNNVS-VCIDFKFRDSGYVVGLSPCLSVNHKEGG------EQNFILSWKGEIKPKD----RDMCMDSSDHIPGGSVLLFKCHGGRGNQFFKYKLESQQILFVNSGFCLEGDPASKHIALQTCNETITDQKWIWTSVNMTELKKLH 1827
            DWH+Y  I ++ +R G GE G     P  E+E    +YKENG++ Y S+ I++ RSL DIRHP CK   YL++LP+ S+IIPFH E WS L+RT+ S+  R P  LI E+ILVDD S +  L+  L  ++   +P  +++RT  R+GLIRTR+LGA  A G+VL FLDSH EAN+NWLPPLL+ IA+N KT+ CP IDVI+++ F Y +Q  +  RG FDW   YKRIP     +   P+DP++SPVMAGGLFA++R+WFWELGGYD GL+IWGGEQ+EISFK+W CGG M D+PCSR+GH+YRKY P+     G  ++RN KRVAE WMDE+ EY+Y RRP  R+    +LT Q  +R+ L CK+F W+M  VA+DL   YP +EP P   GEI+    N  S +C+D K   +G  + L  CL    KEG       EQ F   W+ +I+P D    R  C D+        + L+ CHG +GNQ + Y+ +      V+SG C++  P  K I +  C+     Q+WI+  VN T L K +
Sbjct:   67 DWHDYESIRKDGQRVGKGEHGKPY--PLVEDECDDSVYKENGFNIYVSNNIALDRSLPDIRHPNCKQKLYLENLPNTSIIIPFHNEGWSSLLRTLHSISNRTPDHLIAEIILVDDYSDREHLKAHLAEYMSR-FPKVRIVRTKKREGLIRTRLLGASVARGEVLTFLDSHCEANINWLPPLLDQIAQNPKTIVCPMIDVIDHNHFGYEAQAGDAMRGAFDWEMYYKRIPIPPELQGPDPSDPYQSPVMAGGLFAVNRQWFWELGGYDTGLEIWGGEQFEISFKVWMCGGSMYDVPCSRVGHIYRKYVPY-KVPSGTSLARNLKRVAETWMDEYTEYIYQRRPEYRHLSTGDLTAQKELRKHLKCKDFKWYMNTVAWDLPKYYPPVEPLPAAWGEIR----NAASGLCVDSKHGSTGTELRLDNCL----KEGAERTWAHEQIFTFGWREDIRPGDPLHTRKFCFDAISQ--NSPITLYDCHGMKGNQHWSYRKDKSLYHLVSSG-CMDCSPNDKRIFMNKCDPKSETQQWIFQKVNATVLDKFN 595          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Zebrafish
Match: GALNTL6 (si:ch211-15e22.3 [Source:ZFIN;Acc:ZDB-GENE-090312-115])

HSP 1 Score: 496.508 bits (1277), Expect = 3.182e-169
Identity = 257/544 (47.24%), Postives = 345/544 (63.42%), Query Frame = 1
Query:  235 DWHNYTQIEEELKRRGPGEQGSGVRIPKAEEEEQQRIYKENGYDGYASDKISIQRSLRDIRHPACKTLKYLKSLPSVSVIIPFHQEHWSPLIRTVDSVIRRAPLGLIKEVILVDDASRKPFLQKTLEIFLKEHYPIAKVLRTNGRQGLIRTRVLGAKEAIGDVLIFLDSHSEANVNWLPPLLEPIAKNYKTVTCPFIDVINYDTFEYLSQ-DEGARGIFDWNFDYKRIPRFKSDES-HPADPFESPVMAGGLFAISRKWFWELGGYDEGLDIWGGEQYEISFKLWQCGGKMLDIPCSRIGHVYRKYSPFPNNAKGNFISRNFKRVAEVWMDEFKEYLYLRRPTIRNEDPLNLTNQFAIREKLHCKNFSWFMKEVAFDLVNNYPLIEPNPVCSGEIKLSNPNNVS-VCIDFKFRDSGYVVGLSPCLSVNHKEGG------EQNFILSWKGEIKPKD----RDMCMDSSDHIPGGSVLLFKCHGGRGNQFFKYKLESQQILFVNSGFCLEGDPASKHIALQTCNETITDQKWIWTSVNMTELKKLH 1827
            DWH+Y  I ++ +R G GE G     P  E+E    +YKENG++ Y S+ I++ RSL DIRHP CK   YL++LP+ S+IIPFH E WS L+RT+ S+  R P  LI E+ILVDD S +  L+  L  ++   +P  +++RT  R+GLIRTR+LGA  A G+VL FLDSH EAN+NWLPPLL+ IA+N KT+ CP IDVI+++ F Y +Q  +  RG FDW   YKRIP     +   P+DP++SPVMAGGLFA++R+WFWELGGYD GL+IWGGEQ+EISFK+W CGG M D+PCSR+GH+YRKY P+     G  ++RN KRVAE WMDE+ EY+Y RRP  R+    +LT Q  +R+ L CK+F W+M  VA+DL   YP +EP P   GEI+    N  S +C+D K   +G  + L  CL    KEG       EQ F   W+ +I+P D    R  C D+        + L+ CHG +GNQ + Y+ +      V+SG C++  P  K I +  C+     Q+WI+  VN T L K +
Sbjct:   67 DWHDYESIRKDGQRVGKGEHGKPY--PLVEDECDDSVYKENGFNIYVSNNIALDRSLPDIRHPNCKQKLYLENLPNTSIIIPFHNEGWSSLLRTLHSISNRTPDHLIAEIILVDDYSDREHLKAHLAEYMSR-FPKVRIVRTKKREGLIRTRLLGASVARGEVLTFLDSHCEANINWLPPLLDQIAQNPKTIVCPMIDVIDHNHFGYEAQAGDAMRGAFDWEMYYKRIPIPPELQGPDPSDPYQSPVMAGGLFAVNRQWFWELGGYDTGLEIWGGEQFEISFKVWMCGGSMYDVPCSRVGHIYRKYVPY-KVPSGTSLARNLKRVAETWMDEYTEYIYQRRPEYRHLSTGDLTAQKELRKHLKCKDFKWYMNTVAWDLPKYYPPVEPLPAAWGEIR----NAASGLCVDSKHGSTGTELRLDNCL----KEGAERTWAHEQIFTFGWREDIRPGDPLHTRKFCFDAISQ--NSPITLYDCHGMKGNQHWSYRKDKSLYHLVSSG-CMDCSPNDKRIFMNKCDPKSETQQWIFQKVNATVLDKFN 595          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Zebrafish
Match: GALNT10 (polypeptide N-acetylgalactosaminyltransferase 10-like [Source:NCBI gene;Acc:103910015])

HSP 1 Score: 378.637 bits (971), Expect = 4.532e-126
Identity = 189/401 (47.13%), Postives = 261/401 (65.09%), Query Frame = 1
Query:  637 PIAKVLRTNGRQGLIRTRVLGAKEAIGDVLIFLDSHSEANVNWLPPLLEPIAKNYKTVTCPFIDVINYDTFEYLSQ-DEGARGIFDWNFDYKRIP-RFKSDESHPADPFESPVMAGGLFAISRKWFWELGGYDEGLDIWGGEQYEISFKLWQCGGKMLDIPCSRIGHVYRKYSPFPNNAKGNFISRNFKRVAEVWMDEFKEYLYLRRPTIRNEDPLNLTNQFAIREKLHCKNFSWFMKEVAFDLVNNYPLIEPNPVCSGEIKLSNPNNVSVCIDFKFRDSGYVVGLSPCLSVNHKEGGE--QNFILSWKGEIKPKD----RDMCMDSSDHIPGGSVLLFKCHGGRGNQFFKYKLESQQILFVNSGFCLEGDPASKHIALQTCNETITDQKWIWTSVNMTEL 1815
            P  ++LRT  R+GLIRTR+LGA  A G V+ FLDSH EANVNWLPPLL+ IA+N KT+ CP IDVI++D F Y +Q  +  RG FDW   YKRIP   +  +  P++PF+SPVMAGGLFA+ RKWFWELGGYD GL+IWGGEQYEISFK+W CGG+M DIPCSR+GH+YRKY P+     G  ++RN KRVAEVWMDE+ E+LY RRP  R+    +++ Q  +R +LHC++F WFM+EVA+DL  +YP +EP     GE++        +C++ K   SG  + L PCL    +      Q F   W+ +I+  D    + +C D+  H     V L+ CHG +GNQ + Y+ + + +    S  C+  D A K + + +C+ + + Q+W++ + N + L
Sbjct:    5 PKVRILRTQKREGLIRTRLLGAAAARGQVITFLDSHCEANVNWLPPLLDRIAQNRKTIVCPMIDVIDHDNFGYETQAGDAMRGAFDWEMYYKRIPIPAQLAKPDPSEPFDSPVMAGGLFAVDRKWFWELGGYDTGLEIWGGEQYEISFKVWMCGGRMEDIPCSRVGHIYRKYVPY-KVPGGVSLARNLKRVAEVWMDEYAEFLYQRRPEYRHLSSGDVSQQKELRSRLHCRSFRWFMEEVAWDLPKHYPPVEPPAAAWGELRNV---GTGLCVESKHFSSGSPIRLEPCLRSRGEPSWSHGQVFTFGWRQDIRVGDPLHTKKVCFDAVSH--NSPVTLYDCHGMKGNQLWAYR-KDRSLFHPISNSCVSADAAQKRLLMSSCDASSSSQQWVFQNTNSSVL 398          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Zebrafish
Match: galnt13 (UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 13 [Source:ZFIN;Acc:ZDB-GENE-091204-444])

HSP 1 Score: 373.244 bits (957), Expect = 7.143e-122
Identity = 205/519 (39.50%), Postives = 296/519 (57.03%), Query Frame = 1
Query:  280 GPGEQGSGVRIPKAEEEEQQRIYKENGYDGYASDKISIQRSLRDIRHPACKTLKYLKSLPSVSVIIPFHQEHWSPLIRTVDSVIRRAPLGLIKEVILVDDASRKPFLQKTLEIFLKEHYPIAKVLRTNGRQGLIRTRVLGAKEAIGDVLIFLDSHSEANVNWLPPLLEPIAKNYKTVTCPFIDVINYDTFEYLSQDEGARGIFDWNFDYKRIP-------RFKSDESHPADPFESPVMAGGLFAISRKWFWELGGYDEGLDIWGGEQYEISFKLWQCGGKMLDIPCSRIGHVYRKYSP--FPNNAKGNFISRNFKRVAEVWMDEFKEYLYLRRPTIRNEDPLNLTNQFAIREKLHCKNFSWFMKEVAFDLVNNYPLIEPNPVCSGEIKLSNPNNVSVCIDFKFRDSGYVVGLSPCLSVNHKEGGEQNFILSWKGEIKPKDRDMCMDSSDHIPGGSVLLFKCHGGRGNQFFKYKLESQQILFVNSGFCLEGDPASKHIALQTCNETITDQKWIWTSVNMT 1809
             PGE G  V IPK E+++ + ++K N ++  ASD I++ RSL D+R   CKT  Y   LP+ S++I FH E WS L+RTV S I R+P  L+ E++LVDDAS + FL++ LE ++       ++LR   R GLIR R+ GA    G V+ FLD+H E    WL PL+  I ++ + V CP IDVI+ +TFEY++  +   G F+W  +++  P       R K D + P     +P MAGGLF+I R +F E+G YD G+DIWGGE  E+SF++WQCGG +  + CS +GHV+RK +P  FP    G  I++N +R+AEVWMDEFK++ Y+  P +   D  +++++ A+RE L CK FSW+++ V  D       I       GEI+    N    C+D   R     VG   C    H  GG Q F  +   EI+    D+C+D+S     G V++ KCH  +GNQ F+Y  E   +L VNS  CL+  P+ +   + T  +    +   W   NMT
Sbjct:   56 APGEMGKAVVIPKEEQDKMKELFKINQFNLMASDMIALNRSLPDVRLDGCKTKTYPDDLPNTSIVIVFHNEAWSTLLRTVHSAINRSPRQLLYEILLVDDASERDFLKEKLEDYVATLEVPVRILRMEQRTGLIRARLRGAAATRGQVITFLDAHCECTTGWLEPLMARIKEDRRAVVCPIIDVISDETFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPV---RTPTMAGGLFSIDRTYFEEIGTYDSGMDIWGGENLEMSFRIWQCGGSLEIVTCSHVGHVFRKATPYSFPGGT-GQVINKNNRRLAEVWMDEFKDFFYIISPGVVRVDYGDVSSRKALRESLKCKPFSWYLENVYPD-----SQIPRRYYSLGEIRNVETNQ---CVDNMGRKENEKVGFFNC----HGMGGNQVFSYTADKEIRTD--DLCLDASRL--NGPVVMLKCHHMKGNQMFEYDAERLTLLHVNSNQCLDM-PSEEDKMVPTLKDCSGRRSQQWILRNMT 553          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Zebrafish
Match: galnt1 (UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 1 [Source:ZFIN;Acc:ZDB-GENE-030131-2360])

HSP 1 Score: 371.318 bits (952), Expect = 5.087e-121
Identity = 205/523 (39.20%), Postives = 306/523 (58.51%), Query Frame = 1
Query:  280 GPGEQGSGVRIPKAEEEEQQRIYKENGYDGYASDKISIQRSLRDIRHPACKTLKYLKSLPSVSVIIPFHQEHWSPLIRTVDSVIRRAPLGLIKEVILVDDASRKPFLQKTLEIFLKEHYPIAKVLRTNGRQGLIRTRVLGAKEAIGDVLIFLDSHSEANVNWLPPLLEPIAKNYKTVTCPFIDVINYDTFEYLSQDEGARGIFDWNFDYKRIP-------RFKSDESHPADPFESPVMAGGLFAISRKWFWELGGYDEGLDIWGGEQYEISFKLWQCGGKMLDIPCSRIGHVYRKYSP--FPNNAKGNFISRNFKRVAEVWMDEFKEYLYLRRPTIRNEDPLNLTNQFAIREKLHCKNFSWFMKEVAFDLVNNYPLIEPNPVCSGEIKLSNPNNVSVCIDFKFRDSGYVVGLSPCLSVNHKEGGEQNFILSWKGEIKPKDRDMCMDSSDHIPGGSVLLFKCHGGRGNQFFKYKLESQQILFVNSGFCLE--GDPASKHIALQTCNETITDQKWIWTSVNMTEL 1815
            GPGE G  V I K ++E+ + ++K N ++  AS+ I++ RSL D+R   CKT  Y   LP  SV+I FH E W+ L+RTV SVI R+P  L++E++LVDDAS + FL++ LE ++++     +V+R   R GLIR R+ GA  + G V+ FLD+H E    WL PLL  I  + KTV CP IDVI+ DTFEY++  +   G F+W  +++  P       R K D + P     +P MAGGLF+I R +F E+G YD G+DIWGGE  EISF++WQCGG +  + CS +GHV+RK +P  FP    G  I++N +R+AEVWMDEFK + Y+  P +   D  +++ + ++R++L CK FSW+++ V  D       I  +    GEI+    N    C+D   R     VG+  C    H  GG Q F  +   EI+    D+C+D S     G V++ KCH  +GNQ ++Y      ++ VNS  CL+   +  S+  +++ C+   + Q+W+  +V + E+
Sbjct:   55 GPGEMGKPVVIAKDQQEKMKEMFKINQFNLMASEMIALNRSLPDVRLEGCKTKVYPDDLPRTSVVIVFHNEAWTTLLRTVHSVIDRSPRHLLEEIVLVDDASERDFLKRQLEHYVRKLEVPVRVVRMEQRSGLIRARLKGASISTGQVITFLDAHCECTTGWLEPLLSRIKLDKKTVVCPIIDVISDDTFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPV---RTPTMAGGLFSIDRDYFQEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGT-GQIINKNNRRLAEVWMDEFKNFFYIISPGVTKVDYGDISTRTSLRQRLQCKPFSWYLENVYPD-----SQIPRHYYSLGEIRNVETNQ---CLDNMARKENEKVGIFNC----HGMGGNQVFSYTANKEIRTD--DLCLDVSKL--NGPVMMLKCHHLKGNQLWEYDPVKLSLVHVNSNQCLDKASEDDSQVPSVRDCSGARS-QQWLLRNVTLPEI 556          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Xenopus
Match: GALNTL6 (polypeptide N-acetylgalactosaminyltransferase like 6 [Source:NCBI gene;Acc:100487935])

HSP 1 Score: 513.072 bits (1320), Expect = 1.514e-175
Identity = 258/542 (47.60%), Postives = 355/542 (65.50%), Query Frame = 1
Query:  235 DWHNYTQIEEELKRRGPGEQGSGVRIPKAEEEEQQRIYKENGYDGYASDKISIQRSLRDIRHPACKTLKYLKSLPSVSVIIPFHQEHWSPLIRTVDSVIRRAPLGLIKEVILVDDASRKPFLQKTLEIFLKEHYPIAKVLRTNGRQGLIRTRVLGAKEAIGDVLIFLDSHSEANVNWLPPLLEPIAKNYKTVTCPFIDVINYDTFEYLSQ-DEGARGIFDWNFDYKRIP-RFKSDESHPADPFESPVMAGGLFAISRKWFWELGGYDEGLDIWGGEQYEISFKLWQCGGKMLDIPCSRIGHVYRKYSPFPNNAKGNFISRNFKRVAEVWMDEFKEYLYLRRPTIRNEDPLNLTNQFAIREKLHCKNFSWFMKEVAFDLVNNYPLIEPNPVCSGEIKLSNPNNVSVCIDFKFRDSGYVVGLSPCLSVNHKE--GGEQNFILSWKGEIKPKD----RDMCMDSSDHIPGGSVLLFKCHGGRGNQFFKYKLESQQILFVNSGFCLEGDPASKHIALQTCNETITDQKWIWTSVNMTELKKLHDFN 1836
            DWH+Y  I++E  R G GE G     P  EEE+   +Y+ENG++ + S+KI++ RSL DIRHP CK   YL+ LP+ S+IIPFH E W+ L+RT+ SVI R P  LI+E+ILVDD S +  L++ LE ++  +YP  +++RT  R+GLIRTR+LGA  A G+VL FLDSH E NVNWLPPLL  IA N+KT+ CP IDVI+++ F Y +Q  +  RG FDW   YKRIP   +   + P++PFESPVMAGGLFA+ RKWFWELGGYD GL+IWGGEQYE+SFK+W CGG+M D+PCSR+GH+YRKY P+     G  ++RN KRVAE WMDE+ EY+Y RRP  R+    ++++Q  +R+ L CK+F W+M EVA+D+   YP +EP P   GEI+    N   +CID K   +G  + L  C+    +     EQ F   W+ +I+P +    R  C DS  H     V L+ CHG +GNQ + Y+ + + +    +  C++ +PA K + +  C+     Q+WI+  VNMT L+K + +N
Sbjct:   67 DWHDYESIQKEALRSGKGEHGKPY--PLTEEEQDDTVYRENGFNIFVSNKIALARSLPDIRHPNCKHKLYLERLPNTSIIIPFHNEGWTSLLRTIHSVINRTPDSLIEEMILVDDFSDREHLREKLEEYMA-YYPKVRIVRTKKREGLIRTRLLGASMAKGEVLTFLDSHCEVNVNWLPPLLNQIALNHKTIVCPMIDVIDHNHFGYEAQAGDAMRGAFDWEMYYKRIPIPPELQRTDPSEPFESPVMAGGLFAVDRKWFWELGGYDPGLEIWGGEQYELSFKVWMCGGEMFDVPCSRVGHIYRKYVPY-KVPTGTSLARNLKRVAETWMDEYAEYIYQRRPEYRHLSTGDISSQKELRKHLKCKDFKWYMSEVAWDVPKFYPPVEPPPASWGEIRNVASN---LCIDSKHGATGTELRLDTCVKDGSERTWSHEQLFTFGWREDIRPGEPLHTRKFCFDSISH--SSPVTLYDCHGMKGNQQWSYR-KDKTLFHPVTNSCIDCNPAEKKLFMNRCDPLSETQQWIFEHVNMTILQKFNIYN 598          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Xenopus
Match: galnt10 (polypeptide N-acetylgalactosaminyltransferase 10 [Source:NCBI gene;Acc:779898])

HSP 1 Score: 503.056 bits (1294), Expect = 1.387e-171
Identity = 260/537 (48.42%), Postives = 348/537 (64.80%), Query Frame = 1
Query:  235 DWHNYTQIEEELKRRGPGEQGSGVRIPKAEEEEQQRIYKENGYDGYASDKISIQRSLRDIRHPACKTLKYLKSLPSVSVIIPFHQEHWSPLIRTVDSVIRRAPLGLIKEVILVDDASRKPFLQKTLEIFLKEHYPIAKVLRTNGRQGLIRTRVLGAKEAIGDVLIFLDSHSEANVNWLPPLLEPIAKNYKTVTCPFIDVINYDTFEYLSQ-DEGARGIFDWNFDYKRIP-RFKSDESHPADPFESPVMAGGLFAISRKWFWELGGYDEGLDIWGGEQYEISFKLWQCGGKMLDIPCSRIGHVYRKYSPFPNNAKGNFISRNFKRVAEVWMDEFKEYLYLRRPTIRNEDPLNLTNQFAIREKLHCKNFSWFMKEVAFDLVNNYPLIEPNPVCSGEIKLSNPNNVSVCIDFKFRDSGYVVGLSPCLSVNHKE--GGEQNFILSWKGEIKPKDRDMCMDSS-DHIPGGS-VLLFKCHGGRGNQFFKYKLESQQILFVNSGFCLEGDPASKHIALQTCNETITDQKWIWTSVNMTELKKLH 1827
            DWHNY QI +E ++ G GEQG    +  A+  +Q   Y+ENG++ + SDKIS+ RSL DIRH  CK   Y   LP+ SVIIPFH E WS L+RTV SV+ R+P  LI E++LVDD S K  L+  LE ++  ++P  K++RT  R+GLIRTR+LGA  A G+VL FLDSH EANVNWLPPLL+P+ +NYKTV CP IDVI+ D F Y++Q  +  RG FDW   YKRIP   +  +  P+DPF+SPVMAGGLFAI+R+WFW+LGGYD GL+IWGGEQYEISFK+W CGG+M+D PCSR+GH+YRKY P+   A G  ++RN KRVAEVWMDE+ EY+Y RRP  R+    ++  Q  +R KL C++F WFM E+A+DL   YP +E  P   GEI+      + +C+  K   SG  + L  C    + +  G  Q F L W+ +I+P      M S  D +   S V LF CHG +GNQ +KY+ + + +    S  C++ +     I +  CN +   Q+W +  +N T L+  +
Sbjct:   70 DWHNYEQIRKESEQIGNGEQGKPFPMTDADHVDQA--YRENGFNIFVSDKISLNRSLPDIRHSNCKNKFYFSKLPNTSVIIPFHNEGWSSLLRTVHSVLNRSPPELIAEIVLVDDYSDKAHLKSRLEKYMA-NFPKVKIVRTKKREGLIRTRMLGATVASGEVLTFLDSHCEANVNWLPPLLDPLVQNYKTVVCPMIDVIDSDNFGYVTQAGDAMRGAFDWEMFYKRIPIPPELQKGDPSDPFDSPVMAGGLFAINREWFWQLGGYDPGLEIWGGEQYEISFKVWMCGGRMVDSPCSRVGHIYRKYVPYKVPA-GVSLARNLKRVAEVWMDEYAEYIYQRRPDYRHLSVGDVAAQKELRRKLQCRDFKWFMNEIAWDLPKYYPPVELPPAAWGEIRNV---RMDMCVGVKHVTSGTEIRLEACNKGRNSDTWGARQVFTLGWREDIRPGIPQHTMKSCFDAVSQTSPVTLFDCHGMKGNQLWKYRRD-KTVYHPTSNSCMDCNEGEYKIFMNKCNPSSPTQQWTFEHINSTILEAFN 598          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Xenopus
Match: galnt10 (polypeptide N-acetylgalactosaminyltransferase 10 [Source:NCBI gene;Acc:779898])

HSP 1 Score: 503.056 bits (1294), Expect = 1.387e-171
Identity = 260/537 (48.42%), Postives = 348/537 (64.80%), Query Frame = 1
Query:  235 DWHNYTQIEEELKRRGPGEQGSGVRIPKAEEEEQQRIYKENGYDGYASDKISIQRSLRDIRHPACKTLKYLKSLPSVSVIIPFHQEHWSPLIRTVDSVIRRAPLGLIKEVILVDDASRKPFLQKTLEIFLKEHYPIAKVLRTNGRQGLIRTRVLGAKEAIGDVLIFLDSHSEANVNWLPPLLEPIAKNYKTVTCPFIDVINYDTFEYLSQ-DEGARGIFDWNFDYKRIP-RFKSDESHPADPFESPVMAGGLFAISRKWFWELGGYDEGLDIWGGEQYEISFKLWQCGGKMLDIPCSRIGHVYRKYSPFPNNAKGNFISRNFKRVAEVWMDEFKEYLYLRRPTIRNEDPLNLTNQFAIREKLHCKNFSWFMKEVAFDLVNNYPLIEPNPVCSGEIKLSNPNNVSVCIDFKFRDSGYVVGLSPCLSVNHKE--GGEQNFILSWKGEIKPKDRDMCMDSS-DHIPGGS-VLLFKCHGGRGNQFFKYKLESQQILFVNSGFCLEGDPASKHIALQTCNETITDQKWIWTSVNMTELKKLH 1827
            DWHNY QI +E ++ G GEQG    +  A+  +Q   Y+ENG++ + SDKIS+ RSL DIRH  CK   Y   LP+ SVIIPFH E WS L+RTV SV+ R+P  LI E++LVDD S K  L+  LE ++  ++P  K++RT  R+GLIRTR+LGA  A G+VL FLDSH EANVNWLPPLL+P+ +NYKTV CP IDVI+ D F Y++Q  +  RG FDW   YKRIP   +  +  P+DPF+SPVMAGGLFAI+R+WFW+LGGYD GL+IWGGEQYEISFK+W CGG+M+D PCSR+GH+YRKY P+   A G  ++RN KRVAEVWMDE+ EY+Y RRP  R+    ++  Q  +R KL C++F WFM E+A+DL   YP +E  P   GEI+      + +C+  K   SG  + L  C    + +  G  Q F L W+ +I+P      M S  D +   S V LF CHG +GNQ +KY+ + + +    S  C++ +     I +  CN +   Q+W +  +N T L+  +
Sbjct:   70 DWHNYEQIRKESEQIGNGEQGKPFPMTDADHVDQA--YRENGFNIFVSDKISLNRSLPDIRHSNCKNKFYFSKLPNTSVIIPFHNEGWSSLLRTVHSVLNRSPPELIAEIVLVDDYSDKAHLKSRLEKYMA-NFPKVKIVRTKKREGLIRTRMLGATVASGEVLTFLDSHCEANVNWLPPLLDPLVQNYKTVVCPMIDVIDSDNFGYVTQAGDAMRGAFDWEMFYKRIPIPPELQKGDPSDPFDSPVMAGGLFAINREWFWQLGGYDPGLEIWGGEQYEISFKVWMCGGRMVDSPCSRVGHIYRKYVPYKVPA-GVSLARNLKRVAEVWMDEYAEYIYQRRPDYRHLSVGDVAAQKELRRKLQCRDFKWFMNEIAWDLPKYYPPVELPPAAWGEIRNV---RMDMCVGVKHVTSGTEIRLEACNKGRNSDTWGARQVFTLGWREDIRPGIPQHTMKSCFDAVSQTSPVTLFDCHGMKGNQLWKYRRD-KTVYHPTSNSCMDCNEGEYKIFMNKCNPSSPTQQWTFEHINSTILEAFN 598          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Xenopus
Match: GALNTL6 (polypeptide N-acetylgalactosaminyltransferase like 6 [Source:NCBI gene;Acc:100487935])

HSP 1 Score: 494.967 bits (1273), Expect = 5.408e-169
Identity = 250/540 (46.30%), Postives = 344/540 (63.70%), Query Frame = 1
Query:  235 DWHNYTQIEEELKRRGPGEQGSGVRIPKAEEEEQQRIYKENGYDGYASDKISIQRSLRDIRHPACKTLKYLKSLPSVSVIIPFHQEHWSPLIRTVDSVIRRAPLGLIKEVILVDDASRKPFLQKTLEIFLKEHYPIAKVLRTNGRQGLIRTRVLGAKEAIGDVLIFLDSHSEANVNWLPPLLEPIAKNYKTVTCPFIDVINYDTFEYLSQ-DEGARGIFDWNFDYKRIP-RFKSDESHPADPFESPVMAGGLFAISRKWFWELGGYDEGLDIWGGEQYEISFKLWQCGGKMLDIPCSRIGHVYRKYSPFPNNAKGNFISRNFKRVAEVWMDEFKEYLYLRRPTIRNEDPLNLTNQFAIREKLHCKNFSWFMKEVAFDLVNNYPLIEPNPVCSGEIKLSNPNNVSVCIDFKFRDSGYVVGLSPCLSVNHKEGGEQNFILSWKGEIKPKD----RDMCMDSSDHIPGGSVLLFKCHGGRGNQFFKYKLESQQILFVNSGFCLEGDPASKHIALQTCNETITDQKWIWTSVNMTELKKLHDFN 1836
            DWH+Y  I++E  R G GE G     P  EEE+   +Y+ENG++ + S+KI++ RSL DIRHP CK   YL+ LP+ S+IIPFH E W+ L+RT+ SVI R P  LI+E+ILVDD S +  L++ LE ++  +YP  +++RT  R+GLIRTR+LGA  A G+VL FLDSH E NVNWLPPLL  IA N+KT+ CP IDVI+++ F Y +Q  +  RG FDW   YKRIP   +   + P++PFESPVMAGGLFA+ RKWFWELGGYD GL+IWGGEQYE+SFK+W CGG+M D+PCSR+GH+YRKY P+     G  ++RN KRVAE WMDE+ EY+Y RRP  R+    ++++Q  +R+ L CK+F W+M EVA+D+   YP +EP P   GE+K++                        CL           F   W+ +I+P +    R  C DS  H     V L+ CHG +GNQ + Y+ + + +    +  C++ +PA K + +  C+     Q+WI+  VNMT L+K + +N
Sbjct:   67 DWHDYESIQKEALRSGKGEHGKPY--PLTEEEQDDTVYRENGFNIFVSNKIALARSLPDIRHPNCKHKLYLERLPNTSIIIPFHNEGWTSLLRTIHSVINRTPDSLIEEMILVDDFSDREHLREKLEEYMA-YYPKVRIVRTKKREGLIRTRLLGASMAKGEVLTFLDSHCEVNVNWLPPLLNQIALNHKTIVCPMIDVIDHNHFGYEAQAGDAMRGAFDWEMYYKRIPIPPELQRTDPSEPFESPVMAGGLFAVDRKWFWELGGYDPGLEIWGGEQYELSFKVWMCGGEMFDVPCSRVGHIYRKYVPY-KVPTGTSLARNLKRVAETWMDEYAEYIYQRRPEYRHLSTGDISSQKELRKHLKCKDFKWYMSEVAWDVPKFYPPVEPPPASWGEVKIN------------------------CL-----------FTFGWREDIRPGEPLHTRKFCFDSISH--SSPVTLYDCHGMKGNQQWSYR-KDKTLFHPVTNSCIDCNPAEKKLFMNRCDPLSETQQWIFEHVNMTILQKFNIYN 564          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Xenopus
Match: GALNTL6 (polypeptide N-acetylgalactosaminyltransferase like 6 [Source:NCBI gene;Acc:100487935])

HSP 1 Score: 468.389 bits (1204), Expect = 8.322e-159
Identity = 235/485 (48.45%), Postives = 314/485 (64.74%), Query Frame = 1
Query:  235 DWHNYTQIEEELKRRGPGEQGSGVRIPKAEEEEQQRIYKENGYDGYASDKISIQRSLRDIRHPACKTLKYLKSLPSVSVIIPFHQEHWSPLIRTVDSVIRRAPLGLIKEVILVDDASRKPFLQKTLEIFLKEHYPIAKVLRTNGRQGLIRTRVLGAKEAIGDVLIFLDSHSEANVNWLPPLLEPIAKNYKTVTCPFIDVINYDTFEYLSQ-DEGARGIFDWNFDYKRIP-RFKSDESHPADPFESPVMAGGLFAISRKWFWELGGYDEGLDIWGGEQYEISFKLWQCGGKMLDIPCSRIGHVYRKYSPFPNNAKGNFISRNFKRVAEVWMDEFKEYLYLRRPTIRNEDPLNLTNQFAIREKLHCKNFSWFMKEVAFDLVNNYPLIEPNPVCSGEIKLSNPNNVSVCIDFKFRDSGYVVGLSPCLSVNHKEGGEQNFILSWKGEIKPKD----RDMCMDSSDHIPGGSVLLFKCHGGRGNQFFKYK 1671
            DWH+Y  I++E  R G GE G     P  EEE+   +Y+ENG++ + S+KI++ RSL DIRHP CK   YL+ LP+ S+IIPFH E W+ L+RT+ SVI R P  LI+E+ILVDD S +  L++ LE ++  +YP  +++RT  R+GLIRTR+LGA  A G+VL FLDSH E NVNWLPPLL  IA N+KT+ CP IDVI+++ F Y +Q  +  RG FDW   YKRIP   +   + P++PFESPVMAGGLFA+ RKWFWELGGYD GL+IWGGEQYE+SFK+W CGG+M D+PCSR+GH+YRKY P+     G  ++RN KRVAE WMDE+ EY+Y RRP  R+    ++++Q  +R+ L CK+F W+M EVA+D+   YP +EP P   GE+K++                        CL           F   W+ +I+P +    R  C DS  H     V L+ CHG +GNQ + Y+
Sbjct:   67 DWHDYESIQKEALRSGKGEHGKPY--PLTEEEQDDTVYRENGFNIFVSNKIALARSLPDIRHPNCKHKLYLERLPNTSIIIPFHNEGWTSLLRTIHSVINRTPDSLIEEMILVDDFSDREHLREKLEEYMA-YYPKVRIVRTKKREGLIRTRLLGASMAKGEVLTFLDSHCEVNVNWLPPLLNQIALNHKTIVCPMIDVIDHNHFGYEAQAGDAMRGAFDWEMYYKRIPIPPELQRTDPSEPFESPVMAGGLFAVDRKWFWELGGYDPGLEIWGGEQYELSFKVWMCGGEMFDVPCSRVGHIYRKYVPY-KVPTGTSLARNLKRVAETWMDEYAEYIYQRRPEYRHLSTGDISSQKELRKHLKCKDFKWYMSEVAWDVPKFYPPVEPPPASWGEVKIN------------------------CL-----------FTFGWREDIRPGEPLHTRKFCFDSISH--SSPVTLYDCHGMKGNQQWSYR 510          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Mouse
Match: Galnt10 (polypeptide N-acetylgalactosaminyltransferase 10 [Source:MGI Symbol;Acc:MGI:1890480])

HSP 1 Score: 508.064 bits (1307), Expect = 1.192e-173
Identity = 259/544 (47.61%), Postives = 349/544 (64.15%), Query Frame = 1
Query:  220 ESNLVDWHNYTQIEEELKRRGPGEQGSGVRIPKAEEEEQQRIYKENGYDGYASDKISIQRSLRDIRHPACKTLKYLKSLPSVSVIIPFHQEHWSPLIRTVDSVIRRAPLGLIKEVILVDDASRKPFLQKTLEIFLKEHYPIAKVLRTNGRQGLIRTRVLGAKEAIGDVLIFLDSHSEANVNWLPPLLEPIAKNYKTVTCPFIDVINYDTFEYLSQ-DEGARGIFDWNFDYKRIP-RFKSDESHPADPFESPVMAGGLFAISRKWFWELGGYDEGLDIWGGEQYEISFKLWQCGGKMLDIPCSRIGHVYRKYSPFPNNAKGNFISRNFKRVAEVWMDEFKEYLYLRRPTIRNEDPLNLTNQFAIREKLHCKNFSWFMKEVAFDLVNNYPLIEPNPVCSGEIKLSNPNNVSVCIDFKFRDSGYVVGLSPCLSVNHKEG--GEQNFILSWKGEIKPKD----RDMCMDSSDHIPGGSVLLFKCHGGRGNQFFKYKLESQQILFVNSGFCLEGDPASKHIALQTCNETITDQKWIWTSVNMTELKKLH 1827
            E  L DWHN   I  + +R G GEQG    +  AE  +Q   Y+ENG++ Y SDKIS+ RSL DIRHP C +  YL++LP+ S+IIPFH E WS L+RTV SV+ R+P  L+ E++LVDD S +  L+K LE ++   +P  ++LRT  R+GLIRTR+LGA  A GDV+ FLDSH EANVNWLPPLL+ IA+N KT+ CP IDVI++D F Y +Q  +  RG FDW   YKRIP   +  ++ P+DPFESPVMAGGLFA+ RKWFWELGGYD GL+IWGGEQYEISFK+W CGG+M DIPCSR+GH+YRKY P+   A G  ++RN KRVAEVWMDE+ EY+Y RRP  R+    ++  Q  +R  L+CK+F WFM ++A+DL   YP +EP     GEI+        +C D K    G  + L  C+    +      Q F  +W+ +I+P D    +  C D+  H     V L+ CH  +GNQ +KY+ + + +    SG C++   +   + + TCN +   Q+W++   N T L+  +
Sbjct:   68 EQRLKDWHNKEAIRRDAQRVGYGEQGKPYPMTDAERVDQA--YRENGFNIYVSDKISLNRSLPDIRHPNCNSKLYLETLPNTSIIIPFHNEGWSSLLRTVHSVLNRSPPELVAEIVLVDDFSDREHLKKPLEDYMA-LFPSVRILRTKKREGLIRTRMLGASAATGDVVTFLDSHCEANVNWLPPLLDRIARNRKTIVCPMIDVIDHDDFRYETQAGDAMRGAFDWEMYYKRIPIPPELQKADPSDPFESPVMAGGLFAVDRKWFWELGGYDPGLEIWGGEQYEISFKVWMCGGRMEDIPCSRVGHIYRKYVPYKVPA-GVSLARNLKRVAEVWMDEYAEYIYQRRPEYRHLSAGDVVAQKKLRVSLNCKSFKWFMTKIAWDLPKFYPPVEPPAAAWGEIRNV---GTGLCTDTKLGTLGSPLRLETCIRGRGEAAWNSMQVFTFTWREDIRPGDPQHTKKFCFDAVSHT--SPVTLYDCHSMKGNQLWKYR-KDKTLYHPVSGSCMDCSESDHRVFMNTCNPSSLTQQWLFEHTNSTVLENFN 601          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Mouse
Match: Galntl6 (UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase-like 6 [Source:MGI Symbol;Acc:MGI:1913581])

HSP 1 Score: 501.901 bits (1291), Expect = 2.268e-171
Identity = 252/537 (46.93%), Postives = 344/537 (64.06%), Query Frame = 1
Query:  235 DWHNYTQIEEELKRRGPGEQGSGVRIPKAEEEEQQRIYKENGYDGYASDKISIQRSLRDIRHPACKTLKYLKSLPSVSVIIPFHQEHWSPLIRTVDSVIRRAPLGLIKEVILVDDASRKPFLQKTLEIFLKEHYPIAKVLRTNGRQGLIRTRVLGAKEAIGDVLIFLDSHSEANVNWLPPLLEPIAKNYKTVTCPFIDVINYDTFEYLSQ-DEGARGIFDWNFDYKRIP-RFKSDESHPADPFESPVMAGGLFAISRKWFWELGGYDEGLDIWGGEQYEISFKLWQCGGKMLDIPCSRIGHVYRKYSPFPNNAKGNFISRNFKRVAEVWMDEFKEYLYLRRPTIRNEDPLNLTNQFAIREKLHCKNFSWFMKEVAFDLVNNYPLIEPNPVCSGEIKLSNPNNVSVCIDFKFRDSGYVVGLSPCLSVNHKE--GGEQNFILSWKGEIKPKD----RDMCMDSSDHIPGGSVLLFKCHGGRGNQFFKYKLESQQILFVNSGFCLEGDPASKHIALQTCNETITDQKWIWTSVNMTELKK 1821
            DWH+Y  I+ +  R G GE G     P  EE+     Y+ENG++ + S+ I+++RSL DIRH  CK   YL+ LP+ S+IIPFH E W+ L+RT+ S+I R P  LI E+ILVDD S +  L+  LE ++   +   +++RT  R+GLIRTR+LGA  A G+VL FLDSH E NVNWLPPLL  IA N+KT+ CP IDVI+++ F Y +Q  +  RG FDW   YKRIP   +   + P+DPFESPVMAGGLFA+ RKWFWELGGYD GL+IWGGEQYEISFK+W CGG+M D+PCSR+GH+YRKY P+     G  ++RN KRVAE WMDEF EY+Y RRP  R+    +++ Q  +R++L CK+F WFM  VA+D+   YP +EP P   GEI+    N   +C+D K   +G  + L  C+    +     EQ F   W+ +I+P +    R  C+D+  H     V L+ CHG +GNQ + Y+ E + +    S  C++ +P+ K I +  C+     Q+WI+  +NMT L+K
Sbjct:   68 DWHDYESIQRDALRSGKGEHGKPY--PLTEEDRDDSAYRENGFNIFVSNNIALERSLPDIRHANCKHKMYLERLPNTSIIIPFHNEGWTSLLRTIHSIINRTPESLIAEIILVDDFSDREHLKDKLEDYMAR-FSKVRIVRTKKREGLIRTRLLGASVARGEVLTFLDSHCEVNVNWLPPLLNQIALNHKTIVCPMIDVIDHNHFGYEAQAGDAMRGAFDWEMYYKRIPIPPELQRADPSDPFESPVMAGGLFAVDRKWFWELGGYDPGLEIWGGEQYEISFKVWMCGGEMFDVPCSRVGHIYRKYVPY-KVPSGTSLARNLKRVAETWMDEFAEYIYQRRPEYRHLSTGDISAQKELRKRLKCKDFKWFMAAVAWDVPKYYPPVEPLPAAWGEIRSVAAN---LCVDSKHGATGTELRLDVCVKDGSERTWSHEQLFTFGWREDIRPGEPLHTRKFCLDAISH--SSPVTLYDCHGMKGNQLWGYR-EDRTLFHPVSNSCMDCNPSEKKIFMARCDPLSETQQWIFEHINMTVLEK 594          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Mouse
Match: Galntl6 (UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase-like 6 [Source:MGI Symbol;Acc:MGI:1913581])

HSP 1 Score: 389.423 bits (999), Expect = 4.645e-130
Identity = 196/416 (47.12%), Postives = 267/416 (64.18%), Query Frame = 1
Query:  598 LQKTLEIFLKEHYPIAKVLRTNGRQGLIRTRVLGAKEAIGDVLIFLDSHSEANVNWLPPLLEPIAKNYKTVTCPFIDVINYDTFEYLSQ-DEGARGIFDWNFDYKRIP-RFKSDESHPADPFESPVMAGGLFAISRKWFWELGGYDEGLDIWGGEQYEISFKLWQCGGKMLDIPCSRIGHVYRKYSPFPNNAKGNFISRNFKRVAEVWMDEFKEYLYLRRPTIRNEDPLNLTNQFAIREKLHCKNFSWFMKEVAFDLVNNYPLIEPNPVCSGEIKLSNPNNVSVCIDFKFRDSGYVVGLSPCLSVNHKE--GGEQNFILSWKGEIKPKD----RDMCMDSSDHIPGGSVLLFKCHGGRGNQFFKYKLESQQILFVNSGFCLEGDPASKHIALQTCNETITDQKWIWTSVNMTELKK 1821
            L+  LE ++   +   +++RT  R+GLIRTR+LGA  A G+VL FLDSH E NVNWLPPLL  IA N+KT+ CP IDVI+++ F Y +Q  +  RG FDW   YKRIP   +   + P+DPFESPVMAGGLFA+ RKWFWELGGYD GL+IWGGEQYEISFK+W CGG+M D+PCSR+GH+YRKY P+     G  ++RN KRVAE WMDEF EY+Y RRP  R+    +++ Q  +R++L CK+F WFM  VA+D+   YP +EP P   GEI+    N   +C+D K   +G  + L  C+    +     EQ F   W+ +I+P +    R  C+D+  H     V L+ CHG +GNQ + Y+ E + +    S  C++ +P+ K I +  C+     Q+WI+  +NMT L+K
Sbjct:    3 LKDKLEDYMAR-FSKVRIVRTKKREGLIRTRLLGASVARGEVLTFLDSHCEVNVNWLPPLLNQIALNHKTIVCPMIDVIDHNHFGYEAQAGDAMRGAFDWEMYYKRIPIPPELQRADPSDPFESPVMAGGLFAVDRKWFWELGGYDPGLEIWGGEQYEISFKVWMCGGEMFDVPCSRVGHIYRKYVPY-KVPSGTSLARNLKRVAETWMDEFAEYIYQRRPEYRHLSTGDISAQKELRKRLKCKDFKWFMAAVAWDVPKYYPPVEPLPAAWGEIRSVAAN---LCVDSKHGATGTELRLDVCVKDGSERTWSHEQLFTFGWREDIRPGEPLHTRKFCLDAISH--SSPVTLYDCHGMKGNQLWGYR-EDRTLFHPVSNSCMDCNPSEKKIFMARCDPLSETQQWIFEHINMTVLEK 410          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Mouse
Match: Galnt13 (polypeptide N-acetylgalactosaminyltransferase 13 [Source:MGI Symbol;Acc:MGI:2139447])

HSP 1 Score: 378.252 bits (970), Expect = 8.919e-124
Identity = 212/521 (40.69%), Postives = 301/521 (57.77%), Query Frame = 1
Query:  274 RRGPGEQGSGVRIPKAEEEEQQRIYKENGYDGYASDKISIQRSLRDIRHPACKTLKYLKSLPSVSVIIPFHQEHWSPLIRTVDSVIRRAPLGLIKEVILVDDASRKPFLQKTLEIFLKEHYPIAKVLRTNGRQGLIRTRVLGAKEAIGDVLIFLDSHSEANVNWLPPLLEPIAKNYKTVTCPFIDVINYDTFEYLSQDEGARGIFDWNFDYKRIP-------RFKSDESHPADPFESPVMAGGLFAISRKWFWELGGYDEGLDIWGGEQYEISFKLWQCGGKMLDIPCSRIGHVYRKYSP--FPNNAKGNFISRNFKRVAEVWMDEFKEYLYLRRPTIRNEDPLNLTNQFAIREKLHCKNFSWFMKEVAFDLVNNYPLIEPNPVCSGEIKLSNPNNVSVCIDFKFRDSGYVVGLSPCLSVNHKEGGEQNFILSWKGEIKPKDRDMCMDSSDHIPGGSVLLFKCHGGRGNQFFKYKLESQQILFVNSGFCLEGDPASKHIALQTCNETITDQKWIWTSVNMT 1809
            + GPGE G  V IPK ++E+ + ++K N ++  ASD I++ RSL D+R   CKT  Y   LP+ SV+I FH E WS L+RTV SVI R+P  L+ EVILVDDAS + FL+ TLE ++K      K++R   R GLIR R+ GA  + G V+ FLD+H E  + WL PLL  I ++ KTV CP IDVI+ DTFEY++  +   G F+W  +++  P       R K D + P     +P MAGGLF+I R +F E+G YD G+DIWGGE  E+SF++WQCGG +  + CS +GHV+RK +P  FP    G+ I++N +R+AEVWMDEFK++ Y+  P +   D  +++ +  +RE L CK FSW+++ +  D       I       GEI+    N    C+D   R     VG+  C    H  GG Q F  +   EI+    D+C+D S     G V++ KCH  RGNQ ++Y  E   +   NS  CL+ +P+ +   + T  +    +   W   NMT
Sbjct:   54 QEGPGEMGKAVLIPKDDQEKMKELFKINQFNLMASDLIALNRSLPDVRLEGCKTKVYPDELPNTSVVIVFHNEAWSTLLRTVYSVINRSPHYLLSEVILVDDASERDFLKLTLENYVKTLEVPVKIIRMEERSGLIRARLRGAAASKGQVITFLDAHCECTLGWLEPLLARIKEDRKTVVCPIIDVISDDTFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPV---RTPTMAGGLFSIDRNYFEEIGTYDAGMDIWGGENLEMSFRIWQCGGSLEIVTCSHVGHVFRKATPYTFPGGT-GHVINKNNRRLAEVWMDEFKDFFYIISPGVVKVDYGDVSVRKTLRENLKCKPFSWYLENIYPD-----SQIPRRYYSLGEIRNVETNQ---CLDNMGRKENEKVGIFNC----HGMGGNQVFSYTADKEIRTD--DLCLDVSRL--SGPVIMLKCHHMRGNQLWEYDAERLTLRHANSNQCLD-EPSEEDKMVPTMQDCSGSRSQQWLLRNMT 553          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Mouse
Match: Galnt13 (polypeptide N-acetylgalactosaminyltransferase 13 [Source:MGI Symbol;Acc:MGI:2139447])

HSP 1 Score: 378.252 bits (970), Expect = 8.919e-124
Identity = 212/521 (40.69%), Postives = 301/521 (57.77%), Query Frame = 1
Query:  274 RRGPGEQGSGVRIPKAEEEEQQRIYKENGYDGYASDKISIQRSLRDIRHPACKTLKYLKSLPSVSVIIPFHQEHWSPLIRTVDSVIRRAPLGLIKEVILVDDASRKPFLQKTLEIFLKEHYPIAKVLRTNGRQGLIRTRVLGAKEAIGDVLIFLDSHSEANVNWLPPLLEPIAKNYKTVTCPFIDVINYDTFEYLSQDEGARGIFDWNFDYKRIP-------RFKSDESHPADPFESPVMAGGLFAISRKWFWELGGYDEGLDIWGGEQYEISFKLWQCGGKMLDIPCSRIGHVYRKYSP--FPNNAKGNFISRNFKRVAEVWMDEFKEYLYLRRPTIRNEDPLNLTNQFAIREKLHCKNFSWFMKEVAFDLVNNYPLIEPNPVCSGEIKLSNPNNVSVCIDFKFRDSGYVVGLSPCLSVNHKEGGEQNFILSWKGEIKPKDRDMCMDSSDHIPGGSVLLFKCHGGRGNQFFKYKLESQQILFVNSGFCLEGDPASKHIALQTCNETITDQKWIWTSVNMT 1809
            + GPGE G  V IPK ++E+ + ++K N ++  ASD I++ RSL D+R   CKT  Y   LP+ SV+I FH E WS L+RTV SVI R+P  L+ EVILVDDAS + FL+ TLE ++K      K++R   R GLIR R+ GA  + G V+ FLD+H E  + WL PLL  I ++ KTV CP IDVI+ DTFEY++  +   G F+W  +++  P       R K D + P     +P MAGGLF+I R +F E+G YD G+DIWGGE  E+SF++WQCGG +  + CS +GHV+RK +P  FP    G+ I++N +R+AEVWMDEFK++ Y+  P +   D  +++ +  +RE L CK FSW+++ +  D       I       GEI+    N    C+D   R     VG+  C    H  GG Q F  +   EI+    D+C+D S     G V++ KCH  RGNQ ++Y  E   +   NS  CL+ +P+ +   + T  +    +   W   NMT
Sbjct:   54 QEGPGEMGKAVLIPKDDQEKMKELFKINQFNLMASDLIALNRSLPDVRLEGCKTKVYPDELPNTSVVIVFHNEAWSTLLRTVYSVINRSPHYLLSEVILVDDASERDFLKLTLENYVKTLEVPVKIIRMEERSGLIRARLRGAAASKGQVITFLDAHCECTLGWLEPLLARIKEDRKTVVCPIIDVISDDTFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPV---RTPTMAGGLFSIDRNYFEEIGTYDAGMDIWGGENLEMSFRIWQCGGSLEIVTCSHVGHVFRKATPYTFPGGT-GHVINKNNRRLAEVWMDEFKDFFYIISPGVVKVDYGDVSVRKTLRENLKCKPFSWYLENIYPD-----SQIPRRYYSLGEIRNVETNQ---CLDNMGRKENEKVGIFNC----HGMGGNQVFSYTADKEIRTD--DLCLDVSRL--SGPVIMLKCHHMRGNQLWEYDAERLTLRHANSNQCLD-EPSEEDKMVPTMQDCSGSRSQQWLLRNMT 553          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. UniProt/SwissProt
Match: sp|O45947|GLT10_CAEEL (Putative polypeptide N-acetylgalactosaminyltransferase 10 OS=Caenorhabditis elegans OX=6239 GN=gly-10 PE=1 SV=3)

HSP 1 Score: 582.022 bits (1499), Expect = 0.000e+0
Identity = 296/612 (48.37%), Postives = 395/612 (64.54%), Query Frame = 1
Query:   22 KITFAMTRFKLKN---FLKFACFAALVYLIVNSVYFRN--PNSIEN-------SSNVATTQSVELSTEELLISTSEHLESNLVDWHNYTQIEEELKRRGPGEQGSGVRIPKAEEEEQQ--RIYKENGYDGYASDKISIQRSLRDIRHPACKTLKYLKSLPSVSVIIPFHQEHWSPLIRTVDSVIRRAPLGLIKEVILVDDASRKPFLQKTLEIFLKEHY--PIAKVLRTNGRQGLIRTRVLGAKEAIGDVLIFLDSHSEANVNWLPPLLEPIAKNYKTVTCPFIDVINYDTFEYLSQDEGARGIFDWNFDYKRIPRFKSDESHPADPFESPVMAGGLFAISRKWFWELGGYDEGLDIWGGEQYEISFKLWQCGGKMLDIPCSRIGHVYR-KYSPFPNNAKGNFISRNFKRVAEVWMDEFKEYLYLRRPTIRNEDPLNLTNQFAIREKLHCKNFSWFMKEVAFDLVNNYPLIEPNPVCSGEIKLSNPNNVSVCIDFKFRDSGYVVGLSPCLSVNHKEGGEQNFILSWKGEIKPKDRDMCMDSSDHIPGGSVLLFKCHGGRGNQFFKYKLESQQILFVNSGFCLEGDPASK-HIALQTCNETITDQKWIWTSVN 1803
            K++  ++R+  +     +++      +YLI + V   N  PN  E+         + A         +E L    ++     + W +    E+E +R GPGE G  V++P+ +E E++   +YK NGY+ Y SD IS+ RS++DIRH  CK + Y   LP+VSVI PFH+EH S L+R+V SVI R+P  L+KE+ILVDD S KP L++ LE FLK++    I KVLRT  R+GLIR R LGA++A G++LIFLD+HSEAN NWLPPLL+PIA++Y+TV CPF+DVI+ +T+E   QDEGARG FDW F+YKR+P  K D   P  PF SPVMAGG FAIS KWFWELGGYDEGLDIWGGEQYE+SFK+WQC G+M+D PCSR+ H+YR KY+PF N   G+F+SRN+KRVAEVWMD++KE LY  RP + N D  +L     IREKL CK+F WFMKE+AFD    YP +EP     GEI+    N    CID +F++     GL  C S +   GGEQ+  L+   +I+PK R +C D S  +    V+LF CH  +GNQ FKY++  +QI    SG CL  D   K  + ++ C+ +   QKW W +V+
Sbjct:   60 KLSMGLSRYLSRRHHWVIQYCGLLLFLYLIYSYVATSNDGPNLHEDIPVFQGQGKDRANPNPPAALGDEALDPFEKYRGHEKIKWEDEAAYEKEKRREGPGEWGKPVKLPEDKEVEKEALSLYKANGYNAYISDMISLNRSIKDIRHKECKNMMYSAKLPTVSVIFPFHEEHNSTLLRSVYSVINRSPPELLKEIILVDDFSEKPALRQPLEDFLKKNKIDHIVKVLRTKKREGLIRGRQLGAQDATGEILIFLDAHSEANYNWLPPLLDPIAEDYRTVVCPFVDVIDCETYEVRPQDEGARGSFDWAFNYKRLPLTKKDRESPTKPFNSPVMAGGYFAISAKWFWELGGYDEGLDIWGGEQYELSFKVWQCHGRMVDAPCSRVAHIYRCKYAPFKNAGMGDFVSRNYKRVAEVWMDDYKETLYKHRPGVGNADAGDLKLMKGIREKLQCKSFDWFMKEIAFDQDKYYPAVEPKASAEGEIRNVGTN---FCIDTQFKEQNQRFGLRKCTSDDKDGGGEQDLRLTRWHDIRPKGRKICFDCSTSVDKAPVILFDCHSMKGNQLFKYRVAQKQIYHPISGQCLTADENGKGFLHMKKCDSSSDLQKWAWQTVD 668          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. UniProt/SwissProt
Match: sp|A8Y236|GLT10_CAEBR (Putative polypeptide N-acetylgalactosaminyltransferase 10 OS=Caenorhabditis briggsae OX=6238 GN=gly-10 PE=3 SV=2)

HSP 1 Score: 580.482 bits (1495), Expect = 0.000e+0
Identity = 284/534 (53.18%), Postives = 365/534 (68.35%), Query Frame = 1
Query:  232 VDWHNYTQIEEELKRRGPGEQGSGVRIP--KAEEEEQQRIYKENGYDGYASDKISIQRSLRDIRHPACKTLKYLKSLPSVSVIIPFHQEHWSPLIRTVDSVIRRAPLGLIKEVILVDDASRKPFLQKTLEIFLKEHY--PIAKVLRTNGRQGLIRTRVLGAKEAIGDVLIFLDSHSEANVNWLPPLLEPIAKNYKTVTCPFIDVINYDTFEYLSQDEGARGIFDWNFDYKRIPRFKSDESHPADPFESPVMAGGLFAISRKWFWELGGYDEGLDIWGGEQYEISFKLWQCGGKMLDIPCSRIGHVYR-KYSPFPNNAKGNFISRNFKRVAEVWMDEFKEYLYLRRPTIRNEDPLNLTNQFAIREKLHCKNFSWFMKEVAFDLVNNYPLIEPNPVCSGEIKLSNPNNVSVCIDFKFRDSGYVVGLSPCLSVNHKEGGEQNFILSWKGEIKPKDRDMCMDSSDHIPGGSVLLFKCHGGRGNQFFKYKLESQQILFVNSGFCLEGDPASK-HIALQTCNETITDQKWIWTSVNMTEL 1815
            + W +    E++  R GPGE G  V++P  K  E+E   +YK NGY+ Y SD IS+ RS++DIRH  CK + Y   LP+VSVI PFH+EH S L+R+V SVI R+P  L+KE+ILVDD S KP L++ LE FLK++    I K+LRT  R+GLIR R LGA+EA G++LIFLD+HSE N NWLPPLL+PIA +Y+TV CPF+DVI+ +T+E   QDEGARG FDW F+YKR+P  K D  +P  PF+SPVMAGG FAIS KWFWELGGYDEGLDIWGGEQYE+SFK+WQC GKM+D PCSR+ H+YR KY+PF N   G+F+SRN+KRVAEVWMDE+KE LY  RP I N D  +L     IREKL CK+F WFMKE+AFD    YP IEP     GEI+    N   +CID +F++     GL  C S +   GGEQ+  L+   +I+PK R +C D S  +    ++LF CH  +GNQ FKY++  +QI    SG CL  D   K  + ++ C+ +   Q+W W +++   L
Sbjct:   87 IKWEDEVAYEKDKAREGPGEWGKPVKLPDDKETEKEALSLYKANGYNAYISDMISLNRSIKDIRHKECKKMTYSAKLPTVSVIFPFHEEHNSTLLRSVYSVINRSPPELLKEIILVDDFSEKPALRQPLEDFLKKNKIDHIVKILRTKKREGLIRGRQLGAQEATGEILIFLDAHSECNYNWLPPLLDPIADDYRTVVCPFVDVIDCETYEIRPQDEGARGSFDWAFNYKRLPLTKKDRENPTKPFDSPVMAGGYFAISAKWFWELGGYDEGLDIWGGEQYELSFKVWQCHGKMVDAPCSRVAHIYRCKYAPFKNAGMGDFVSRNYKRVAEVWMDEYKETLYKHRPGIGNADAGDLKLMKGIREKLQCKSFDWFMKEIAFDQDKYYPAIEPKASAEGEIRHVASN---LCIDTQFKEQNQRFGLRKCASEDKDGGGEQDLRLTRWHDIRPKGRKICFDVSTSVDKAPIILFDCHSMKGNQLFKYRMPQKQIYHPVSGQCLTADENGKGFLHMKKCDSSSKLQQWAWQTIDQELL 617          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. UniProt/SwissProt
Match: sp|Q925R7|GLT10_RAT (Polypeptide N-acetylgalactosaminyltransferase 10 OS=Rattus norvegicus OX=10116 GN=Galnt10 PE=2 SV=1)

HSP 1 Score: 508.834 bits (1309), Expect = 4.443e-173
Identity = 260/544 (47.79%), Postives = 349/544 (64.15%), Query Frame = 1
Query:  220 ESNLVDWHNYTQIEEELKRRGPGEQGSGVRIPKAEEEEQQRIYKENGYDGYASDKISIQRSLRDIRHPACKTLKYLKSLPSVSVIIPFHQEHWSPLIRTVDSVIRRAPLGLIKEVILVDDASRKPFLQKTLEIFLKEHYPIAKVLRTNGRQGLIRTRVLGAKEAIGDVLIFLDSHSEANVNWLPPLLEPIAKNYKTVTCPFIDVINYDTFEYLSQ-DEGARGIFDWNFDYKRIP-RFKSDESHPADPFESPVMAGGLFAISRKWFWELGGYDEGLDIWGGEQYEISFKLWQCGGKMLDIPCSRIGHVYRKYSPFPNNAKGNFISRNFKRVAEVWMDEFKEYLYLRRPTIRNEDPLNLTNQFAIREKLHCKNFSWFMKEVAFDLVNNYPLIEPNPVCSGEIKLSNPNNVSVCIDFKFRDSGYVVGLSPCLSVNHKEG--GEQNFILSWKGEIKPKD----RDMCMDSSDHIPGGSVLLFKCHGGRGNQFFKYKLESQQILFVNSGFCLEGDPASKHIALQTCNETITDQKWIWTSVNMTELKKLH 1827
            E  L DWHN   I  + +R G GEQG    +  AE  +Q   Y+ENG++ Y SDKIS+ RSL DIRHP C +  YL++LP+ S+IIPFH E WS L+RTV SV+ R+P  L+ E++LVDD S +  L+K LE ++   +P  ++LRT  R+GLIRTR+LGA  A GDV+ FLDSH EANVNWLPPLL+ IA+N KT+ CP IDVI++D F Y +Q  +  RG FDW   YKRIP   +  ++ P+DPFESPVMAGGLFA+ RKWFWELGGYD GL+IWGGEQYEISFK+W CGG+M DIPCSR+GH+YRKY P+   A G  ++RN KRVAEVWMDE+ EY+Y RRP  R+    ++  Q  +R  L+CK+F WFM ++A+DL   YP +EP     GEI+        +C D K    G  + L  C+    +      Q F  +W+ +I+P D    +  C D+  H     V L+ CH  +GNQ +KY+ + + +    SG C++   +   I + TCN +   Q+W++   N T L+  +
Sbjct:   68 EQRLKDWHNKEAIRRDAQRVGNGEQGKPYPMTDAERVDQA--YRENGFNIYVSDKISLNRSLPDIRHPNCNSKLYLETLPNTSIIIPFHNEGWSSLLRTVHSVLNRSPPELVAEIVLVDDFSDREHLKKPLEDYMA-LFPSVRILRTKKREGLIRTRMLGASAATGDVITFLDSHCEANVNWLPPLLDRIARNRKTIVCPMIDVIDHDDFRYETQAGDAMRGAFDWEMYYKRIPIPPELQKADPSDPFESPVMAGGLFAVDRKWFWELGGYDPGLEIWGGEQYEISFKVWMCGGRMEDIPCSRVGHIYRKYVPYKVPA-GVSLARNLKRVAEVWMDEYAEYIYQRRPEYRHLSAGDVVAQKKLRGSLNCKSFKWFMTKIAWDLPKFYPPVEPPAAAWGEIRNV---GTGLCTDTKHGTLGSPLRLETCIRGRGEAAWNSMQVFTFTWREDIRPGDPQHTKKFCFDAVSHT--SPVTLYDCHSMKGNQLWKYR-KDKTLYHPVSGSCMDCSESDHRIFMNTCNPSSLTQQWLFEHTNSTVLENFN 601          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. UniProt/SwissProt
Match: sp|Q6P9S7|GLT10_MOUSE (Polypeptide N-acetylgalactosaminyltransferase 10 OS=Mus musculus OX=10090 GN=Galnt10 PE=2 SV=1)

HSP 1 Score: 508.064 bits (1307), Expect = 8.335e-173
Identity = 259/544 (47.61%), Postives = 349/544 (64.15%), Query Frame = 1
Query:  220 ESNLVDWHNYTQIEEELKRRGPGEQGSGVRIPKAEEEEQQRIYKENGYDGYASDKISIQRSLRDIRHPACKTLKYLKSLPSVSVIIPFHQEHWSPLIRTVDSVIRRAPLGLIKEVILVDDASRKPFLQKTLEIFLKEHYPIAKVLRTNGRQGLIRTRVLGAKEAIGDVLIFLDSHSEANVNWLPPLLEPIAKNYKTVTCPFIDVINYDTFEYLSQ-DEGARGIFDWNFDYKRIP-RFKSDESHPADPFESPVMAGGLFAISRKWFWELGGYDEGLDIWGGEQYEISFKLWQCGGKMLDIPCSRIGHVYRKYSPFPNNAKGNFISRNFKRVAEVWMDEFKEYLYLRRPTIRNEDPLNLTNQFAIREKLHCKNFSWFMKEVAFDLVNNYPLIEPNPVCSGEIKLSNPNNVSVCIDFKFRDSGYVVGLSPCLSVNHKEG--GEQNFILSWKGEIKPKD----RDMCMDSSDHIPGGSVLLFKCHGGRGNQFFKYKLESQQILFVNSGFCLEGDPASKHIALQTCNETITDQKWIWTSVNMTELKKLH 1827
            E  L DWHN   I  + +R G GEQG    +  AE  +Q   Y+ENG++ Y SDKIS+ RSL DIRHP C +  YL++LP+ S+IIPFH E WS L+RTV SV+ R+P  L+ E++LVDD S +  L+K LE ++   +P  ++LRT  R+GLIRTR+LGA  A GDV+ FLDSH EANVNWLPPLL+ IA+N KT+ CP IDVI++D F Y +Q  +  RG FDW   YKRIP   +  ++ P+DPFESPVMAGGLFA+ RKWFWELGGYD GL+IWGGEQYEISFK+W CGG+M DIPCSR+GH+YRKY P+   A G  ++RN KRVAEVWMDE+ EY+Y RRP  R+    ++  Q  +R  L+CK+F WFM ++A+DL   YP +EP     GEI+        +C D K    G  + L  C+    +      Q F  +W+ +I+P D    +  C D+  H     V L+ CH  +GNQ +KY+ + + +    SG C++   +   + + TCN +   Q+W++   N T L+  +
Sbjct:   68 EQRLKDWHNKEAIRRDAQRVGYGEQGKPYPMTDAERVDQA--YRENGFNIYVSDKISLNRSLPDIRHPNCNSKLYLETLPNTSIIIPFHNEGWSSLLRTVHSVLNRSPPELVAEIVLVDDFSDREHLKKPLEDYMA-LFPSVRILRTKKREGLIRTRMLGASAATGDVVTFLDSHCEANVNWLPPLLDRIARNRKTIVCPMIDVIDHDDFRYETQAGDAMRGAFDWEMYYKRIPIPPELQKADPSDPFESPVMAGGLFAVDRKWFWELGGYDPGLEIWGGEQYEISFKVWMCGGRMEDIPCSRVGHIYRKYVPYKVPA-GVSLARNLKRVAEVWMDEYAEYIYQRRPEYRHLSAGDVVAQKKLRVSLNCKSFKWFMTKIAWDLPKFYPPVEPPAAAWGEIRNV---GTGLCTDTKLGTLGSPLRLETCIRGRGEAAWNSMQVFTFTWREDIRPGDPQHTKKFCFDAVSHT--SPVTLYDCHSMKGNQLWKYR-KDKTLYHPVSGSCMDCSESDHRVFMNTCNPSSLTQQWLFEHTNSTVLENFN 601          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. UniProt/SwissProt
Match: sp|Q86SR1|GLT10_HUMAN (Polypeptide N-acetylgalactosaminyltransferase 10 OS=Homo sapiens OX=9606 GN=GALNT10 PE=1 SV=2)

HSP 1 Score: 506.138 bits (1302), Expect = 4.061e-172
Identity = 259/541 (47.87%), Postives = 350/541 (64.70%), Query Frame = 1
Query:  229 LVDWHNYTQIEEELKRRGPGEQGSGVRIPKAEEEEQQRIYKENGYDGYASDKISIQRSLRDIRHPACKTLKYLKSLPSVSVIIPFHQEHWSPLIRTVDSVIRRAPLGLIKEVILVDDASRKPFLQKTLEIFLKEHYPIAKVLRTNGRQGLIRTRVLGAKEAIGDVLIFLDSHSEANVNWLPPLLEPIAKNYKTVTCPFIDVINYDTFEYLSQ-DEGARGIFDWNFDYKRIP-RFKSDESHPADPFESPVMAGGLFAISRKWFWELGGYDEGLDIWGGEQYEISFKLWQCGGKMLDIPCSRIGHVYRKYSPFPNNAKGNFISRNFKRVAEVWMDEFKEYLYLRRPTIRNEDPLNLTNQFAIREKLHCKNFSWFMKEVAFDLVNNYPLIEPNPVCSGEIKLSNPNNVSVCIDFKFRDSGYVVGLSPCLSVNHKEG--GEQNFILSWKGEIKPKD----RDMCMDSSDHIPGGSVLLFKCHGGRGNQFFKYKLESQQILFVNSGFCLEGDPASKHIALQTCNETITDQKWIWTSVNMTELKKLH 1827
            L DWH+   I  + +R G GEQG    +  AE  +Q   Y+ENG++ Y SDKIS+ RSL DIRHP C + +YL++LP+ S+IIPFH E WS L+RTV SV+ R+P  L+ E++LVDD S +  L+K LE ++   +P  ++LRT  R+GLIRTR+LGA  A GDV+ FLDSH EANVNWLPPLL+ IA+N KT+ CP IDVI++D F Y +Q  +  RG FDW   YKRIP   +  ++ P+DPFESPVMAGGLFA+ RKWFWELGGYD GL+IWGGEQYEISFK+W CGG+M DIPCSR+GH+YRKY P+   A G  ++RN KRVAEVWMDE+ EY+Y RRP  R+    ++  Q  +R  L+CK+F WFM ++A+DL   YP +EP     GEI+        +C D K    G  + L  C+    +      Q F  +W+ +I+P D    +  C D+  H     V L+ CH  +GNQ +KY+ + + +    SG C++   +   I + TCN +   Q+W++   N T L+K +
Sbjct:   71 LKDWHDKEAIRRDAQRVGNGEQGRPYPMTDAERVDQA--YRENGFNIYVSDKISLNRSLPDIRHPNCNSKRYLETLPNTSIIIPFHNEGWSSLLRTVHSVLNRSPPELVAEIVLVDDFSDREHLKKPLEDYMA-LFPSVRILRTKKREGLIRTRMLGASVATGDVITFLDSHCEANVNWLPPLLDRIARNRKTIVCPMIDVIDHDDFRYETQAGDAMRGAFDWEMYYKRIPIPPELQKADPSDPFESPVMAGGLFAVDRKWFWELGGYDPGLEIWGGEQYEISFKVWMCGGRMEDIPCSRVGHIYRKYVPYKVPA-GVSLARNLKRVAEVWMDEYAEYIYQRRPEYRHLSAGDVAVQKKLRSSLNCKSFKWFMTKIAWDLPKFYPPVEPPAAAWGEIRNV---GTGLCADTKHGALGSPLRLEGCVRGRGEAAWNNMQVFTFTWREDIRPGDPQHTKKFCFDAISHT--SPVTLYDCHSMKGNQLWKYR-KDKTLYHPVSGSCMDCSESDHRIFMNTCNPSSLTQQWLFEHTNSTVLEKFN 601          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. TrEMBL
Match: A0A1S3JMP6 (Polypeptide N-acetylgalactosaminyltransferase OS=Lingula unguis OX=7574 GN=LOC106174572 PE=3 SV=1)

HSP 1 Score: 652.129 bits (1681), Expect = 0.000e+0
Identity = 302/531 (56.87%), Postives = 384/531 (72.32%), Query Frame = 1
Query:  232 VDWHNYTQIEEELKRRGPGEQGSGVRIPKAEEEEQQRIYKENGYDGYASDKISIQRSLRDIRHPACKTLKYLKSLPSVSVIIPFHQEHWSPLIRTVDSVIRRAPLGLIKEVILVDDASRKPFLQKTLEIFLKEHYPIAKVLRTNGRQGLIRTRVLGAKEAIGDVLIFLDSHSEANVNWLPPLLEPIAKNYKTVTCPFIDVINYDTFEYLSQDEGARGIFDWNFDYKRIPRFKSDESHPADPFESPVMAGGLFAISRKWFWELGGYDEGLDIWGGEQYEISFKLWQCGGKMLDIPCSRIGHVYRKYSPFPNNAKGNFISRNFKRVAEVWMDEFKEYLYLRRPTIRNEDPLNLTNQFAIREKLHCKNFSWFMKEVAFDLVNNYPLIEPNPVCSGEIKLSNPNNVSVCIDFKFRDSGYVVGLSPCLSVNHKEGGEQNFILSWKGEIKPKDRDMCMDSSDHIPGGSVLLFKCHGGRGNQFFKYKLESQQILFVNSGFCLEGDPASKHIALQTCNETITDQKWIWTSVNMTELKKL 1824
            +DWHNY QI EE +R+GPGEQGS V +   EE+++  +YK NG++ YASDKIS+ R+L DIRHP CK  KYL  LP+ SV+IPFH EHW+ L+R V S+I R+P  L+ EVIL DDAS K FL + L+ +LKEH+   + +R   R+GLIRTR+LGAK A GDVLIFLDSH EANVNWLPPLLEPIA+N +T  CPFIDVI+++ F Y +QDEGARG FDW F YKR+P    D  HP++PF+SPVMAGGLFAI RKWFWELGGYD GLDIWGGEQYE+SFK+WQC G+M+D PCSR+GH+YRK++PFPN   G+F+ +N++RVA VWMDE+ E+LY RRP  +N DP +LT Q AIR+KL CK F +FM+EVAFDL   YP +EP P   GE++        +CID +FR      GL  C+S + K GGEQ   LSW  +I+PK R++C D S  +    V+LF CHG +GNQ FKY  +++QI    S  CL+ D  +K I +  C+E +  QKW +  +N  E+KKL
Sbjct:   77 IDWHNYKQIAEEKERKGPGEQGSAVILSPEEEQKKNDLYKVNGFNAYASDKISLDRALVDIRHPDCKHKKYLAKLPTASVVIPFHNEHWTTLLRNVHSLINRSPKSLLHEVILADDASTKDFLGQKLDDYLKEHFTNVRTVRAKKREGLIRTRLLGAKAATGDVLIFLDSHCEANVNWLPPLLEPIAQNRRTAVCPFIDVIDFENFAYRAQDEGARGAFDWEFFYKRLPLLPEDLRHPSEPFKSPVMAGGLFAIDRKWFWELGGYDPGLDIWGGEQYELSFKIWQCHGQMVDAPCSRVGHIYRKFAPFPNPGIGDFVGKNYRRVAVVWMDEYAEHLYRRRPHYKNIDPGDLTEQKAIRQKLKCKPFKYFMEEVAFDLKKYYPPVEPPPFAEGEVRNL---GSGLCIDTRFRGQNEKFGLETCISESPKGGGEQQLELSWHKDIRPKKRNVCFDVSSSVHKAPVILFGCHGMQGNQLFKYNSKTKQIFHPISNHCLDSDSGNKEIFMTQCDENLQSQKWTFEKLNAVEMKKL 604          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. TrEMBL
Match: T1JNW7 (Polypeptide N-acetylgalactosaminyltransferase OS=Strigamia maritima OX=126957 PE=3 SV=1)

HSP 1 Score: 649.047 bits (1673), Expect = 0.000e+0
Identity = 312/594 (52.53%), Postives = 409/594 (68.86%), Query Frame = 1
Query:   43 RFKLKNFLKFACFAALVYLIVNSV---YFRNPNSIENSSNVATTQSVELSTEELLISTSEHLESNLVDWHNYTQIEEELKRRGPGEQGSGVRIPKAEEEEQQRIYKENGYDGYASDKISIQRSLRDIRHPACKTLKYLKSLPSVSVIIPFHQEHWSPLIRTVDSVIRRAPLGLIKEVILVDDASRKPFLQKTLEIFLKEHYPIAKVLRTNGRQGLIRTRVLGAKEAIGDVLIFLDSHSEANVNWLPPLLEPIAKNYKTVTCPFIDVINYDTFEYLSQDEGARGIFDWNFDYKRIPRFKSDESHPADPFESPVMAGGLFAISRKWFWELGGYDEGLDIWGGEQYEISFKLWQCGGKMLDIPCSRIGHVYRKYSPFPNNAKGNFISRNFKRVAEVWMDEFKEYLYLRRPTIRNEDPLNLTNQFAIREKLHCKNFSWFMKEVAFDLVNNYPLIEPNPVCSGEIKLSNPNNVSVCIDFKFRDSGYVVGLSPCLSVNHKEGGEQNFILSWKGEIKPKDRDMCMDSSDHIPGGSVLLFKCHGGRGNQFFKYKLESQQILFVNSGFCLEGDPASKHIALQTCNETITDQKWIWTSVNMTEL 1815
            R  L++ +K A  A + +   N +   +  + +S ++ S  A     ++        + + +  + +DWHNYT IEEEL+R GPGEQG+   +   E++ +Q +YK NG++ +ASDKI++ RSLRDIRH  CK   YL  LP  SVI+PFH EHWS L+RT  SVI R+P  LIKEVILVDD S K   ++ L+ +LKEH P  +V+R   R GLIR R+LGAK A GDVLIFLDSH+EAN NWLPPLL+PIAKN +TV CPFIDVI+Y+TF Y +QDEGARG FDW   YKR+P    D  +P +PF+SPVMAGGLFAISR++FWELGGYDEGLDIWGGEQYE+SFK+WQCGG+M+D PCSRIGH+YRK++PFPN   G+F+ RN++RVAEVWMDE+KEYLY RRP  RN  P +LT Q A+R +L CK+F WFM E+AFD V  YP +EP    SGEI+    N    CID +FR       L  C+  + + GGEQ F L+W  +I+PK R +C D S       V+L+ CHG +GNQF++YK+++  +  V +G CL+ D   K + ++ C++T   QKW ++ VNMT L
Sbjct:    2 RRNLRSIVKLAASAVIFFAAFNLISKYFLGDESSRKDDSESAKLMPRDIHFHWTKTVSPKKINGSKIDWHNYTLIEEELQRIGPGEQGAAFILSPEEDKLKQPLYKVNGFNAFASDKIALNRSLRDIRHFGCKDKVYLVDLPVASVIVPFHNEHWSTLLRTAYSVINRSPSHLIKEVILVDDFSNKEHCKQQLDDYLKEHQPKVRVVRAGKRVGLIRARLLGAKAATGDVLIFLDSHTEANTNWLPPLLDPIAKNKRTVVCPFIDVIDYETFAYRAQDEGARGSFDWELFYKRLPLLPEDLENPTEPFKSPVMAGGLFAISREYFWELGGYDEGLDIWGGEQYELSFKIWQCGGEMVDAPCSRIGHIYRKFAPFPNPGIGDFVGRNYRRVAEVWMDEYKEYLYSRRPHYRNISPGDLTEQKALRTRLQCKSFKWFMTEIAFDQVKKYPPVEPPDFASGEIRNVATN---YCIDTRFRGENEKFNLEKCIKDDEQGGGEQQFALTWHKDIRPKKRLVCFDVSSSEDKAPVVLWNCHGMQGNQFWQYKVDTNHLQHVITGTCLDADVERKDLFMRKCDDTSKTQKWKFSFVNMTAL 592          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. TrEMBL
Match: V4ALX2 (Polypeptide N-acetylgalactosaminyltransferase OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_239085 PE=3 SV=1)

HSP 1 Score: 645.195 bits (1663), Expect = 0.000e+0
Identity = 301/530 (56.79%), Postives = 380/530 (71.70%), Query Frame = 1
Query:  232 VDWHNYTQIEEELKRRGPGEQGSGVRIPKAEEEEQQRIYKENGYDGYASDKISIQRSLRDIRHPACKTLKYLKSLPSVSVIIPFHQEHWSPLIRTVDSVIRRAPLGLIKEVILVDDASRKPFLQKTLEIFLKEHYPIAKVLRTNGRQGLIRTRVLGAKEAIGDVLIFLDSHSEANVNWLPPLLEPIAKNYKTVTCPFIDVINYDTFEYLSQDEGARGIFDWNFDYKRIPRFKSDESHPADPFESPVMAGGLFAISRKWFWELGGYDEGLDIWGGEQYEISFKLWQCGGKMLDIPCSRIGHVYRKYSPFPNNAKGNFISRNFKRVAEVWMDEFKEYLYLRRPTIRNEDPLNLTNQFAIREKLHCKNFSWFMKEVAFDLVNNYPLIEPNPVCSGEIKLSNPNNVSVCIDFKFRDSGYVVGLSPCLSVNHKEGGEQNFILSWKGEIKPKDRDMCMDSSDHIPGGSVLLFKCHGGRGNQFFKYKLESQQILFVNSGFCLEGDPASKHIALQTCNETITDQKWIWTSVNMTELKK 1821
            +DWH+Y  I EE +R G GEQGS V +   EE+++  +YK NG++ YASDKIS+QR+L+DIRH  CK  KYL  LP+ S+I+PFH EHWS L+RT  SVI R+P  L++EVILVDD S K   ++ L+ ++ EHY   +++R   R+GLIRTR+LGA+ A GDVLIFLDSH E N+NWLPPLL+PIA++ KTV CPFIDVI+Y+TF Y +QDEGARG FDW F YKR+P    D+ HPADPF+SPVMAGGLFAI ++WFW LGGYD GLDIWGGEQYE+SFK+WQCGG M+D PCSRIGHVYRK++PFPN   G+FI RN+KRVAEVWMDE+ EYLY RRP  +  D  +LT Q AIR+KLHCK+F WFM EVAFDLV  YP IEP P+ SGE++  N  N   CID +F+       L  C+      GGEQ F  SW  +I+PK R +C D++   P   V+L+ CHG  GNQ FKY L++ QI    SG CL+ D  +  + +  C+     QKW W  +N+ ++KK
Sbjct:   25 IDWHDYKAIAEEQQRTGLGEQGSAVILTAEEEKKKGDLYKVNGFNAYASDKISLQRALKDIRHEQCKNKKYLNKLPTASIIVPFHNEHWSTLLRTAQSVIDRSPPHLLQEVILVDDFSSKEHCKQQLDDYVAEHYTKVRIVRAEKREGLIRTRLLGARAAKGDVLIFLDSHCEVNINWLPPLLDPIARDQKTVVCPFIDVIDYETFAYRAQDEGARGAFDWEFFYKRLPLLPEDKKHPADPFKSPVMAGGLFAIHQEWFWMLGGYDPGLDIWGGEQYELSFKIWQCGGMMVDSPCSRIGHVYRKFAPFPNPGVGDFIGRNYKRVAEVWMDEYAEYLYKRRPHYKTLDAGDLTEQKAIRDKLHCKSFKWFMTEVAFDLVKVYPPIEPTPMASGEVR--NQAN-EKCIDTRFKGQNERFQLESCIKDGQGAGGEQQFEFSWHKDIRPKSRAVCFDAAHSAPKSPVILYNCHGMGGNQRFKYNLQTNQIFHPVSGQCLDCDKENLEVFMNPCDADSETQKWKWEKINLKDVKK 551          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. TrEMBL
Match: A0A210PT88 (Polypeptide N-acetylgalactosaminyltransferase OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT12281 PE=3 SV=1)

HSP 1 Score: 639.032 bits (1647), Expect = 0.000e+0
Identity = 300/529 (56.71%), Postives = 380/529 (71.83%), Query Frame = 1
Query:  232 VDWHNYTQIEEELKRRGPGEQGSGVRIPKAEEEEQQRIYKENGYDGYASDKISIQRSLRDIRHPACKTLKYLKSLPSVSVIIPFHQEHWSPLIRTVDSVIRRAPLGLIKEVILVDDASRKPFLQKTLEIFLKEHYPIAKVLRTNGRQGLIRTRVLGAKEAIGDVLIFLDSHSEANVNWLPPLLEPIAKNYKTVTCPFIDVINYDTFEYLSQDEGARGIFDWNFDYKRIPRFKSDESHPADPFESPVMAGGLFAISRKWFWELGGYDEGLDIWGGEQYEISFKLWQCGGKMLDIPCSRIGHVYRKYSPFPNNAKGNFISRNFKRVAEVWMDEFKEYLYLRRPTIRNEDPLNLTNQFAIREKLHCKNFSWFMKEVAFDLVNNYPLIEPNPVCSGEIKLSNPNNVSVCIDFKFRDSGYVVGLSPCLSVNHKEGGEQNFILSWKGEIKPKDRDMCMDSSDHIPGGSVLLFKCHGGRGNQFFKYKLESQQILFVNSGFCLEGDPASKHIALQTCNETITDQKWIWTSVNMTELK 1818
            +DWH+Y QI EE +R+GPGEQG  V +   EE+++  +YK NG++ +ASDKIS+QRSL+DIRH  CK+ KYL  LP+ SVI+PFH EHW+ L+R   SV+ RAP G++ E+IL DD S K   +K L+ +LKEH+   +V+R   R+GLIRTR++GAK A G VLIFLDSH EAN+NWLPPLLEPIA++YKTV CPFIDVI+++TF Y +QDEGARG FDW F YKR+P    D  HPA+PF SPVMAGGLFAIS KWFWELGGYD GLDIWGGEQYE+SFKLWQCGGKM+D PCSRIGH+YRK++PFPN   G+F+ RN++RVAEVWMDE+ EYLY  RP  RN D  +++ Q AIR KL+CK F WFM++VAFDL   YP +EP P   GEI+  + N   +CID +++       L PCL  + K GGEQ F  SW  +I+P  R +C D S  I    ++LF CHG  GNQ FKY L++ QI  V S  CL+ D  S  +    C++ +  Q+W   +VN T L+
Sbjct:   71 IDWHSYKQIAEEEERKGPGEQGQAVILSPEEEKQKNDLYKVNGFNAFASDKISLQRSLKDIRHADCKSKKYLNHLPNASVIVPFHNEHWTTLLRLCYSVLNRAPKGMVHEIILADDFSNKEHCKKPLDDYLKEHFDNVRVVRAKQREGLIRTRIMGAKAATGQVLIFLDSHVEANINWLPPLLEPIAEDYKTVVCPFIDVIDFETFAYRAQDEGARGAFDWEFFYKRLPLLPEDLKHPAEPFNSPVMAGGLFAISTKWFWELGGYDPGLDIWGGEQYELSFKLWQCGGKMVDAPCSRIGHIYRKFAPFPNPGVGDFVGRNYRRVAEVWMDEYAEYLYNHRPHYRNIDTGDISAQKAIRTKLNCKPFKWFMEKVAFDLPKFYPPVEPPPFAKGEIRNVDAN---LCIDTRYKGQNERFQLEPCLK-DGKGGGEQEFQFSWHKDIRPGKRSVCFDVSQSIKKSPIILFNCHGMGGNQRFKYNLDTSQIYHVISNQCLDCDAGSHELFTNPCDKNLKSQQWKIQTVNETALR 595          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. TrEMBL
Match: R7V610 (Polypeptide N-acetylgalactosaminyltransferase OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_197005 PE=3 SV=1)

HSP 1 Score: 638.647 bits (1646), Expect = 0.000e+0
Identity = 309/601 (51.41%), Postives = 405/601 (67.39%), Query Frame = 1
Query:   58 NFLKFACFAALVYLIVNS--VYFRNPNSIENSSNVATTQSVELSTEELLISTSEHLES----------NLVDWHNYTQIEEELKRRGPGEQGSGVRIPKAEEEEQQRIYKENGYDGYASDKISIQRSLRDIRHPACKTLKYLKSLPSVSVIIPFHQEHWSPLIRTVDSVIRRAPLGLIKEVILVDDASRKPFLQKTLEIFLKEHYP-IAKVLRTNGRQGLIRTRVLGAKEAIGDVLIFLDSHSEANVNWLPPLLEPIAKNYKTVTCPFIDVINYDTFEYLSQDEGARGIFDWNFDYKRIPRFKSDESHPADPFESPVMAGGLFAISRKWFWELGGYDEGLDIWGGEQYEISFKLWQCGGKMLDIPCSRIGHVYRKYSPFPNNAKGNFISRNFKRVAEVWMDEFKEYLYLRRPTIRNEDPLNLTNQFAIREKLHCKNFSWFMKEVAFDLVNNYPLIEPNPVCSGEIKLSNPNNVSVCIDFKFRDSGYVVGLSPCLSVNHKEGGEQNFILSWKGEIKPKDRDMCMDSSDHIPGGSVLLFKCHGGRGNQFFKYKLESQQILFVNSGFCLEGDPASKHIALQTCNETITDQKWIWTSVNMTELKK 1821
            + LK+   AAL +L +    V F  P+  ++ +     + + +    ++  ++   ES            +DWH+Y  IE E +R GPGEQG+ V +   EE+++  +YK NG++G+ASDKIS+QRSL+DIRHP C+T KY   LP+VSV++PFH EHWS L+RT +SV+ R+P  LI E+ILVDD S K    K L+  L  HY    KV+    R+GLIRTR+ GA+EA GDVLIFLDSH EANVNWLPPLL+PIA++Y+TV CPFIDV++Y+TF Y +QDEGARG FDW F YKR+P    D  HPA PF+SPVMAGGLFAIS KWFWELGGYD GLDIWGGEQYE+SFKLWQCGG+MLD PCSR+GH+YRK++PFPN   G+F+ RN++RVAEVWMDE+ E+LY RRP  R+  P N+T Q AIR+KL+CK F WFM+E+AFDL   YP IEP  V  GE++    N   +C+D +F+  G   GL  C       GGEQ   ++W  +I+P  R  C D S  +    V+L+ CHG +GNQ+FKY  E+ Q+    S  CL+ D   K I + +C++    QKW +  VN+ + KK
Sbjct:    7 SILKYLVLAAL-FLTLGPFLVKFMIPDDHDDIAPRGNAEGMPIEPGAVVRKSASDHESPEKSRADEPLQKIDWHDYKHIEIEKQRTGPGEQGAAVILSSDEEKKKDALYKVNGFNGFASDKISLQRSLKDIRHPQCRTQKYWNKLPTVSVVVPFHNEHWSTLLRTAESVLVRSPPELIHEIILVDDFSSKEHCGKPLDDHLATHYGGKVKVIHQPKREGLIRTRLAGAREATGDVLIFLDSHCEANVNWLPPLLDPIAEDYRTVVCPFIDVVDYETFAYRAQDEGARGAFDWEFFYKRLPLLPEDLKHPARPFKSPVMAGGLFAISAKWFWELGGYDPGLDIWGGEQYELSFKLWQCGGQMLDAPCSRVGHIYRKFAPFPNPGVGDFVGRNYRRVAEVWMDEYAEFLYKRRPQYRSIQPGNITEQLAIRKKLNCKPFKWFMEEIAFDLPKKYPPIEPPAVAEGEMRNVGAN---LCVDTRFKGQGETFGLEKCAKDEPGIGGEQRLQITWHKDIRPGKRSFCFDVSTSVEKAPVILYNCHGMKGNQWFKYDTETSQVFHPISRHCLDCDAERKEIFMSSCDKDSNTQKWKFEKVNLEQAKK 603          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Cavefish
Match: si:ch211-15e22.3 (polypeptide N-acetylgalactosaminyltransferase like 6 [Source:NCBI gene;Acc:103040570])

HSP 1 Score: 504.597 bits (1298), Expect = 1.992e-172
Identity = 262/544 (48.16%), Postives = 344/544 (63.24%), Query Frame = 1
Query:  235 DWHNYTQIEEELKRRGPGEQGSGVRIPKAEEEEQQRIYKENGYDGYASDKISIQRSLRDIRHPACKTLKYLKSLPSVSVIIPFHQEHWSPLIRTVDSVIRRAPLGLIKEVILVDDASRKPFLQKTLEIFLKEHYPIAKVLRTNGRQGLIRTRVLGAKEAIGDVLIFLDSHSEANVNWLPPLLEPIAKNYKTVTCPFIDVINYDTFEYLSQ-DEGARGIFDWNFDYKRIP-RFKSDESHPADPFESPVMAGGLFAISRKWFWELGGYDEGLDIWGGEQYEISFKLWQCGGKMLDIPCSRIGHVYRKYSPFPNNAKGNFISRNFKRVAEVWMDEFKEYLYLRRPTIRNEDPLNLTNQFAIREKLHCKNFSWFMKEVAFDLVNNYPLIEPNPVCSGEIKLSNPNNVS-VCIDFKFRDSGYVVGLSPCLSVNHKEGG------EQNFILSWKGEIKPKD----RDMCMDSSDHIPGGSVLLFKCHGGRGNQFFKYKLESQQILFVNSGFCLEGDPASKHIALQTCNETITDQKWIWTSVNMTELKKLH 1827
            DWH+   I  +  R G GE G     P AE+E    +YKENG++ Y S+ I++ RSL DIRHP CK   YL++LP+ S+IIPFH E WS L+RT+ S++ R P  LI E+ILVDD S +  L   LE ++   +P  +++RT  R+GLIRTR+LGA  A G+VL FLDSH E N+NWLPPLL+ IA+N +T+ CP IDVI+++ F Y +Q  +  RG FDW   YKRIP   +   S P++P+ESPVMAGGLFA+ R+WFWELGGYD GL+IWGGEQYEISFK+W CGG M D+PCSR+GH+YRKY P+     G  ++RN KRVAE WMDEF EY+Y RRP  R+    +LT Q  +R+ L CK+F W+M  VA+DL   YP +EP P   GEI+    N  S +C+D K   +G  + L  CL    KEG       EQ F   W+ +I+P D    R  C D+        V L+ CHG RGNQ + Y+ +      V+SG C++  PA K I +  CN     Q+W++  VN T L K +
Sbjct:   67 DWHDNESIRRDELRVGKGEHGKPY--PLAEDECDDSVYKENGFNIYVSNNIALDRSLPDIRHPNCKQKLYLENLPNTSIIIPFHNEGWSSLLRTIHSIVNRTPDHLIAEIILVDDYSDRDHLGARLEDYMSR-FPKVRIVRTKKREGLIRTRLLGASVAKGEVLTFLDSHCETNINWLPPLLDQIAQNPRTIVCPMIDVIDHNHFGYEAQAGDAMRGAFDWEMYYKRIPIPLELQGSDPSNPYESPVMAGGLFAVRRQWFWELGGYDTGLEIWGGEQYEISFKVWMCGGSMYDVPCSRVGHIYRKYVPY-KVPSGTSLARNLKRVAETWMDEFAEYIYQRRPEYRHLSTGDLTAQKELRKHLKCKDFKWYMNTVAWDLPKYYPPVEPLPAAWGEIR----NAASGLCVDSKHGSTGTELRLDTCL----KEGAERTWAHEQIFTFGWREDIRPGDPLHTRKFCFDAISQ--SSPVTLYDCHGMRGNQHWSYRKDKSLYHLVSSG-CMDCSPADKRIFMNKCNPQSETQQWLFQRVNTTILDKFN 595          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Cavefish
Match: GALNT10 (polypeptide N-acetylgalactosaminyltransferase 10 [Source:HGNC Symbol;Acc:HGNC:19873])

HSP 1 Score: 476.863 bits (1226), Expect = 7.089e-163
Identity = 240/515 (46.60%), Postives = 336/515 (65.24%), Query Frame = 1
Query:  319 AEEEEQQRIYKENGYDGYASDKISIQRSLRDIRHPACKTLKYLKSLPSVSVIIPFHQEHWSPLIRTVDSVIRRAPLGLIKEVILVDDASRKPFLQKTLEIFLKEHYPIAKVLRTNGRQGLIRTRVLGAKEAIGDVLIFLDSHSEANVNWLPPLLEPIAKNYKTVTCPFIDVINYDTFEYLSQ-DEGARGIFDWNFDYKRIP---RFKSDESHPADPFESPVMAGGLFAISRKWFWELGGYDEGLDIWGGEQYEISFKLWQCGGKMLDIPCSRIGHVYRKYSPFPNNAKGNFISRNFKRVAEVWMDEFKEYLYLRRPTIRNEDPLNLTNQFAIREKLHCKNFSWFMKEVAFDLVNNYPLIEPNPVCSGEIKLSNPNNV--SVCIDFKFRDSGYVVGLSPCLSVNHKEGGE--QNFILSWKGEIKPKD----RDMCMDSSDHIPGGSVLLFKCHGGRGNQFFKYKLESQQILFVNSGFCLEGDPASKHIALQTCNETITDQKWIWTSVNMTELKKLH 1827
             + +   + Y+ENG++ Y S++IS+ RSL DIRHP CK   Y + LP+ S+IIPFH E WS L+RTV S++ R+P  LI E+ILVDD S +  L+ +LE ++    P  ++LRT  R+GLIRTR+LGA  A G+V+ FLDSH EANVNWLPPLL+ IA+N K + CP IDVI++D F Y +Q  +  RG FDW   YKRIP     + D+  P++PFESPVMAGGLFA+ RKWFWELGGYD GL+IWGGEQYEISFK+W CGG+M DIPCSR+GH+YRKY P+     G  ++RN KRVAEVWMDE+ EY+Y RRP  R+    ++T Q  +R +L+CKNF WFM +VA+DL  +YP +EP     GE++     NV   +C++ K   SG  + +  C+    +      Q F   W+ +I+  D    + +C D+  H     V L+ CHG +GNQ ++Y+ + + +    S  C++ +P  K + + +C+ +I  Q+W++   N T L + +
Sbjct:    2 TDADRVDQAYRENGFNIYVSNRISLNRSLPDIRHPNCKLKLYSERLPNTSIIIPFHNEGWSSLLRTVHSILNRSPPELIAEIILVDDFSDREHLKASLEDYMVR-MPKVRILRTKKREGLIRTRLLGAAAAKGEVITFLDSHCEANVNWLPPLLDRIAQNRKAIVCPMIDVIDHDNFGYETQAGDAMRGAFDWEMYYKRIPIPAELQKDD--PSEPFESPVMAGGLFAVDRKWFWELGGYDTGLEIWGGEQYEISFKVWMCGGRMEDIPCSRVGHIYRKYVPY-KVPGGVSLARNLKRVAEVWMDEYAEYIYQRRPEYRHLSAGDVTTQKELRARLNCKNFKWFMTDVAWDLPKHYPPVEPPAAAWGELR-----NVGSGLCMESKHFSSGTPLRMEVCVKGRGETAWSHGQVFTFGWREDIRVGDPLHTKKVCFDAISH--NSPVTLYDCHGMKGNQLWRYR-KDKTLYHPISNSCIDHNPNEKRVFMNSCDASIATQQWVFERTNSTVLDQFN 504          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Cavefish
Match: galnt13 (polypeptide N-acetylgalactosaminyltransferase 13 [Source:NCBI gene;Acc:103039482])

HSP 1 Score: 381.333 bits (978), Expect = 4.326e-125
Identity = 215/523 (41.11%), Postives = 300/523 (57.36%), Query Frame = 1
Query:  280 GPGEQGSGVRIPKAEEEEQQRIYKENGYDGYASDKISIQRSLRDIRHPACKTLKYLKSLPSVSVIIPFHQEHWSPLIRTVDSVIRRAPLGLIKEVILVDDASRKPFLQKTLEIFLKEHYPIAKVLRTNGRQGLIRTRVLGAKEAIGDVLIFLDSHSEANVNWLPPLLEPIAKNYKTVTCPFIDVINYDTFEYLSQDEGARGIFDWNFDYKRIP-------RFKSDESHPADPFESPVMAGGLFAISRKWFWELGGYDEGLDIWGGEQYEISFKLWQCGGKMLDIPCSRIGHVYRKYSP--FPNNAKGNFISRNFKRVAEVWMDEFKEYLYLRRPTIRNEDPLNLTNQFAIREKLHCKNFSWFMKEVAFDLVNNYP--LIEPNPVCSGEIKLSNPNNVSVCIDFKFRDSGYVVGLSPCLSVNHKEGGEQNFILSWKGEIKPKDRDMCMDSSDHIPGGSVLLFKCHGGRGNQFFKYKLESQQILFVNSGFCLEGDPASKHI--ALQTCNETITDQKWIWTSVNMT 1809
            GPGE G  V IPK ++E+ + ++K N ++  ASD I++ RSL D+R   CKT  Y   LP+ S++I FH E WS L+RTV SVI R+P  L+ E++LVDDAS + FL+K LE ++K      ++LR   R GLIR R+ GA    G V+ FLD+H E  V WL PLL  I ++ K V CP IDVI+ +TFEY++  +   G F+W  +++  P       R K D + P     +P MAGGLF+I R +F E+G YD G+DIWGGE  E+SF++WQCGG +  + CS +GHV+RK +P  FP    G  I++N +R+AEVWMDEFK++ Y+  P +   D  +++ + A+RE L CK FSW+++       N YP   I       GEI+    N    C+D   R     VG   C    H  GG Q F  +   EI+    D+C+D S     G V++ KCH  +GNQ F+Y  E   +L VNS  CL+       +   L+ CN + + Q   W   NMT
Sbjct:   56 GPGEMGKAVIIPKDDQEKMKELFKINQFNLMASDMIALNRSLPDVRLDGCKTKVYPDDLPNTSIVIVFHNEAWSTLLRTVHSVINRSPRHLLVEILLVDDASERDFLKKKLEDYVKTLEVPVRILRMEQRSGLIRARLRGAAATRGQVITFLDAHCECTVGWLEPLLSRIKEDRKAVVCPIIDVISDETFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPV---RTPTMAGGLFSIDRSYFEEIGTYDPGMDIWGGENLEMSFRIWQCGGSLEIVTCSHVGHVFRKATPYSFPGGT-GQVINKNNRRLAEVWMDEFKDFFYIISPGVVRVDYGDVSARKALREALQCKPFSWYLE-------NIYPDSQIPRRYFSLGEIRNVETNQ---CVDNMGRKENEKVGFFNC----HGMGGNQVFSYTADKEIRTD--DLCLDVSRL--NGPVVMLKCHHMKGNQMFEYDAERLTLLHVNSNQCLDMPSEEDKMVPTLRDCNGSRSQQ---WLLRNMT 553          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Cavefish
Match: galnt1 (polypeptide N-acetylgalactosaminyltransferase 1 [Source:NCBI gene;Acc:103031512])

HSP 1 Score: 373.629 bits (958), Expect = 4.667e-122
Identity = 206/523 (39.39%), Postives = 305/523 (58.32%), Query Frame = 1
Query:  280 GPGEQGSGVRIPKAEEEEQQRIYKENGYDGYASDKISIQRSLRDIRHPACKTLKYLKSLPSVSVIIPFHQEHWSPLIRTVDSVIRRAPLGLIKEVILVDDASRKPFLQKTLEIFLKEHYPIAKVLRTNGRQGLIRTRVLGAKEAIGDVLIFLDSHSEANVNWLPPLLEPIAKNYKTVTCPFIDVINYDTFEYLSQDEGARGIFDWNFDYKRIP-------RFKSDESHPADPFESPVMAGGLFAISRKWFWELGGYDEGLDIWGGEQYEISFKLWQCGGKMLDIPCSRIGHVYRKYSP--FPNNAKGNFISRNFKRVAEVWMDEFKEYLYLRRPTIRNEDPLNLTNQFAIREKLHCKNFSWFMKEVAFDLVNNYPLIEPNPVCSGEIKLSNPNNVSVCIDFKFRDSGYVVGLSPCLSVNHKEGGEQNFILSWKGEIKPKDRDMCMDSSDHIPGGSVLLFKCHGGRGNQFFKYKLESQQILFVNSGFCLE--GDPASKHIALQTCNETITDQKWIWTSVNMTEL 1815
            GPGE G  V IPK + E+ + ++K N ++  AS+ I++ RSL D+R   CK   Y   LP  SV+I FH E W+ L+RTV SVI R+P  L++EV+LVDDAS + FL++ LE ++++     +++R   R GLIR R+ GA  + G V+ FLD+H E  + WL PLL  I ++ KTV CP IDVI+ DTFEY++  +   G F+W  +++  P       R K D + P     +P MAGGLF+I R +F E+G YD G+DIWGGE  EISF++WQCGG +  + CS +GHV+RK +P  FP    G  I++N +R+AEVWMDEFK + Y+  P +   D  ++  + ++R+KL CK FSW+++ V  D       I  +    GEI+    N    C+D   R     VG+  C    H  GG Q F  +   EI+    D+C+D S     G V++ KCH  +GNQ + Y      ++ VNS  CL+   +  S+  +++ C  + + Q+W+  +V + E+
Sbjct:   55 GPGEMGKPVVIPKEQHEKMKEMFKINQFNLMASEMIALNRSLPDVRLEGCKNKVYPDDLPRTSVVIVFHNEAWTTLLRTVHSVINRSPRHLLEEVVLVDDASERDFLKRKLEQYVRKLEVPVRIVRMEQRSGLIRARLKGASLSTGQVITFLDAHCECTMGWLEPLLSRIKQDKKTVVCPIIDVISDDTFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPV---RTPTMAGGLFSIDRDYFQEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGT-GQIINKNNRRLAEVWMDEFKNFFYIISPGVTKVDYGDIATRASLRQKLQCKPFSWYLENVYPD-----SQIPRHYYSLGEIRNVETNQ---CLDNMARKENEKVGIFNC----HGMGGNQVFSYTANKEIRTD--DLCLDVSKL--NGPVMMLKCHHLKGNQLWDYDPLKLSLVHVNSNQCLDKASEDDSQVPSVRDCTGSRS-QQWLLRNVTLPEI 556          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Cavefish
Match: galnt13 (polypeptide N-acetylgalactosaminyltransferase 13 [Source:NCBI gene;Acc:103039482])

HSP 1 Score: 370.163 bits (949), Expect = 1.793e-120
Identity = 203/490 (41.43%), Postives = 285/490 (58.16%), Query Frame = 1
Query:  280 GPGEQGSGVRIPKAEEEEQQRIYKENGYDGYASDKISIQRSLRDIRHPACKTLKYLKSLPSVSVIIPFHQEHWSPLIRTVDSVIRRAPLGLIKEVILVDDASRKPFLQKTLEIFLKEHYPIAKVLRTNGRQGLIRTRVLGAKEAIGDVLIFLDSHSEANVNWLPPLLEPIAKNYKTVTCPFIDVINYDTFEYLSQDEGARGIFDWNFDYKRIP-------RFKSDESHPADPFESPVMAGGLFAISRKWFWELGGYDEGLDIWGGEQYEISFKLWQCGGKMLDIPCSRIGHVYRKYSP--FPNNAKGNFISRNFKRVAEVWMDEFKEYLYLRRPTIRNEDPLNLTNQFAIREKLHCKNFSWFMKEVAFDLVNNYP--LIEPNPVCSGEIKLSNPNNVSVCIDFKFRDSGYVVGLSPCLSVNHKEGGEQNFILSWKGEIKPKDRDMCMDSSDHIPGGSVLLFKCHGGRGNQFFKYKLESQQILFVNSGFCL 1716
            GPGE G  V IPK ++E+ + ++K N ++  ASD I++ RSL D+R   CKT  Y   LP+ S++I FH E WS L+RTV SVI R+P  L+ E++LVDDAS + FL+K LE ++K      ++LR   R GLIR R+ GA    G V+ FLD+H E  V WL PLL  I ++ K V CP IDVI+ +TFEY++  +   G F+W  +++  P       R K D + P     +P MAGGLF+I R +F E+G YD G+DIWGGE  E+SF++WQCGG +  + CS +GHV+RK +P  FP    G  I++N +R+AEVWMDEFK++ Y+  P +   D  +++ + A+RE L CK FSW+++       N YP   I       GEI+    N    C+D   R     VG   C    H  GG Q F  +   EI+    D+C+D S     G V++ KCH  +GNQ F+Y  E    + + +  CL
Sbjct:   56 GPGEMGKAVIIPKDDQEKMKELFKINQFNLMASDMIALNRSLPDVRLDGCKTKVYPDDLPNTSIVIVFHNEAWSTLLRTVHSVINRSPRHLLVEILLVDDASERDFLKKKLEDYVKTLEVPVRILRMEQRSGLIRARLRGAAATRGQVITFLDAHCECTVGWLEPLLSRIKEDRKAVVCPIIDVISDETFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPV---RTPTMAGGLFSIDRSYFEEIGTYDPGMDIWGGENLEMSFRIWQCGGSLEIVTCSHVGHVFRKATPYSFPGGT-GQVINKNNRRLAEVWMDEFKDFFYIISPGVVRVDYGDVSARKALREALQCKPFSWYLE-------NIYPDSQIPRRYFSLGEIRNVETNQ---CVDNMGRKENEKVGFFNC----HGMGGNQVFSYTADKEIRTD--DLCLDVSRL--NGPVVMLKCHHMKGNQMFEYDAEKGTFMHIITQSCL 523          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Sea Lamprey
Match: galnt11 (UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 11 (GalNAc-T11) [Source:ZFIN;Acc:ZDB-GENE-060929-998])

HSP 1 Score: 330.102 bits (845), Expect = 1.515e-106
Identity = 195/516 (37.79%), Postives = 289/516 (56.01%), Query Frame = 1
Query:  301 GVRIPKAEEEEQQRIYKENGYDGYASDKISIQRSLRDIRHPACKTLKYLKSLPSVSVIIPFHQEHWSPLIRTVDSVIRRAPLGLIKEVILVDDASRKPFLQKTLEIFLKEHYPI-AKVLRTNGRQGLIRTRVLGAKEAIGDVLIFLDSHSEANVNWLPPLLEPIAKNYKTVTCPFIDVINYDTFEYLSQDEGARGIFDWNFDYKRIPRFKSDESHP---ADPFESPVMAGGLFAISRKWFWELGGYDEGLDIWGGEQYEISFKLWQCGGKMLDIPCSRIGHVYRKYSPFPNNAKGNFISRNFKRVAEVWMDEFKEYLYLRRPTIRNEDPLNLTNQFAIREKLHCKNFSWFMKEVAFDLVNNYPLI----------EPNPVCSGEIKLSNPNNVSVCIDFKFRDSGYVVGLSPCLSVNHKEGGEQNFILSWKGEIKPKDRDMCMDSSDHIPGGSVLLFKCHGGRGNQFFK-------YKLESQQILFVNSGFCLEGDPASKHIALQTCNETITDQKW 1785
            G+   + ++E +   Y+++ ++   S+++   R++ D RHP C T  Y   LP+ SV+I F+ E  S L+RTV SV  R P  L+ EV+LVDD S    L++ LE  LKE +P   K++R   R+GLIR R++GA  A GDVL+FLDSH E NV WL PLL  +A+N  TV CP ID++N DTF Y S     RG F+W   ++  P   S  S P     P +SP MAGGLFA+ RK+F +LG YD G+DIWGGE  EISF++W CGG +  IPCSRIGH++RK  P+ + A  + +SRN  R+A VW+DE+KE     RP +R  +  +++ + A+RE+L C+ F W+++ V  ++    P +           P PV  G ++        V  +      G VV + PC S +     EQ ++ +   E++  +  +C+D  +  P  S  L KCHG  G+Q +        Y++   Q L V S   ++G      + ++ CN +   Q+W
Sbjct:    1 GMIYSREDQETRDLGYQKHAFNLLISNRLDPHRTIPDTRHPRCATKSYPAQLPTASVVICFYNEAVSALLRTVHSVTERTPPALLHEVLLVDDFSDLVDLREGLEKELKEKFPKKVKLVRNEKREGLIRGRMVGANHATGDVLVFLDSHCEVNVAWLEPLLARVAENPSTVVCPIIDIVNPDTFLY-SASPLVRGGFNWGLHFRWDPVPSSLLSGPDGEMAPIKSPTMAGGLFAMDRKYFNKLGQYDGGMDIWGGENLEISFRIWMCGGSLEIIPCSRIGHIFRKRRPYGSPAGADTMSRNSLRLAHVWLDEYKEQYLALRPELREREYGDVSERKALRERLGCRPFRWYLQNVYPEIEVGRPQLPQAVLSKMHKRPKPVQRGRLRHLQTGKCLVAHNDPSEKGGLVV-VRPCDSGDI----EQVWVYNEGQELQLANL-LCLDMPEMEPRASPRLMKCHGSGGSQQWTMGKFNRLYQVSLGQCLQVKSMTDVKG-----RVVMEICNGS-EQQQW 503          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000477.1 (pep scaffold:Pmarinus_7.0:GL501308:12705:54064:-1 gene:ENSPMAG00000000418.1 transcript:ENSPMAT00000000477.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 322.013 bits (824), Expect = 3.847e-104
Identity = 184/471 (39.07%), Postives = 265/471 (56.26%), Query Frame = 1
Query:  427 CKTLKYLKSLPSVSVIIPFHQEHWSPLIRTVDSVIRRAPLGLIKEVILVDDASRKPFLQKTLEIFLKEHYPIAKVLRTNGRQGLIRTRVLGAKEAIGDVLIFLDSHSEANVNWLPPLLEPIAKNYKTVTCPFIDVINYDTFEYLSQDEGARGIFDW--NFDYKRIPRFKSD--ESHPADPFESPVMAGGLFAISRKWFWELGGYDEGLDIWGGEQYEISFKLWQCGGKMLDIPCSRIGHVYRKYSP--FPNNAKGNFISRNFKRVAEVWMDEFKEYLYLRRPTIRNEDPLNLTNQFAIREKLHCKNFSWFMKEVAFDLVNNYP--LIEPNPVCSGEIKLSNPNNVSVCIDFKFRDSGYVVGLSPCLSVNHKEGGEQNFILSWKGEIKPKDRDMCMDSSDHIPGGSVLLFKCHGGRGNQFFKYKLESQQILF--VNSGFCLEGDPASKHIALQTCNETITDQKWIWTSVNMT 1809
            CKT  Y   LP  SV+I FH E WS L+RTV S+I R+P  +++E+ILVDDAS + FL+  LE +  +      ++R   R GLIR R+ GA  + G V+ FLD+H E    WL PLL  I  + K V CP IDVI+ +TFEYL+  +   G F+W  NF +  +P+ + D  +     P  SP MAGGLFAI R +F E+G YD G+DIWGGE  E+SF++WQCGG +  + CS +GHV+RK +P  FP    G  I++N +R+AEVWMD FK++ Y+  P +   +  +++ + A+R++L CK FSWF++ V       YP   I  +    GE++    N    C+D   R     +G+  C    H  GG Q F  S+  + + +  D+C+D S     G VL+ KCH  +GNQ + Y  + Q+++    NS  CL+     +   + T  E    +   W   NMT
Sbjct:    1 CKTKVYPDGLPKTSVVIVFHNEAWSTLLRTVHSIIGRSPRHMLEEIILVDDASERDFLKSPLEEYASKLPVPVHIVRMESRSGLIRARLRGAAVSRGQVITFLDAHCECTTGWLEPLLARIKADRKNVVCPIIDVISDETFEYLAGSDMTYGGFNWKLNFRWYPVPQSEMDRRKGDRTIPVRSPTMAGGLFAIDRDYFQEIGTYDAGMDIWGGENLEMSFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGT-GQVINKNNRRLAEVWMDNFKDFFYIISPGVTKVEYGDVSQRKALRDRLKCKPFSWFLENV-------YPNSQIPRHYYSLGEVRNVETNQ---CLDNMGRKENEKIGIFNC----HSMGGNQVF--SYTADKELRTDDLCLDVSRM--NGPVLMLKCHHMKGNQLWDYDQQMQKLIMRHTNSNQCLD-KATEQDRQVPTMRECDGGRSQQWILRNMT 451          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Sea Lamprey
Match: poc1bl (POC1 centriolar protein homolog B (Chlamydomonas), like [Source:ZFIN;Acc:ZDB-GENE-050306-41])

HSP 1 Score: 306.22 bits (783), Expect = 1.663e-96
Identity = 187/509 (36.74%), Postives = 283/509 (55.60%), Query Frame = 1
Query:  151 NVATTQSVELSTEELLISTSEHLESNLVDWHNYTQIEEELKR----------RGPGEQGSGVRIPKAEEEEQQRIYKEN----GYDGYASDKISIQRSLRDIRHPACKTLKY-LKSLPSVSVIIPFHQEHWSPLIRTVDSVIRRAPLGLIKEVILVDDASRKPFLQKTLEIFLKEHYPIAKVLRTNGRQGLIRTRVLGAKEAIGDVLIFLDSHSEANVNWLPPLLEPIAKNYKTVTCPFIDVINYDTFE-YLSQDEGARGIFDW--NFDYKRIPRF-KSDESHPADPFESPVMAGGLFAISRKWFWELGGYDEGLDIWGGEQYEISFKLWQCGGKMLDIPCSRIGHVYRKYSPFPNNAKGNFISRNFKRVAEVWMDEFKEYLYLRRPTIRNEDPLNLTNQFAIREKLHCKNFSWFMKEVAFDLVNNYPLIEPNPVCSGEIKLSNPNNVSVCIDFKFRD---SGYVVGLSPCLSVNHKEGGEQNFILSWKGEIK-PKDRDMCMDSSDHIP 1608
             + T+ S E S        +E  ES  V       +EE+L R          R  GE     R+   E   ++++ +E+      + Y SD+IS+ R + D R   CK  K+  + LP+ SV+I F+ E WS L+RTV SV+  +P  L++E+ILVDD S + +L+  LE ++     + +++RT  R+GL+R R+LGA  A G VL FLD H E    W+ PLL+ I +    V CP ID I+++TFE Y+   E A G FDW   F +  +P   +S  +   +P +SP MAGGLFA+S+K+F  +G YD+G+++WGGE  E+SF++WQCGG +   PCS +GHV+ K +P+P   +  F+ +N  R AEVWMD +KE+ Y R P  R E   +L+ +  +REKL CK+F W++K +  DL     + E  P   G I+  N    S CID+   D   +G ++ L PC    H +GG Q F  + + +++     ++C +  D  P
Sbjct:   30 QLVTSSSREQSERAQPFEPAEKGESQEV-------VEEDLSRPLYSKPPPDERALGEWAKAARLNLPEGSSERKLEEESIERYALNIYLSDRISLHRHIPDGRMYECKAQKFDYRRLPTTSVVIAFYNEAWSTLLRTVHSVLESSPAVLLREIILVDDFSDRAYLKSPLEDYISTLERV-RLVRTTQREGLVRARLLGATHATGQVLTFLDCHCECVPGWIEPLLQRIWEKETAVVCPVIDTIDWNTFEFYMQTSEPAIGGFDWRLTFQWHGVPEHERSRRASRIEPIQSPTMAGGLFAVSKKYFDHIGTYDQGMEVWGGENLELSFRVWQCGGSLEVHPCSHVGHVFPKKAPYP---RPRFL-QNTVRAAEVWMDSYKEHFYNRNPPGRKEKYGDLSERKTLREKLGCKSFEWYLKNIYPDLH----VPEDRPGFHGAIQ--NKGIQSECIDYNAPDNNPTGAMLSLYPC----HGQGGNQFFEYTTRKDLRFNSATELCAEVRDGKP 516          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Sea Lamprey
Match: galnt12 (UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 12 [Source:ZFIN;Acc:ZDB-GENE-060503-704])

HSP 1 Score: 299.286 bits (765), Expect = 2.286e-94
Identity = 192/517 (37.14%), Postives = 277/517 (53.58%), Query Frame = 1
Query:  286 GEQGSGVRIPKAEEEEQQRIYKENGY--DGYASDKISIQRSLRDIRHPACKTLKY-LKSLPSVSVIIPFHQEHWSPLIRTVDSVIRRAPLGLIKEVILVDDASRKPFLQKTLEIFLKEHYPIAKVLRTNGRQGLIRTRVLGAKEAIGDVLIFLDSHSEANVNWLPPLLEPIAKNYKTVTCPFIDVINYDTFEYL-SQDEGARGIFDWN--FDYKRIPRFKSDE-SHPADPFESPVMAGGLFAISRKWFWELGGYDEGLDIWGGEQYEISFKLWQCGGKMLDIPCSRIGHVYRKYSPFPNNAKGNFISRNFKRVAEVWMDEFKEYLYLRRPTIRNEDPLNLTNQFAIREKLHCKNFSWFMKEVAFDLVNNYPLIEPNPVCSGEIKLSNPNNVSVCIDFKFRDSGYVVGLSPCLSVNHKEGGEQNFILSWKGEIKPKDR--DMCMDSSDHIPGGSVLLFKCHGGRG----NQFFKYKLESQQILFVNSGFCLEG--DPASKHIALQTCNETITDQKWIW 1791
            GE G  VR+    EE+++     N +  + Y SD+IS+ R L +  +P C+  KY  + LP+ SV+I F+ E WS L+RTV SV+  +P  L+ E+ILVDD S +  L+  LE ++     + +++R   R+GL+R R+LGA  A GDVL FLD H E +V WL PLLE IA+    V CP IDVI ++TFEY+ +  E   G FDW   F +  +P  +      P D   SP MAGGLFA+S+K+F  LG YD G+++WGGE  E SF++WQCGG +   PCS +GHV+ K +P+  +        N  R AEVWMD +KE  Y R P  R E   ++T +  +RE+L CK F WF++ V  D+     + E  P   G +K    +N   C D+   D   V G    L   H  G  Q F  + + EI+   R  + C    + +    + ++ CH        NQ F ++ E   I  + +  CLE    P S  + L    +  T Q+W++
Sbjct:   28 GEMGKAVRLNLEGEEKRKEEESINKHQINIYVSDRISLHRQLPEKWNPLCREKKYNYRQLPTTSVVIAFYNEAWSTLLRTVHSVLETSPDALLNEIILVDDYSDREHLRDRLEQYIATLRKV-RLVRARKREGLVRARLLGAGVATGDVLTFLDCHCECHVGWLEPLLERIAEEESAVVCPVIDVIEWNTFEYMGNAGEPQIGGFDWRLVFTWHTVPGHEQKRRKSPIDVIRSPTMAGGLFAVSKKYFDYLGTYDTGMEVWGGENLEFSFRIWQCGGTLEVHPCSHVGHVFPKQAPYSRSKA----LANSVRAAEVWMDGYKELYYHRNPHARMEPFGDVTERRNLRERLQCKTFKWFLENVYPDI----HVPEDRPGKFGMLKNRGLSN--YCFDYNPPDENQVTGQRIILYGCHGMGQNQFFEYTSEQEIRYNTRQPEACAAVDNGM--DYLTMYYCHSKNSPVTENQKFDFR-EDGSIFHILTQKCLEAVEQPNSGPLPLLRTCDGNTRQRWLF 530          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Sea Lamprey
Match: galnt2 (UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 2 [Source:ZFIN;Acc:ZDB-GENE-041111-110])

HSP 1 Score: 289.271 bits (739), Expect = 3.653e-92
Identity = 167/416 (40.14%), Postives = 232/416 (55.77%), Query Frame = 1
Query:  427 CKTLKYLKSLPSVSVIIPFHQEHWSPLIRTVDSVIRRAPLGLIKEVILVDDASRKPFLQKTLEIFLKEHYPIAKVLRTNGRQGLIRTRVLGAKEAIGDVLIFLDSHSEANVNWLPPLLEPIAKNYKTVTCPFIDVINYDTFEYLSQDEGARGIFDWN----FDYKRIPRFKSDESHPADPFESPVMAGGLFAISRKWFWELGGYDEGLDIWGGE------QYEISFKLWQCGGKMLDIPCSRIGHVYRKYSP--FPNNAKGNFISRNFKRVAEVWMDEFKEYLYLRRPTIRNEDPLNLTNQFAIREKLHCKNFSWFMKEVAFDLVNNYP-LIEPNPVCSGEIKLSNPNNVSVCIDFKFRDSGYVVGLSPCLSVNHKEGGEQNFILSWKGEIKPKDRDMCMDSSDHIPGGSVLLFKC 1635
            C+   +  SLP+ SVII FH E  S L+RTV SV+ ++P  LI+E+ILVDD S  P   K L    K      K +R   R+GL+R+RV GA  A   +L FLDSH E N +WL PLLE +A++   V CP IDVIN D F+Y+      +G F+WN    +DY    + K+ ++ P  P  +P++AGGLF + + +F ELG YD  +DIWGGE      + EISF++WQCGG +  IPCSR+GHV+RK  P  FP  + G   +RN +R AEVWMDE+K + Y   P+ R+    N+  +  +REKL CK F W++  V       YP L  P+     ++        + C+D     +   VG+  C    H  GG Q +  +   E   K  D+C+  +D IPGG + L  C
Sbjct:    1 CRYQTWGPSLPATSVIITFHNEARSTLLRTVVSVLNKSPAHLIREIILVDDYSDDPEDGKLLAKIEK-----VKTIRNEKREGLMRSRVRGADIAESAILTFLDSHCECNEHWLEPLLERVAEDRTRVVCPIIDVINMDNFQYVGASADLKGGFEWNLVFKWDYLTPEQRKARQTTPTSPIRTPMIAGGLFVMEKAYFEELGKYDMMMDIWGGENLGSAPRAEISFRVWQCGGSLEIIPCSRVGHVFRKQHPYSFPGGS-GTVFARNTRRAAEVWMDEYKNFYYAAVPSARSVSFGNIQGRLELREKLKCKPFKWYLDNV-------YPELRVPD---KQDVAFGALQQGANCLDTMGHFADGTVGVYEC----HNAGGNQEWAFT--KEKSLKHIDLCLTVTDRIPGGLLKLQVC 394          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Nematostella
Match: EDO31035 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZ28])

HSP 1 Score: 400.593 bits (1028), Expect = 2.144e-134
Identity = 207/466 (44.42%), Postives = 297/466 (63.73%), Query Frame = 1
Query:  280 GPGEQGSGVRIPKAEEEEQQRIYKENGYDGYASDKISIQRSLRDIRHPACKTLKYLKSLPSVSVIIPFHQEHWSPLIRTVDSVIRRAPLGLIKEVILVDDASRKPFLQKTLEIFLKEHYPIAKVLRTNGRQGLIRTRVLGAKEAIGDVLIFLDSHSEANVNWLPPLLEPIAKNYKTVTCPFIDVINYDTFEYLSQDEGARGIFDWNFDYKRI---PRFKSDESHPADPFESPVMAGGLFAISRKWFWELGGYDEGLDIWGGEQYEISFKLWQCGGKMLDIPCSRIGHVYRKYSPFPNNAKGNFISRNFKRVAEVWMDEFKEYLYLRRPTIRNEDPLNLTNQFAIREKLHCKNFSWFMKEVAFDLVNNYPLIEPNPVCSGEIKLSNPNNVSVCIDFKFRDSGYVVGLSPCLSVNHKEGGEQNFILSWKGEIKPKDRDMCMDSSDHIPGGSVLLFKCHGGRGNQFFKY 1668
            GPGE G  V     +E ++   Y E G++ + SD+IS++R++ D RH ACK   Y  +LP  SV+I FH E WS L+RTV +V+ R+P  +++E+++VDD S K FL++ L+ + K+   I K++RT  R GLI+ RV+GA  A+G+V+IFLD+H E N  WLPPLLE IA N +T  CP ID I++ TF+Y   D   RG F+W FDYK     P   +    P    +SPVMAGGLFAI+R++F ELG YD G+ IWGGEQYEISFKLWQCGG++ +IPCSR+GHVYR + P+    K +    NF+RVAEVWMDE+K++LY +RP I++ D  +++++ A+R++L CK+F W+++ VA D V          +C+   ++ N    ++C+D   R  G+ VGL+ C    H  GG Q F  ++  E++    + C D  +  PG  V  F CH  +GNQ F +
Sbjct:    1 GPGENGEPVETKAEDESKKDAAYSEFGFNQFVSDQISLERTISDTRHQACKQRSYPINLPKASVVIVFHNEGWSTLMRTVHTVLLRSPPHMLQEIVMVDDFSNKDFLKQKLDDYTKKLGKI-KIVRTKERVGLIKARVIGANNAVGEVVIFLDAHCECNKGWLPPLLERIALNRRTAVCPTIDFIDHKTFQYKPMDPYIRGTFNWRFDYKERAVRPEEMAKRRDPTQEVKSPVMAGGLFAINREFFSELGQYDPGMFIWGGEQYEISFKLWQCGGQLENIPCSRVGHVYRHHVPY-TYPKHDATLVNFRRVAEVWMDEYKDWLYDKRPEIKSVDYGDISDRIALRKRLKCKSFKWYLENVANDTVK-------TKLCAC-FQVRNQGK-NMCLDSMGRKDGH-VGLASC----HNMGGNQAFQYTYIRELRTD--ETCFDVHESFPGAKVHFFPCHEMKGNQEFLF 448          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Nematostella
Match: EDO45829 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRV7])

HSP 1 Score: 342.043 bits (876), Expect = 7.788e-111
Identity = 198/523 (37.86%), Postives = 302/523 (57.74%), Query Frame = 1
Query:  277 RGPGEQGSGVRIPKAEEEEQQRI----YKENGYDGYASDKISIQRSLRDIRHPACKTL--KYLKSLPSVSVIIPFHQEHWSPLIRTVDSVIRRAPLGLIKEVILVDDASRKPFLQKTLEIFLKEHYPIAKVLRTNGRQGLIRTRVLGAKEAIGDVLIFLDSHSEANVNWLPPLLEPIAKNYKTVTCPFIDVINYDTFEYL-SQDEGARGIFDWN--FDYKRIP----RFKSDESHPADPFESPVMAGGLFAISRKWFWELGGYDEGLDIWGGEQYEISFKLWQCGGKMLDIPCSRIGHVYRKYSP---FPNNAKGNFISRNFKRVAEVWMDEFKEYLYLRRPTIRNEDPLNLTNQFAIREKLHCKNFSWFMKEVAFDLVNNYPLIEPNPVCSGEIKLSNPNNVSVCIDFKFRDSGYVVGLSPCLSVNHKEGGEQNFILSWKGEIKPKDRDMCMDSSDHIPGGSVLLFKCHGGRGNQFFKYKLESQQILFVNSGFCLE-GDPASKHIALQTCNETITDQKWIWT 1794
            R   + G G +    E EE +++    +  + ++   SDKIS+ R+L D+R   CK     Y   LP+ SVII FH+E  S L+RTV SVI R P  L+ EVI+VDD S+   L K L+  + + +   KVLR   R+GL+R R+ GA  A GDVL FLDSH EA   W  PLL  IA + + V CP I+VIN DTF Y  S +   RG F W+  F +K IP    + ++D+S   DP  +P MAGGLF+I R++F+++G YDE +DIWGGE  E+SF++W CGG++  + CSR+GHV+RKY+    FP+  +   +++NF R+AEVWMDE+K+  Y ++P  +N D  +++ +  +R++L CK+F W++  +  D+     + E +P   GE++  + N     +  K   +   VG+  C    H +GG Q  +  +       + + C D S   PG  V L KCHG RGNQ +K+  E   ++   +  CL+ G P+ ++  +  C+   + Q+W+++
Sbjct:    2 RNTHQLGGGGKPAFLESEENKKLAEKYFANHSFNWLLSDKISLDRTLDDVRSERCKAKHNTYPAKLPTTSVIICFHKERLSVLLRTVHSVINRTPPELLAEVIVVDDFSQDAKLGKPLDDHVAQ-FTKVKVLRMKKREGLVRARLQGANTAKGDVLTFLDSHCEATPGWAEPLLARIAADRRNVVCPAIEVINADTFAYQGSTNADQRGGFSWDLFFKWKGIPPEEQKLRNDDS---DPIRTPTMAGGLFSIHRQYFFDIGSYDEEMDIWGGENLELSFRVWMCGGRLEIVTCSRVGHVFRKYTSPYKFPDGVE-RTLTKNFNRLAEVWMDEYKDLYYNKKPQAKNSDYGDISKRLELRKRLKCKSFKWYINNIYPDV----QMPELDPPARGEVRNPSSNQCLDSLGAKPEHNAR-VGIYTC----HGQGGNQ--VSKYMPRELIFEEENCFDVSKTHPGAPVELMKCHGMRGNQEWKHDREKGTLMHFTTQQCLDRGSPSDQYAVMNPCDGRES-QRWVFS 507          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Nematostella
Match: EDO37266 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SG81])

HSP 1 Score: 338.961 bits (868), Expect = 9.149e-110
Identity = 200/512 (39.06%), Postives = 294/512 (57.42%), Query Frame = 1
Query:  280 GPGEQGSGVRIPKAEEEEQQRIYKENGYDGYASDKISIQRSLRDIRHPACKTLK--YLKSLPSVSVIIPFHQEHWSPLIRTVDSVIRRAPLGLIKEVILVDDASRKPFLQKTLEIFLKEHYPIAKVLRTNGRQGLIRTRVLGAKEAIGDVLIFLDSHSEANVNWLPPLLEPIAKNYKTVTCPFIDVINYDTFEYLSQDE-GARGIFDWN--FDYKRIPRF-KSDESHPADPFESPVMAGGLFAISRKWFWELGGYDEGLDIWGGEQYEISFKLWQCGGKMLDIPCSRIGHVYRKYSP---FPNNAKGNFISRNFKRVAEVWMDEFKEYLYLRRP-TIRNEDPLNLTNQFAIREKLHCKNFSWFMKEVAFDLVNNYPLIEPNPVCSGEIKLSNPNNVSVCIDFKFRDSGYVVGLSPCLSVNHKEGGEQNFILSWKGEIKPKDRDMCMDSSDHIPGGSVLLFKCHGGRGNQFFKYKLESQQILFVNSGFCLEGDPASKHIALQTCNETITDQKW 1785
            G G+ G    +P   +E     +  + ++   SD+IS+ R L+D+R P CK     Y ++LP+ SVII FH E  S L+RTV SV+  +P  LI ++ILVDD S    L++ L   +     + K++R   RQGL+  R+ GA+EA G+VL FLDSH EA   WL PLL  IA++ + V CP I+VIN D F Y + D    RG F W+  F +K IP   K       D   SP MAGGLFAI +K+F++LG YD  ++IWGGE  E+SF++W CGG++  +PCSR+GHV+RKY+    FP       ++RNF R+AEVWMDE+K++ Y ++    RN D  +++++ A+R++L CK+F W++  +  D+ N  P    + + S +I+       S+C+D     +   VGL  C    H  GG Q F L+   EI   D D C+DS +  PG  V +  CHG +GNQ +K+      I+ V +  CL+     + I +  C+ + T Q+W
Sbjct:    1 GLGDLGEAATLPTRFKEHAAHAFDNHSFNVMLSDRISLDRRLKDVRGPKCKRKHKLYPRALPTTSVIICFHNEALSVLLRTVHSVLNESPPRLIADIILVDDYSEYDDLKQPLIDHISMLNKV-KLIRMPSRQGLVPARLRGAEEARGEVLTFLDSHCEATPGWLEPLLVRIAEDRRNVVCPVIEVINADDFRYQASDVIHERGGFTWDLFFTWKAIPEAEKKRRKDETDYIRSPTMAGGLFAIHKKYFYDLGSYDSKMEIWGGENLEMSFRIWMCGGQLEIVPCSRVGHVFRKYTSPYKFPKGTTTT-LARNFNRLAEVWMDEYKDHYYRKKTEEERNVDIGDISDRVALRKRLGCKSFKWYLDNIYPDMTNKLP--PKSYLYSHQIR---NKESSLCLDTLGEKNIKRVGLYTC----HGMGGNQFFTLTKSNEILFND-DKCLDSPNGDPGSYVEMITCHGLKGNQEWKHNKRMGTIVHVWTENCLDISQDGQFIIVNPCDGSST-QRW 499          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Nematostella
Match: EDO30269 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T197])

HSP 1 Score: 330.102 bits (845), Expect = 1.597e-106
Identity = 190/501 (37.92%), Postives = 271/501 (54.09%), Query Frame = 1
Query:  328 EEQQRIYKENGYDGYASDKISIQRSLRDIRHPACKTLKYLKSLPSVSVIIPFHQEHWSPLIRTVDSVIRRAPLGLIKEVILVDDASRKPFLQKTLEIFLKEHYPIAKVLRTNGRQGLIRTRVLGAKEAIGDVLIFLDSHSEANVNWLPPLLEPIAKNYKTVTCPFIDVINYDTFEYLSQDEGARGIFDWNFDYK---RIPRFK-SDESHPADPFESPVMAGGLFAISRKWFWELGGYDEGLDIWGGEQYEISFKLWQCGGKMLDIPCSRIGHVYRKYSP--FPNNAKGNFISRNFKRVAEVWMDEFKEYLYLRRPTIRNEDPLNLTNQFAIREKLHCKNFSWFMKEVAFDLVNNYPLIEPNPVCSGEIKLSNPNNVSVCIDFKFRDSGYVVGLSPCLSVNHKEGGEQNFILSWKGEIKPKDRDMCMDSSDHIPGGSVLLFKCHGGRGNQFFKYKLESQQILFVNSGFCLEGDPASK--HIALQTCNETITDQKWIWTSVNM 1806
            +E +  Y +N ++   SDKI   R + D RH  C+   Y  +LP+ S+II FH E  S L+RTV S++ + P  L+ E+ILVDD     F     +  L    P  KVLR N RQGLIR+RV G+  A  DVL FLDSH E N +WL PLL+ + +N K V  P IDVIN D F Y+      +G FDW+  +K     P  K S  S P  P ++P++AGGLF +++ WF E+G YD  +DIWGGE +EISF+ WQCGG M  IPCSR+GHV+RK  P  FP+     ++ +N +R AEVWMDE+K + Y  RP  R+    ++ ++  +R++L CK F W+++ V  +L     + +   V  GE+K         C+D     +G  VG+  C    H + G Q + L+ K  ++  D  + + S     GG+V L  C  G   Q ++       +    SG CL+   A    H+  + C      Q W + S+NM
Sbjct:   15 KEGEDAYGKNQFNQAISDKIGGDRDVPDTRHSHCRYEAYPSTLPATSIIITFHNEARSTLLRTVKSILNKTPPNLVNEIILVDD-----FSDDAEDGLLLMGLPKVKVLRNNKRQGLIRSRVKGSDTAKSDVLTFLDSHCECNTDWLQPLLKRVVQNKKAVVSPIIDVINMDDFSYIGASADIKGGFDWSLHFKWDNLTPEQKQSRRSTPIAPIKTPMIAGGLFVVTKSWFEEMGKYDTMMDIWGGENFEISFRTWQCGGSMEIIPCSRVGHVFRKRHPYTFPDGNANTYM-KNTRRTAEVWMDEYKRFYYAARPMARSALYGSIKSRKELRKRLQCKPFKWYLQNVYPEL----QIPDSQDVSFGELKQGKS-----CLDTLGSQAGGSVGMFDC----HGQAGNQEWALTKKSTVRHLDLCLTLGS-----GGAVTLEGCRDGDPKQIWEQTSPQHTLRHKQSGLCLDSKEAKSGGHVRGEHCKRGEFAQIWQF-SLNM 490          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Nematostella
Match: EDO34355 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPN9])

HSP 1 Score: 323.553 bits (828), Expect = 9.313e-104
Identity = 180/507 (35.50%), Postives = 286/507 (56.41%), Query Frame = 1
Query:  346 YKENGYDGYASDKISIQRSLRDIRHPACKTLKYLKSLPSVSVIIPFHQEHWSPLIRTVDSVIRRAPLGLIKEVILVDDASRKPFLQKTLEIFLKEHYPIAKVLRTNGRQGLIRTRVLGAKEAIGDVLIFLDSHSEANVNWLPPLLEPIAKNYKTVTCPFIDVINYDTFEYLSQDEGARGIFDWNFDYKRIPRFKSDESHPAD---PFESPVMAGGLFAISRKWFWELGGYDEGLDIWGGEQYEISFKLWQCGGKMLDIPCSRIGHVYRKYSPFPNNAKGNFISRNFKRVAEVWMDEFKEYLYLRRPTIRNEDPLNLTNQFAIREKLHCKNFSWFMKEV-------------AFDLVNNYPLI---EPNPVCSGEIKLSNPNNVSVCIDFKFRDSGYVVGLSPCLSVNHKEGGEQNF-ILSWKGEIKPKDRDMCMDSSDHIPGGSVLLFKCHGGRGNQFFKYKLESQQILFVNSGFCLEGDPASKHI--ALQTCNETITDQKWIWTSV 1800
            Y  +G++   S+++S+ R+++D RH  C+   Y K+LP  S++I F+ E W+ L+RT+ SV+ R P   + E+ILVDD S    L+  L+ +L    P  +++R N R+GLIR R++GA+ A G VL+FLDSH E N+NWL PLL+ I  + K V CP IDVI+ DTFEY S     RG F+W   +   P   S    P D   P  SP MAGGLFA+ R++F +LG YD G+DIWG E  EISF++W CGG +  +PCSR+GH++R++ P+ +++KG+ +SRN  R+AEVW+D +K+Y Y  R  +  +   +++ +  +R+ L CK+F W++K +             AF  ++  P +   +   +C   I+L    +   C+D      G+         ++  E  +  F  L+  GE+K +   +C+++S +     + L KCH   G Q +K+  +   +    +G CL  + +  +    +Q C+ +I  Q   WT V
Sbjct:   18 YSAHGFNLLISNRLSLHRTIKDTRHELCRGKTYPKNLPVASIVICFYNEAWTILLRTIHSVLDRTPHQFLHEIILVDDFSNMLELKSKLDRYLST-MPKIRIVRNNKREGLIRGRIIGAEAATGQVLVFLDSHCEVNINWLQPLLQHIHDDQKAVACPVIDVISSDTFEY-SSSPMVRGGFNWGLHFTWEPIPPSLLVKPEDYVKPIRSPTMAGGLFAVDREYFTQLGKYDSGMDIWGAENLEISFRIWMCGGSLDILPCSRVGHLFRRFRPYGSDSKGDTMSRNSMRLAEVWLDGYKKYFYQIRHDLEGKKFGDISQRIKLRKSLQCKSFEWYLKNIYPELKPPGQPGGGAFYPIDRRPQVVIWKGKVIC---IQLQTSFDDGYCLD----SPGHPSEKKASAVIHQCESTKSRFWSLNEDGELKIESL-LCLEASGYQSKLGLRLMKCHAQGGGQQWKFLNKKSVLYHPATGLCLGVNESRTYSTPGMQICDYSIHQQ---WTFV 511          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Medaka
Match: GALNT10 (polypeptide N-acetylgalactosaminyltransferase 10 [Source:NCBI gene;Acc:101171188])

HSP 1 Score: 500.36 bits (1287), Expect = 8.345e-171
Identity = 268/610 (43.93%), Postives = 370/610 (60.66%), Query Frame = 1
Query:   43 RFKLKNFLKFA--CFAALVYL-------IVNSVYFRNPNSIENSSNVATTQSVELSTEELLISTSEHLESNLVDWHNYTQIEEELKRRGPGEQGSGVRIPKAEEEEQQRIYKENGYDGYASDKISIQRSLRDIRHPACKTLKYLKSLPSVSVIIPFHQEHWSPLIRTVDSVIRRAPLGLIKEVILVDDASRKPFLQKTLEIFLKEHYPIAKVLRTNGRQGLIRTRVLGAKEAIGDVLIFLDSHSEANVNWLPPLLEPIAKNYKTVTCPFIDVINYDTFEYLSQ-DEGARGIFDWNFDYKRIP-RFKSDESHPADPFESPVMAGGLFAISRKWFWELGGYDEGLDIWGGEQYEISFKLWQCGGKMLDIPCSRIGHVYRKYSPFPNNAKGNFISRNFKRVAEVWMDEFKEYLYLRRPTIRNEDPLNLTNQFAIREKLHCKNFSWFMKEVAFDLVNNYPLIEPNPVCSGEIKLSNPNNVSVCIDFKFRDSGYVVGLSPCLS--VNHKEGGEQNFILSWKGEIKPKD----RDMCMDS-SDHIPGGSVLLFKCHGGRGNQFFKYKLESQQILFVNSGFCLEGDPASKHIALQTCNETITDQKWIWTSVNMTELK 1818
            R K K  L+ A    AAL++L       +     F N    +    +   Q V     + L+      +    DWH+Y  I  +  R G GEQG    +  A+  +Q   Y+ENG++ + SD+IS+ RS+ DIRHP CK   Y + LP+ S+IIPFH E WS L+RTV SV+ R+P  LI E+ILVDD S K  L+  LE ++    P  ++LRT  R+GLIRTR+LGA  A G+V+ FLDSH EAN+NWLPPLL+ IA N KT+ CP IDVI++D F Y +Q  +  RG FDW   YKRIP   +  ++ P++PFESPVMAGGLFA+ RKWFWELGGYD GL+IWGGEQYEISFK+W CGG+M DIPCSR+GH+YRKY P+     G  ++RN KRVAEVWMDE+ EY+Y RRP  R+    ++  Q  +R  L+CK+F WFMKEVA+DL  +YP +EP     GE++ +      +C++ K   SG  + L  C+    +   G  Q F   W+ +I+  D    + +C D+ S H P   V L+ CHG RGNQ ++Y+ + + +    S  C++ + + + + +  CN     Q+W++   N T L+
Sbjct:    2 RRKEKRLLQVAGLLIAALLFLPNVGLWSLYRDRVFDNSPDTDGPRGIPAIQGVNRMGRDSLVGLGGTRKK---DWHDYEAIRRDATRSGNGEQGKAFPLTDADRVDQA--YRENGFNIFVSDRISLNRSVPDIRHPNCKQKLYAERLPNTSIIIPFHNEGWSSLLRTVHSVLNRSPPQLIAEIILVDDFSDKDHLKGALEEYMVR-LPKVRILRTKKREGLIRTRLLGAAAAKGEVITFLDSHCEANINWLPPLLDRIALNRKTIVCPMIDVIDHDNFGYETQAGDAMRGAFDWEMYYKRIPIPAELQKNDPSEPFESPVMAGGLFAVDRKWFWELGGYDTGLEIWGGEQYEISFKVWMCGGRMEDIPCSRVGHIYRKYVPY-KVPGGVSLARNLKRVAEVWMDEYAEYVYQRRPEYRHLSAGDVAAQKELRSTLNCKSFKWFMKEVAWDLPKHYPPVEPPAAAWGEVRSAAS---GLCLESKHFVSGTPIRLESCVKGRADVSWGHGQVFTFGWREDIRVGDPMHTKKVCFDAVSHHSP---VTLYDCHGMRGNQLWRYR-KDKSLYHPVSNSCVDSNASERRVFMNVCNPASASQQWLFEKTNATVLE 597          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Medaka
Match: GALNT10 (polypeptide N-acetylgalactosaminyltransferase 10 [Source:NCBI gene;Acc:101160340])

HSP 1 Score: 500.36 bits (1287), Expect = 9.713e-171
Identity = 271/615 (44.07%), Postives = 379/615 (61.63%), Query Frame = 1
Query:   43 RFKLKNFLKFACFAALVYLIVNSV----YFRNPNSIENSSNVATTQSVELSTEELLISTSEHLESNLV---DWHNYTQIEEELKRRGPGEQGSGVRIPKAEEEEQQRIYKENGYDGYASDKISIQRSLRDIRHPACKTLKYLKSLPSVSVIIPFHQEHWSPLIRTVDSVIRRAPLGLIKEVILVDDASRKPFLQKTLEIFLKEHYPIAKVLRTNGRQGLIRTRVLGAKEAIGDVLIFLDSHSEANVNWLPPLLEPIAKNYKTVTCPFIDVINYDTFEYLSQ-DEGARGIFDWNFDYKRIP---RFKSDESHPADPFESPVMAGGLFAISRKWFWELGGYDEGLDIWGGEQYEISFKLWQCGGKMLDIPCSRIGHVYRKYSPFPNNAKGNFISRNFKRVAEVWMDEFKEYLYLRRPTIRNEDPLNLTNQFAIREKLHCKNFSWFMKEVAFDLVNNYPLIEPNPVCSGEIKLSNPNNVSVCIDFKFRDSGYVVGLSPCL----SVNHKEGGEQNFILSWKGEIKPKD----RDMCMDS-SDHIPGGSVLLFKCHGGRGNQFFKYKLESQQILFVNSGFCLEGDPASKHIALQTCNETITDQKWIWTSVNMTELKKLH 1827
            R + K  L+ A       L + +V     +R+   +ENS + A    V  ST++ L      + S+ V   DWH+Y  +  +  R G GEQG     P  E +   + Y+ENG++ Y S++IS+ RSL DIRH  C+   Y + LP+ ++IIPFH E WS L+RTV SVI R+P  L+ E+ILVDD S K  L+  LE ++K  +P  ++LRT  R+GLIRTR+LGA  A G+V+ FLDSH EANVNWLPPLL+ I +N KT+ CP IDVI++D F Y +Q  +  RG FDW   YKRIP     ++D+  P +PFESPVMAGGLFA+ RKWFWELGGYD GL+IWGGEQYEISFK+W CGG+M DIPCSR+GH+YRKY P+     G  +++N KRVAEVWMDE+ EY+Y RRP  R+    +++ Q  +R  L+CKNF WFM+EVA+DL  +YP +EP     GEI+        +C++ K   SG  + L  C+     V+   G  Q     W+ +I+  D    R +C D+ S H P   V L+ CHG +GNQ ++Y+ + + +    S  C++   + + + + TC+ T   Q+W++   N T L++ +
Sbjct:    2 RRREKRLLQVAGLLVAAVLFLPNVGLWSLYRD-RVLENSPDAADGSGV-FSTKQGLHQKVAQVGSDGVRRIDWHDYKAMRRDAARAGNGEQGKP--FPVTETDRVDQAYRENGFNIYVSNRISLNRSLPDIRHENCRQKLYAEKLPNTTIIIPFHNEGWSSLLRTVHSVINRSPPRLVAEIILVDDFSDKEHLKVALEEYMKR-FPKVRILRTKKREGLIRTRLLGAGAAKGEVITFLDSHCEANVNWLPPLLDRIVQNRKTIVCPMIDVIDHDNFGYDTQAGDAMRGAFDWEMYYKRIPIPAEMRTDD--PTEPFESPVMAGGLFAVDRKWFWELGGYDTGLEIWGGEQYEISFKVWMCGGRMEDIPCSRVGHIYRKYVPY-KVPGGISLAKNLKRVAEVWMDEYAEYVYQRRPEYRHLSAGDMSAQKELRSHLNCKNFRWFMEEVAWDLPKHYPPVEPPAAAWGEIRSVGS---GMCMEIKHFVSGSPIRLESCVKGRGDVSWSHG--QVLTFGWREDIRVGDPMHTRKVCFDAVSHHSP---VTLYDCHGMKGNQLWRYR-KDKSLFHPVSNSCIDSSASERRVFMNTCDPTSLSQQWLFERTNDTVLERFN 599          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Medaka
Match: galnt13 (polypeptide N-acetylgalactosaminyltransferase 13 [Source:NCBI gene;Acc:101172857])

HSP 1 Score: 375.941 bits (964), Expect = 5.783e-123
Identity = 210/523 (40.15%), Postives = 298/523 (56.98%), Query Frame = 1
Query:  280 GPGEQGSGVRIPKAEEEEQQRIYKENGYDGYASDKISIQRSLRDIRHPACKTLKYLKSLPSVSVIIPFHQEHWSPLIRTVDSVIRRAPLGLIKEVILVDDASRKPFLQKTLEIFLKEHYPIAKVLRTNGRQGLIRTRVLGAKEAIGDVLIFLDSHSEANVNWLPPLLEPIAKNYKTVTCPFIDVINYDTFEYLSQDEGARGIFDWNFDYKRIP-------RFKSDESHPADPFESPVMAGGLFAISRKWFWELGGYDEGLDIWGGEQYEISFKLWQCGGKMLDIPCSRIGHVYRKYSP--FPNNAKGNFISRNFKRVAEVWMDEFKEYLYLRRPTIRNEDPLNLTNQFAIREKLHCKNFSWFMKEVAFDLVNNYP--LIEPNPVCSGEIKLSNPNNVSVCIDFKFRDSGYVVGLSPCLSVNHKEGGEQNFILSWKGEIKPKDRDMCMDSSDHIPGGSVLLFKCHGGRGNQFFKYKLESQQILFVNSGFCLEGDPASKHI--ALQTCNETITDQKWIWTSVNMT 1809
            GPGE G  V I K ++E+ + ++K N ++  ASD I++ RSL D+R   CKT  Y   LP+ S++I FH E WS L+RTV SVI R+P  L+ E++LVDDAS + FL+K LE +++      K+LR   R GLIR R+ GA    G V+ FLD+H E    WL PLL  I ++   V CP IDVI+ +TFEY++  +   G F+W  +++  P       R K D + P     +P MAGGLF+I + +F E+G YD G+DIWGGE  E+SF++WQCGG +  + CS +GHV+RK +P  FP    G  I++N +R+AEVWMDEFK++ Y+  P +   D  +++++ A+RE L CK F+W+++       N YP   I       GEI+    N    C+D   R     VG   C    H  GG Q F  +   EI+    D+C+D S     G V++ KCH  +GNQ F+Y  E   +L VNS  CL+       +   L+ CN + + Q   W   NMT
Sbjct:   56 GPGEMGKAVNIAKDDQEKMKELFKINQFNLMASDMIALNRSLPDVRLDGCKTKVYADDLPTTSIVIVFHNEAWSTLLRTVHSVISRSPRHLLVEIVLVDDASERDFLKKKLEGYVRTLEVPVKILRMEQRSGLIRARLRGAAATTGQVITFLDAHCECTEGWLEPLLARIKEDRTAVVCPIIDVISDETFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPV---RTPTMAGGLFSIDKMYFEEIGSYDPGMDIWGGENLEMSFRIWQCGGSLEIVTCSHVGHVFRKATPYSFPGGT-GQVINKNNRRLAEVWMDEFKDFFYIISPGVMRVDYGDVSSRKALREALKCKPFAWYLE-------NIYPDSQIPRRYYSLGEIRNVETNQ---CVDNMGRKENEKVGFFNC----HGMGGNQVFSYTADKEIRTD--DLCLDVSRL--NGPVVMLKCHHMKGNQMFEYDAERLTLLHVNSNQCLDMPSEEDKMVPTLRDCNGSRSQQ---WLLRNMT 553          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Medaka
Match: galnt13 (polypeptide N-acetylgalactosaminyltransferase 13 [Source:NCBI gene;Acc:101172857])

HSP 1 Score: 375.941 bits (964), Expect = 5.783e-123
Identity = 210/523 (40.15%), Postives = 298/523 (56.98%), Query Frame = 1
Query:  280 GPGEQGSGVRIPKAEEEEQQRIYKENGYDGYASDKISIQRSLRDIRHPACKTLKYLKSLPSVSVIIPFHQEHWSPLIRTVDSVIRRAPLGLIKEVILVDDASRKPFLQKTLEIFLKEHYPIAKVLRTNGRQGLIRTRVLGAKEAIGDVLIFLDSHSEANVNWLPPLLEPIAKNYKTVTCPFIDVINYDTFEYLSQDEGARGIFDWNFDYKRIP-------RFKSDESHPADPFESPVMAGGLFAISRKWFWELGGYDEGLDIWGGEQYEISFKLWQCGGKMLDIPCSRIGHVYRKYSP--FPNNAKGNFISRNFKRVAEVWMDEFKEYLYLRRPTIRNEDPLNLTNQFAIREKLHCKNFSWFMKEVAFDLVNNYP--LIEPNPVCSGEIKLSNPNNVSVCIDFKFRDSGYVVGLSPCLSVNHKEGGEQNFILSWKGEIKPKDRDMCMDSSDHIPGGSVLLFKCHGGRGNQFFKYKLESQQILFVNSGFCLEGDPASKHI--ALQTCNETITDQKWIWTSVNMT 1809
            GPGE G  V I K ++E+ + ++K N ++  ASD I++ RSL D+R   CKT  Y   LP+ S++I FH E WS L+RTV SVI R+P  L+ E++LVDDAS + FL+K LE +++      K+LR   R GLIR R+ GA    G V+ FLD+H E    WL PLL  I ++   V CP IDVI+ +TFEY++  +   G F+W  +++  P       R K D + P     +P MAGGLF+I + +F E+G YD G+DIWGGE  E+SF++WQCGG +  + CS +GHV+RK +P  FP    G  I++N +R+AEVWMDEFK++ Y+  P +   D  +++++ A+RE L CK F+W+++       N YP   I       GEI+    N    C+D   R     VG   C    H  GG Q F  +   EI+    D+C+D S     G V++ KCH  +GNQ F+Y  E   +L VNS  CL+       +   L+ CN + + Q   W   NMT
Sbjct:   56 GPGEMGKAVNIAKDDQEKMKELFKINQFNLMASDMIALNRSLPDVRLDGCKTKVYADDLPTTSIVIVFHNEAWSTLLRTVHSVISRSPRHLLVEIVLVDDASERDFLKKKLEGYVRTLEVPVKILRMEQRSGLIRARLRGAAATTGQVITFLDAHCECTEGWLEPLLARIKEDRTAVVCPIIDVISDETFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPV---RTPTMAGGLFSIDKMYFEEIGSYDPGMDIWGGENLEMSFRIWQCGGSLEIVTCSHVGHVFRKATPYSFPGGT-GQVINKNNRRLAEVWMDEFKDFFYIISPGVMRVDYGDVSSRKALREALKCKPFAWYLE-------NIYPDSQIPRRYYSLGEIRNVETNQ---CVDNMGRKENEKVGFFNC----HGMGGNQVFSYTADKEIRTD--DLCLDVSRL--NGPVVMLKCHHMKGNQMFEYDAERLTLLHVNSNQCLDMPSEEDKMVPTLRDCNGSRSQQ---WLLRNMT 553          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Medaka
Match: galnt13 (polypeptide N-acetylgalactosaminyltransferase 13 [Source:NCBI gene;Acc:101172857])

HSP 1 Score: 375.941 bits (964), Expect = 5.783e-123
Identity = 210/523 (40.15%), Postives = 298/523 (56.98%), Query Frame = 1
Query:  280 GPGEQGSGVRIPKAEEEEQQRIYKENGYDGYASDKISIQRSLRDIRHPACKTLKYLKSLPSVSVIIPFHQEHWSPLIRTVDSVIRRAPLGLIKEVILVDDASRKPFLQKTLEIFLKEHYPIAKVLRTNGRQGLIRTRVLGAKEAIGDVLIFLDSHSEANVNWLPPLLEPIAKNYKTVTCPFIDVINYDTFEYLSQDEGARGIFDWNFDYKRIP-------RFKSDESHPADPFESPVMAGGLFAISRKWFWELGGYDEGLDIWGGEQYEISFKLWQCGGKMLDIPCSRIGHVYRKYSP--FPNNAKGNFISRNFKRVAEVWMDEFKEYLYLRRPTIRNEDPLNLTNQFAIREKLHCKNFSWFMKEVAFDLVNNYP--LIEPNPVCSGEIKLSNPNNVSVCIDFKFRDSGYVVGLSPCLSVNHKEGGEQNFILSWKGEIKPKDRDMCMDSSDHIPGGSVLLFKCHGGRGNQFFKYKLESQQILFVNSGFCLEGDPASKHI--ALQTCNETITDQKWIWTSVNMT 1809
            GPGE G  V I K ++E+ + ++K N ++  ASD I++ RSL D+R   CKT  Y   LP+ S++I FH E WS L+RTV SVI R+P  L+ E++LVDDAS + FL+K LE +++      K+LR   R GLIR R+ GA    G V+ FLD+H E    WL PLL  I ++   V CP IDVI+ +TFEY++  +   G F+W  +++  P       R K D + P     +P MAGGLF+I + +F E+G YD G+DIWGGE  E+SF++WQCGG +  + CS +GHV+RK +P  FP    G  I++N +R+AEVWMDEFK++ Y+  P +   D  +++++ A+RE L CK F+W+++       N YP   I       GEI+    N    C+D   R     VG   C    H  GG Q F  +   EI+    D+C+D S     G V++ KCH  +GNQ F+Y  E   +L VNS  CL+       +   L+ CN + + Q   W   NMT
Sbjct:   56 GPGEMGKAVNIAKDDQEKMKELFKINQFNLMASDMIALNRSLPDVRLDGCKTKVYADDLPTTSIVIVFHNEAWSTLLRTVHSVISRSPRHLLVEIVLVDDASERDFLKKKLEGYVRTLEVPVKILRMEQRSGLIRARLRGAAATTGQVITFLDAHCECTEGWLEPLLARIKEDRTAVVCPIIDVISDETFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPV---RTPTMAGGLFSIDKMYFEEIGSYDPGMDIWGGENLEMSFRIWQCGGSLEIVTCSHVGHVFRKATPYSFPGGT-GQVINKNNRRLAEVWMDEFKDFFYIISPGVMRVDYGDVSSRKALREALKCKPFAWYLE-------NIYPDSQIPRRYYSLGEIRNVETNQ---CVDNMGRKENEKVGFFNC----HGMGGNQVFSYTADKEIRTD--DLCLDVSRL--NGPVVMLKCHHMKGNQMFEYDAERLTLLHVNSNQCLDMPSEEDKMVPTLRDCNGSRSQQ---WLLRNMT 553          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Planmine SMEST
Match: SMESG000070134.1 (SMESG000070134.1)

HSP 1 Score: 1247.26 bits (3226), Expect = 0.000e+0
Identity = 599/600 (99.83%), Postives = 600/600 (100.00%), Query Frame = 1
Query:   37 MTRFKLKNFLKFACFAALVYLIVNSVYFRNPNSIENSSNVATTQSVELSTEELLISTSEHLESNLVDWHNYTQIEEELKRRGPGEQGSGVRIPKAEEEEQQRIYKENGYDGYASDKISIQRSLRDIRHPACKTLKYLKSLPSVSVIIPFHQEHWSPLIRTVDSVIRRAPLGLIKEVILVDDASRKPFLQKTLEIFLKEHYPIAKVLRTNGRQGLIRTRVLGAKEAIGDVLIFLDSHSEANVNWLPPLLEPIAKNYKTVTCPFIDVINYDTFEYLSQDEGARGIFDWNFDYKRIPRFKSDESHPADPFESPVMAGGLFAISRKWFWELGGYDEGLDIWGGEQYEISFKLWQCGGKMLDIPCSRIGHVYRKYSPFPNNAKGNFISRNFKRVAEVWMDEFKEYLYLRRPTIRNEDPLNLTNQFAIREKLHCKNFSWFMKEVAFDLVNNYPLIEPNPVCSGEIKLSNPNNVSVCIDFKFRDSGYVVGLSPCLSVNHKEGGEQNFILSWKGEIKPKDRDMCMDSSDHIPGGSVLLFKCHGGRGNQFFKYKLESQQILFVNSGFCLEGDPASKHIALQTCNETITDQKWIWTSVNMTELKKLHDFN 1836
            MTRFKLKNFLKFACFAALVYLIVNSVYFRNPNSIENSSNVATTQSVELSTEELLISTSEHLESNLVDWHNYTQIEEELKRRGPGEQGSGVRIPKAEEEEQQRIYKENGYDGYASDKISIQRSLRDIRHPACKTLKYLKSLPSVSVIIPFHQEHWSPLIRTVDSVIRRAPLGLIKEVILVDDASRKPFLQKTLEIFLKEHYPIAKVLRTNGRQGLIRTRVLGAKEAIGDVLIFLDSHSEANVNWLPPLLEPIAKNYKTVTCPFIDVINYDTFEYLSQDEGARGIFDWNFDYKRIPRFKSDESHPADPFESPVMAGGLFAISRKWFWELGGYDEGLDIWGGEQYEISFKLWQCGGKMLD+PCSRIGHVYRKYSPFPNNAKGNFISRNFKRVAEVWMDEFKEYLYLRRPTIRNEDPLNLTNQFAIREKLHCKNFSWFMKEVAFDLVNNYPLIEPNPVCSGEIKLSNPNNVSVCIDFKFRDSGYVVGLSPCLSVNHKEGGEQNFILSWKGEIKPKDRDMCMDSSDHIPGGSVLLFKCHGGRGNQFFKYKLESQQILFVNSGFCLEGDPASKHIALQTCNETITDQKWIWTSVNMTELKKLHDFN
Sbjct:    1 MTRFKLKNFLKFACFAALVYLIVNSVYFRNPNSIENSSNVATTQSVELSTEELLISTSEHLESNLVDWHNYTQIEEELKRRGPGEQGSGVRIPKAEEEEQQRIYKENGYDGYASDKISIQRSLRDIRHPACKTLKYLKSLPSVSVIIPFHQEHWSPLIRTVDSVIRRAPLGLIKEVILVDDASRKPFLQKTLEIFLKEHYPIAKVLRTNGRQGLIRTRVLGAKEAIGDVLIFLDSHSEANVNWLPPLLEPIAKNYKTVTCPFIDVINYDTFEYLSQDEGARGIFDWNFDYKRIPRFKSDESHPADPFESPVMAGGLFAISRKWFWELGGYDEGLDIWGGEQYEISFKLWQCGGKMLDVPCSRIGHVYRKYSPFPNNAKGNFISRNFKRVAEVWMDEFKEYLYLRRPTIRNEDPLNLTNQFAIREKLHCKNFSWFMKEVAFDLVNNYPLIEPNPVCSGEIKLSNPNNVSVCIDFKFRDSGYVVGLSPCLSVNHKEGGEQNFILSWKGEIKPKDRDMCMDSSDHIPGGSVLLFKCHGGRGNQFFKYKLESQQILFVNSGFCLEGDPASKHIALQTCNETITDQKWIWTSVNMTELKKLHDFN 600          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Planmine SMEST
Match: SMESG000077709.1 (SMESG000077709.1)

HSP 1 Score: 639.417 bits (1648), Expect = 0.000e+0
Identity = 299/527 (56.74%), Postives = 396/527 (75.14%), Query Frame = 1
Query:  232 VDWHNYTQIEEELKRRGPGEQGSGVRIPKAEEEEQQRIYKENGYDGYASDKISIQRSLRDIRHPACKTLKYLKSLPSVSVIIPFHQEHWSPLIRTVDSVIRRAPLGLIKEVILVDDASRKPFLQKTLEIFLKEHYP-IAKVLRTNGRQGLIRTRVLGAKEAIGDVLIFLDSHSEANVNWLPPLLEPIAKNYKTVTCPFIDVINYDTFEYLSQDEGARGIFDWNFDYKRIPRFKSDESHPADPFESPVMAGGLFAISRKWFWELGGYDEGLDIWGGEQYEISFKLWQCGGKMLDIPCSRIGHVYRKYSPFPNNAK-GNFISRNFKRVAEVWMDEFKEYLYLRRPTIRNEDPLNLTNQFAIREKLHCKNFSWFMKEVAFDLVNNYPLIEPNPVCSGEI--KLSNPNNVSVCIDFKFRDSGYVVGLSPCLSVNHKEGGEQNFILSWKGEIKPKDRDMCMDSSDHIPGGSVLLFKCHGGRGNQFFKYKLESQQILFVNSGFCLEGDPASKHIALQTCNETITDQKWIWTSV 1800
            +DWHNY QI EE +R G GE GS V +  +E   ++ I+K NG++G ASDK+++ RS++DIRHP CK + Y KSLPSVS+IIPF++EHWS L+RT  S + RAP GL+KE+ILVDD S K FL+  L+ +++ ++  I +VLR + R+GLIRTR+ GAK A GDVLIFLDSH EAN+NWLPPLL+PIA++Y+TVTCPFIDV+++DTFEY +QDEGARG FDW F YKR+P    D  +PA PF+SPVMAGGLFAISRKWFWELGGYD GLDIWGGEQYE+SFK+WQCGG+MLD PCSRI HVYRKY+PFP+    GNFI+RN+KRVAEVWMDE+++YLY R+P+   E+  +LT QFAIRE+L CK+F WFM E+AFDL  +YP +EP     GE+  K+ N +  S+C+D KF  S   + L+PC+  N +  GEQ F+L+W  +++ K RD C+D   ++    V+L+ CHG +GNQ +KYKL+S+Q+  V +  CL  D  ++ + + TC  + ++QKW   +V
Sbjct:   58 IDWHNYKQILEESQREGVGEHGSAVILDSSENNLKESIFKVNGFNGLASDKMALNRSVKDIRHPDCKKMLYQKSLPSVSIIIPFYEEHWSTLLRTFISALIRAPKGLVKEIILVDDCSTKEFLKDKLDQYIENNFKGIVRVLRQDKREGLIRTRLKGAKNATGDVLIFLDSHCEANINWLPPLLDPIAQDYRTVTCPFIDVLDHDTFEYRAQDEGARGAFDWEFYYKRLPLLPEDLKYPARPFKSPVMAGGLFAISRKWFWELGGYDPGLDIWGGEQYELSFKIWQCGGQMLDTPCSRIAHVYRKYAPFPSVVNIGNFIARNYKRVAEVWMDEYRKYLYRRQPSWERENAGDLTAQFAIRERLKCKSFKWFMTEIAFDLEKHYPSVEPPNSADGEVRSKVFNSDGNSLCLDAKFAKSESQIRLAPCVKDNSRLTGEQKFLLTWHEDLRLKSRDECLDVPQNMFKSPVILYSCHGQKGNQLWKYKLDSKQLYHVVTQKCLTADGPTQSVYMDTCTSS-SNQKWYLENV 583          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Planmine SMEST
Match: SMESG000027520.1 (SMESG000027520.1)

HSP 1 Score: 558.525 bits (1438), Expect = 0.000e+0
Identity = 281/592 (47.47%), Postives = 385/592 (65.03%), Query Frame = 1
Query:   37 MTRFKLKNFLKFACFAALVYLIVNSVYFRNPNSIENSSNVATTQSVELSTEELLISTSEHLESNLVDWHNYTQIEEELKRRGPGEQGSGVRIPKAEEEEQQRIYKENGYDGYASDKISIQRSLRDIRHPACKTLKYLKSLPSVSVIIPFHQEHWSPLIRTVDSVIRRAPLGLIKEVILVDDASRKPFLQKTLEIFLKEHYPIAKVLRTNGRQGLIRTRVLGAKEAIGDVLIFLDSHSEANVNWLPPLLEPIAKNYKTVTCPFIDVINYDTFEYLSQDEGARGIFDWNFDYKRIPRFKSDESHPADPFESPVMAGGLFAISRKWFWELGGYDEGLDIWGGEQYEISFKLWQCGGKMLDIPCSRIGHVYRKYSPFPNNAKGNFISRNFKRVAEVWMDEFKEYLYLRRPTIRNE-DPLNLTNQFAIREKLHCKNFSWFMKEVAFDLVNNYPLIEPNPVCSGEIKLSNPNNVSVCIDFKFRDSGYVVGLSPCLSVNHKEGGEQNFILSWKGEIKPKDRDMCMDSSDHIPGGSVLLFKCHGGRGNQFFKYKLESQQILFVNSGFCLE--GDPASKHIALQTCNETITDQKWIWTSVN 1803
            M R KLK  L F      ++LI N +                +   E S E   +S+   ++   +DW N+  I+EE  R GPGEQG GV +   E E+ +++ + NGY+  ASDKIS+ RS++D+R   CK LKY   LP  S+IIPFH EHWS L+RTV S++ R+P  L+KE+ILVDD S K FL + LE ++ EH+   ++LRT  R+GLIR R+LGA EA G VLIF+DSH E  +NWLPPLL+PI  +YKT++CPFIDVI+Y+ F    QDEG RG FDWNFDYKR+PR   D +HP  PF +P+MAGGLFAIS+ WF ELGGYD GLD+WGGEQYE+SFK+W CGGKM+D+PCSR+GHVYRK++PF     GN+++RN KR+AEVWMD++K+Y+Y +   + +  DP +LT Q  +R+ L+C +F WFMK++A+DL+  YP I+  P    + K+ +  N  +C DF   + G    +S C  V++    EQN   +W+ EIKP+ RD+C+D      G  + +F CHG  GNQ + Y   S QI+ V S  C++   +P S  I +Q C+   + QKWI  ++N
Sbjct:   17 MLRIKLKKILLFFIVLLGIFLIQNIL----------------SDWKETSDEINEVSSDSQIK---IDWANHDTIDEENARVGPGEQGIGVYLTANENEKAKQLMETNGYNALASDKISVHRSIKDLRINKCKWLKYDNFLPPASIIIPFHNEHWSTLLRTVHSILHRSPDKLVKEIILVDDNSTKEFLGEKLEQYVSEHFTKVRILRTGKREGLIRARLLGANEANGTVLIFIDSHCEVGINWLPPLLQPIRDHYKTISCPFIDVISYNDFSLRPQDEGGRGAFDWNFDYKRLPRLSKDNAHPEKPFYNPIMAGGLFAISKLWFNELGGYDYGLDVWGGEQYELSFKVWMCGGKMVDVPCSRVGHVYRKFNPFAVVGLGNYLARNHKRIAEVWMDDWKQYIYQKHQKVYSSLDPGDLTEQKKLRKALNCTSFDWFMKQIAYDLLEKYP-IQKQPENLSQGKIKSEINPHLCFDFNLGNPGDPFRISNCTDVSN----EQNLAFTWEMEIKPQKRDICLDYPR--KGEELTMFSCHGMGGNQKWIYNQNSHQIVHVVSKKCIDYRYNPESLEINIQKCSRK-SSQKWILENMN 581          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Planmine SMEST
Match: SMESG000021519.1 (SMESG000021519.1)

HSP 1 Score: 410.223 bits (1053), Expect = 2.877e-136
Identity = 196/477 (41.09%), Postives = 309/477 (64.78%), Query Frame = 1
Query:  364 DGYASDKISIQRSLRDIRHPACKTLKYLKSLPSVSVIIPFHQEHWSPLIRTVDSVIRRAPLGLIKEVILVDDASRKPFLQKTLEIFLKEHYPIAKVLRTNGRQGLIRTRVLGAKEAIGDVLIFLDSHSEANVNWLPPLLEPIAKNYKTVTCPFIDVINYDTFEYLSQDEGARGIFDWNFDYKRIPRFKSDESHPADPFESPVMAGGLFAISRKWFWELGGYDEGLDIWGGEQYEISFKLWQCGGKMLDIPCSRIGHVYRKYSPFPNNAKGNFISRNFKRVAEVWMDEFKEYLYLRR-PTIRNEDPLNLTNQFAIREKLHCKNFSWFMKEVAFDLVNNYPLIEPNPVCSGEIKLSNPNNVSVCIDFKFRDSGYVVGLSPCLSVNHKE-GGEQNFILSWKGEIKPKDRDMCMDSSDHIPGGSVLLFKCHGGRGNQFFKYKLESQQILFVNSGFCLEGDPASKHIALQTCNETITDQKWI 1788
            + +  +K+S+ R++ +++   CK L++ K+LPSVS+II F+   W  L++T   ++ R+P  LIKE++++DD +    ++  +  ++ +H+   +V+    R+GLI+ R+LGAK A G VL+F+DSH    V WLPPLLEPI +NYKTVTCPFID+ + DT  Y SQDEGARG FDWNF+Y R+PR  ++++ P DPF++P+M G +FAI+R WFWELGGYDEGL+IWGGEQ+E+SFK+W CGG+M+++PCSRI  +++    F        I +N+KR+AE+WMD +K+++Y R      + D  +++ Q  +++KL+CK+F WFM+ VA+D++  YP I  +   +  I L + +  S+C+D K+R  G  VG+  C  +   E   EQ F  +   EI+P  R++C D  +     +++L +C     NQ ++Y   S QI  + S  C++ +  S  + +  C+ + T QKWI
Sbjct:   70 NSFEEEKVSLYRTINELKITKCKWLRHNKTLPSVSIIITFYDSDWETLMQTTRMLLLRSPRRLIKEILIIDDNADNNDMRSKMNAYVSKHFTNVRVVHKTKREGLIKARLLGAKLAKGKVLVFMDSHCTVGVKWLPPLLEPIKENYKTVTCPFIDINDTDTSLY-SQDEGARGAFDWNFNYTRLPRLHNNKTDPEDPFDNPIMQGRIFAITRNWFWELGGYDEGLEIWGGEQFELSFKIWMCGGRMVNVPCSRIRCIFKDIYSFDFIHDDIKIRKNYKRIAEIWMDNWKKFIYQRHLEEYSSFDCGDISKQKKLQQKLNCKSFDWFMENVAYDILYLYPPITVSEKLNCSITLESDD--SICVDSKYRKQGDRVGIDQCNQIGRSEKNKEQRFSFTSDFEIRPGQRNLCFDYRN--SSETLMLSQCDLMNPNQKWEYNSTSHQITNIPSQKCIKVNSKSLLLLVNNCSLSSTMQKWI 541          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Planmine SMEST
Match: SMESG000021519.1 (SMESG000021519.1)

HSP 1 Score: 378.637 bits (971), Expect = 3.193e-124
Identity = 184/477 (38.57%), Postives = 295/477 (61.84%), Query Frame = 1
Query:  364 DGYASDKISIQRSLRDIRHPACKTLKYLKSLPSVSVIIPFHQEHWSPLIRTVDSVIRRAPLGLIKEVILVDDASRKPFLQKTLEIFLKEHYPIAKVLRTNGRQGLIRTRVLGAKEAIGDVLIFLDSHSEANVNWLPPLLEPIAKNYKTVTCPFIDVINYDTFEYLSQDEGARGIFDWNFDYKRIPRFKSDESHPADPFESPVMAGGLFAISRKWFWELGGYDEGLDIWGGEQYEISFKLWQCGGKMLDIPCSRIGHVYRKYSPFPNNAKGNFISRNFKRVAEVWMDEFKEYLYLRR-PTIRNEDPLNLTNQFAIREKLHCKNFSWFMKEVAFDLVNNYPLIEPNPVCSGEIKLSNPNNVSVCIDFKFRDSGYVVGLSPCLSVNHKE-GGEQNFILSWKGEIKPKDRDMCMDSSDHIPGGSVLLFKCHGGRGNQFFKYKLESQQILFVNSGFCLEGDPASKHIALQTCNETITDQKWI 1788
            + +  +K+S+ R++ +++   CK L++ K+LPSVS+II F+   W  L++T   ++ R+P  LIKE++++DD +    ++  +  ++ +H+   +V+    R+GLI+ R+LGAK A G VL+F+DSH    V WLPPLLEPI +NYKT                   DEGARG FDWNF+Y R+PR  ++++ P DPF++P+M G +FAI+R WFWELGGYDEGL+IWGGEQ+E+SFK+W CGG+M+++PCSRI  +++    F        I +N+KR+AE+WMD +K+++Y R      + D  +++ Q  +++KL+CK+F WFM+ VA+D++  YP I  +   +  I L + +  S+C+D K+R  G  VG+  C  +   E   EQ F  +   EI+P  R++C D  +     +++L +C     NQ ++Y   S QI  + S  C++ +  S  + +  C+ + T QKWI
Sbjct:   70 NSFEEEKVSLYRTINELKITKCKWLRHNKTLPSVSIIITFYDSDWETLMQTTRMLLLRSPRRLIKEILIIDDNADNNDMRSKMNAYVSKHFTNVRVVHKTKREGLIKARLLGAKLAKGKVLVFMDSHCTVGVKWLPPLLEPIKENYKT-------------------DEGARGAFDWNFNYTRLPRLHNNKTDPEDPFDNPIMQGRIFAITRNWFWELGGYDEGLEIWGGEQFELSFKIWMCGGRMVNVPCSRIRCIFKDIYSFDFIHDDIKIRKNYKRIAEIWMDNWKKFIYQRHLEEYSSFDCGDISKQKKLQQKLNCKSFDWFMENVAYDILYLYPPITVSEKLNCSITLESDD--SICVDSKYRKQGDRVGIDQCNQIGRSEKNKEQRFSFTSDFEIRPGQRNLCFDYRN--SSETLMLSQCDLMNPNQKWEYNSTSHQITNIPSQKCIKVNSKSLLLLVNNCSLSSTMQKWI 523          
The following BLAST results are available for this feature:
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GALNT108.456e-17347.87polypeptide N-acetylgalactosaminyltransferase 10 [... [more]
GALNTL61.873e-17147.03polypeptide N-acetylgalactosaminyltransferase like... [more]
GALNTL62.212e-17147.03polypeptide N-acetylgalactosaminyltransferase like... [more]
GALNTL64.485e-12947.00polypeptide N-acetylgalactosaminyltransferase like... [more]
GALNT132.326e-12440.88polypeptide N-acetylgalactosaminyltransferase 13 [... [more]
back to top
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gly-100.000e+053.40Putative polypeptide N-acetylgalactosaminyltransfe... [more]
gly-100.000e+053.40Putative polypeptide N-acetylgalactosaminyltransfe... [more]
gly-71.288e-12638.10Probable N-acetylgalactosaminyltransferase 7 [Sou... [more]
gly-71.619e-12640.49Probable N-acetylgalactosaminyltransferase 7 [Sou... [more]
gly-55.159e-11039.19Polypeptide N-acetylgalactosaminyltransferase 5 [... [more]
back to top
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pgant64.820e-16748.41gene:FBgn0035375 transcript:FBtr0072973[more]
Pgant64.820e-16748.41gene:FBgn0035375 transcript:FBtr0333442[more]
Pgant64.820e-16748.41gene:FBgn0035375 transcript:FBtr0072972[more]
Pgant41.497e-15043.07gene:FBgn0051956 transcript:FBtr0333248[more]
Pgant41.497e-15043.07gene:FBgn0051956 transcript:FBtr0114524[more]
back to top
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GALNTL63.182e-16947.24si:ch211-15e22.3 [Source:ZFIN;Acc:ZDB-GENE-090312-... [more]
GALNTL63.182e-16947.24si:ch211-15e22.3 [Source:ZFIN;Acc:ZDB-GENE-090312-... [more]
GALNT104.532e-12647.13polypeptide N-acetylgalactosaminyltransferase 10-l... [more]
galnt137.143e-12239.50UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-a... [more]
galnt15.087e-12139.20UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-a... [more]
back to top
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GALNTL61.514e-17547.60polypeptide N-acetylgalactosaminyltransferase like... [more]
galnt101.387e-17148.42polypeptide N-acetylgalactosaminyltransferase 10 [... [more]
galnt101.387e-17148.42polypeptide N-acetylgalactosaminyltransferase 10 [... [more]
GALNTL65.408e-16946.30polypeptide N-acetylgalactosaminyltransferase like... [more]
GALNTL68.322e-15948.45polypeptide N-acetylgalactosaminyltransferase like... [more]
back to top
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Galnt101.192e-17347.61polypeptide N-acetylgalactosaminyltransferase 10 [... [more]
Galntl62.268e-17146.93UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-a... [more]
Galntl64.645e-13047.12UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-a... [more]
Galnt138.919e-12440.69polypeptide N-acetylgalactosaminyltransferase 13 [... [more]
Galnt138.919e-12440.69polypeptide N-acetylgalactosaminyltransferase 13 [... [more]
back to top
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O45947|GLT10_CAEEL0.000e+048.37Putative polypeptide N-acetylgalactosaminyltransfe... [more]
sp|A8Y236|GLT10_CAEBR0.000e+053.18Putative polypeptide N-acetylgalactosaminyltransfe... [more]
sp|Q925R7|GLT10_RAT4.443e-17347.79Polypeptide N-acetylgalactosaminyltransferase 10 O... [more]
sp|Q6P9S7|GLT10_MOUSE8.335e-17347.61Polypeptide N-acetylgalactosaminyltransferase 10 O... [more]
sp|Q86SR1|GLT10_HUMAN4.061e-17247.87Polypeptide N-acetylgalactosaminyltransferase 10 O... [more]
back to top
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3JMP60.000e+056.87Polypeptide N-acetylgalactosaminyltransferase OS=L... [more]
T1JNW70.000e+052.53Polypeptide N-acetylgalactosaminyltransferase OS=S... [more]
V4ALX20.000e+056.79Polypeptide N-acetylgalactosaminyltransferase OS=L... [more]
A0A210PT880.000e+056.71Polypeptide N-acetylgalactosaminyltransferase OS=M... [more]
R7V6100.000e+051.41Polypeptide N-acetylgalactosaminyltransferase OS=C... [more]
back to top
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch211-15e22.31.992e-17248.16polypeptide N-acetylgalactosaminyltransferase like... [more]
GALNT107.089e-16346.60polypeptide N-acetylgalactosaminyltransferase 10 [... [more]
galnt134.326e-12541.11polypeptide N-acetylgalactosaminyltransferase 13 [... [more]
galnt14.667e-12239.39polypeptide N-acetylgalactosaminyltransferase 1 [S... [more]
galnt131.793e-12041.43polypeptide N-acetylgalactosaminyltransferase 13 [... [more]
back to top
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
galnt111.515e-10637.79UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-a... [more]
ENSPMAT00000000477.13.847e-10439.07pep scaffold:Pmarinus_7.0:GL501308:12705:54064:-1 ... [more]
poc1bl1.663e-9636.74POC1 centriolar protein homolog B (Chlamydomonas),... [more]
galnt122.286e-9437.14UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-a... [more]
galnt23.653e-9240.14UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-a... [more]
back to top
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO310352.144e-13444.42Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO458297.788e-11137.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO372669.149e-11039.06Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO302691.597e-10637.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO343559.313e-10435.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GALNT108.345e-17143.93polypeptide N-acetylgalactosaminyltransferase 10 [... [more]
GALNT109.713e-17144.07polypeptide N-acetylgalactosaminyltransferase 10 [... [more]
galnt135.783e-12340.15polypeptide N-acetylgalactosaminyltransferase 13 [... [more]
galnt135.783e-12340.15polypeptide N-acetylgalactosaminyltransferase 13 [... [more]
galnt135.783e-12340.15polypeptide N-acetylgalactosaminyltransferase 13 [... [more]
back to top
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000070134.10.000e+099.83SMESG000070134.1[more]
SMESG000077709.10.000e+056.74SMESG000077709.1[more]
SMESG000027520.10.000e+047.47SMESG000027520.1[more]
SMESG000021519.12.877e-13641.09SMESG000021519.1[more]
SMESG000021519.13.193e-12438.57SMESG000021519.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028011 ID=SMED30028011|Name=Polypeptide N-acetylgalactosaminyltransferase|organism=Schmidtea mediterranea sexual|type=transcript|length=1880bp
ATACGTGCTCCATGATTCCTAAAAATCACTTTTGCTATGACTAGGTTTAA
ACTGAAAAATTTCCTCAAATTTGCATGTTTCGCAGCGCTTGTATATCTCA
TTGTTAACAGCGTGTACTTCCGCAATCCAAATTCCATTGAAAATAGTTCA
AATGTTGCCACCACCCAATCAGTAGAACTTTCAACTGAAGAGCTGCTTAT
TTCAACCTCTGAACATCTAGAATCGAACTTAGTAGACTGGCATAATTATA
CACAAATAGAGGAAGAGTTGAAACGCCGAGGTCCTGGTGAACAAGGTTCA
GGAGTACGCATTCCCAAAGCTGAAGAAGAAGAACAACAAAGAATTTATAA
AGAAAATGGATATGATGGTTATGCTAGTGATAAAATTTCTATTCAAAGGA
GTCTCAGAGATATTCGTCATCCGGCATGTAAAACTTTAAAATACTTAAAG
AGCCTTCCTAGCGTTTCAGTAATTATTCCATTTCACCAGGAACATTGGAG
TCCATTGATACGAACAGTTGATTCTGTCATTCGTAGAGCACCTCTTGGAT
TAATTAAAGAAGTCATTCTTGTAGATGATGCTAGTCGCAAGCCTTTCCTG
CAAAAGACTCTTGAAATATTTTTGAAGGAACACTATCCAATCGCAAAAGT
ACTAAGAACAAACGGTAGACAAGGTTTAATTAGAACTCGAGTTCTCGGAG
CCAAAGAAGCAATTGGGGATGTTCTGATATTTTTAGATTCCCATTCTGAG
GCCAATGTAAATTGGCTACCGCCTTTATTAGAACCTATTGCAAAGAACTA
CAAAACCGTAACTTGTCCTTTTATTGATGTTATCAATTATGATACGTTTG
AATATTTATCACAAGATGAAGGAGCAAGGGGAATCTTTGATTGGAATTTT
GATTATAAGAGAATTCCTCGTTTCAAATCAGATGAATCCCATCCAGCTGA
TCCTTTTGAAAGTCCAGTTATGGCGGGTGGCTTGTTTGCCATATCCAGAA
AATGGTTTTGGGAACTTGGAGGTTATGATGAAGGACTAGATATTTGGGGT
GGAGAACAGTATGAAATTTCTTTCAAGCTTTGGCAATGTGGAGGGAAAAT
GTTAGATATCCCATGCTCTAGAATCGGGCATGTGTATCGAAAATATTCCC
CGTTTCCAAACAATGCAAAAGGCAATTTTATCAGTCGAAATTTTAAAAGA
GTAGCAGAAGTCTGGATGGACGAGTTTAAAGAATATTTGTATTTGAGGAG
GCCTACAATAAGAAATGAGGATCCGTTGAATTTAACGAACCAATTTGCTA
TCAGAGAAAAATTGCATTGTAAAAACTTTTCGTGGTTCATGAAAGAAGTG
GCCTTTGACCTTGTGAACAATTATCCTTTAATCGAACCGAATCCTGTTTG
TTCCGGGGAAATCAAATTATCAAACCCAAACAATGTTTCTGTTTGCATAG
ATTTCAAATTCCGAGATTCAGGATACGTTGTCGGTCTTTCTCCTTGTTTA
TCGGTTAATCACAAAGAAGGAGGAGAACAGAATTTTATTCTCAGTTGGAA
AGGAGAAATTAAACCAAAAGACAGAGACATGTGTATGGACAGTAGTGATC
ACATCCCTGGCGGGTCAGTTTTACTATTTAAGTGTCATGGGGGTAGAGGC
AATCAATTTTTTAAATATAAATTGGAAAGTCAACAAATTCTATTTGTCAA
TTCGGGTTTCTGTTTGGAGGGGGACCCTGCATCGAAACATATCGCCCTTC
AAACTTGCAACGAAACTATTACAGATCAAAAATGGATATGGACTAGTGTC
AACATGACAGAGCTGAAAAAGTTACATGATTTTAATTAAAATTTATACAT
TTTATAAGATAATAAAATTTTGGATGTTTT
back to top

protein sequence of SMED30028011-orf-1

>SMED30028011-orf-1 ID=SMED30028011-orf-1|Name=SMED30028011-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=601bp
MTRFKLKNFLKFACFAALVYLIVNSVYFRNPNSIENSSNVATTQSVELST
EELLISTSEHLESNLVDWHNYTQIEEELKRRGPGEQGSGVRIPKAEEEEQ
QRIYKENGYDGYASDKISIQRSLRDIRHPACKTLKYLKSLPSVSVIIPFH
QEHWSPLIRTVDSVIRRAPLGLIKEVILVDDASRKPFLQKTLEIFLKEHY
PIAKVLRTNGRQGLIRTRVLGAKEAIGDVLIFLDSHSEANVNWLPPLLEP
IAKNYKTVTCPFIDVINYDTFEYLSQDEGARGIFDWNFDYKRIPRFKSDE
SHPADPFESPVMAGGLFAISRKWFWELGGYDEGLDIWGGEQYEISFKLWQ
CGGKMLDIPCSRIGHVYRKYSPFPNNAKGNFISRNFKRVAEVWMDEFKEY
LYLRRPTIRNEDPLNLTNQFAIREKLHCKNFSWFMKEVAFDLVNNYPLIE
PNPVCSGEIKLSNPNNVSVCIDFKFRDSGYVVGLSPCLSVNHKEGGEQNF
ILSWKGEIKPKDRDMCMDSSDHIPGGSVLLFKCHGGRGNQFFKYKLESQQ
ILFVNSGFCLEGDPASKHIALQTCNETITDQKWIWTSVNMTELKKLHDFN
*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR035992Ricin_B-like_lectins
IPR000772Ricin_B_lectin
IPR029044Nucleotide-diphossugar_trans
IPR001173Glyco_trans_2-like
Vocabulary: cellular component
TermDefinition
GO:0000139Golgi membrane
GO:0005794Golgi apparatus
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0006486protein glycosylation
Vocabulary: molecular function
TermDefinition
GO:0016740transferase activity
GO:0016757transferase activity, transferring glycosyl groups
GO:0030246carbohydrate binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000772Ricin B, lectin domainSMARTSM00458ricin_3coord: 456..586
e-value: 1.1E-16
score: 71.4
IPR000772Ricin B, lectin domainPFAMPF00652Ricin_B_lectincoord: 466..583
e-value: 3.1E-20
score: 72.7
IPR000772Ricin B, lectin domainPROSITEPS50231RICIN_B_LECTINcoord: 455..586
score: 17.685
IPR000772Ricin B, lectin domainCDDcd00161RICINcoord: 457..585
e-value: 2.39566E-22
score: 90.6426
NoneNo IPR availableGENE3DG3DSA:2.80.10.50coord: 454..594
e-value: 1.3E-25
score: 91.9
NoneNo IPR availablePANTHERPTHR11675:SF23N-ACETYLGALACTOSAMINYLTRANSFERASE 4-RELATEDcoord: 52..595
NoneNo IPR availablePANTHERPTHR11675N-ACETYLGALACTOSAMINYLTRANSFERASEcoord: 52..595
NoneNo IPR availableCDDcd02510pp-GalNAc-Tcoord: 144..439
e-value: 1.96736E-167
score: 476.696
NoneNo IPR availableTMHMMTMhelixcoord: 9..28
IPR001173Glycosyltransferase 2-likePFAMPF00535Glycos_transf_2coord: 144..328
e-value: 2.9E-28
score: 98.8
IPR029044Nucleotide-diphospho-sugar transferasesGENE3DG3DSA:3.90.550.10coord: 63..449
e-value: 1.9E-160
score: 535.8
IPR029044Nucleotide-diphospho-sugar transferasesSUPERFAMILYSSF53448Nucleotide-diphospho-sugar transferasescoord: 121..441
IPR035992Ricin B-like lectinsSUPERFAMILYSSF50370Ricin B-like lectinscoord: 450..586