SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1

Overview
NameSWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1
Smed IDSMED30028010
Length (bp)2112
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 (SMED30028010) t-SNE clustered cells

Violin plots show distribution of expression levels for SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 (SMED30028010) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 (SMED30028010) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 (SMED30028010) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028010

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30028010h1SMcG0004001 SmedASXL_017971SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30028010h1SMcG0004001 SmedASXL_017971SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
neoblastSMED30028010h1SMcG0004001 dd_Smed_v4_10238_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 vs. Ensembl Human
Match: SMARCAL1 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a like 1 [Source:HGNC Symbol;Acc:HGNC:11102])

HSP 1 Score: 306.99 bits (785), Expect = 3.347e-113
Identity = 176/426 (41.31%), Postives = 263/426 (61.74%), Query Frame = 3
Query:   87 VLYSHERFEIIIGYNERVINVIKSIKSSEYDQNTRKWNILLTKYKETVTALNKLGILDITLLPNYVIKIFNHKI--NNLTLPPDPISRVSDENYLKVDAKIRESLFPFQVQGVKYMIGRHGRCLLADDMGLGKSVQSLGAASYYRDEWPLLIISPSSVKMAWRDQVKKWIT--EPVDILVIDTSKDIKHENFEHLNKNSIILVSYDLVSRLSSHLLKFNFKVIIMDESHFIKSGLTARAKGCIPLAKKANRLFLLSGTPALSRPSEMFTQIDVIAPSLYNGYFKEFGNRYCDPQFTNWGINYNGSSNTSELQILLNEGIMLRRLKSEVLGQLPEKRREVILLASKFLE---KASLKRHADIMMKDNLKSLQRRGALLEYFHATGKAKIDAIKNYIDDLLESPR-KFLFFAHHSEVLNAVEDQIIKK 1340
            +L S   FE  I Y++ +I + K + S  YD  TRKW+ LL ++ + +  +  L  + +  LP  +   F  ++   +L+L PD    V + +  +VD K+  +L PFQ  GV + I + GR LLADDMGLGK++Q++  A++YR EWPLL++ PSSV+  W     +W+    P  I V+ T KD        L    I +VS+DL+S+L    LK  FKV+I+DESHF+K+  TAR +  +P+ K A R+ LLSGTPA+SRP+E++TQI  + P+ +   F  FG RYCD +   WG +Y+GSSN  EL++LL E +MLRRLKS+VL QLP K+R+++++A   +    +A+L   A  M   +    Q++ AL+ +F+ T +AKI ++  YI DLLES R KFL FAHH  VL+A+  ++ +K
Sbjct:  336 MLISRAYFEADISYSQDLIALFKQMDSRRYDVKTRKWSFLLEEHSKLIAKVRCLPQVQLDPLPTTLTLAFASQLKKTSLSLTPD----VPEADLSEVDPKLVSNLMPFQRAGVNFAIAKGGRLLLADDMGLGKTIQAICIAAFYRKEWPLLVVVPSSVRFTWEQAFLRWLPSLSPDCINVVVTGKD-------RLTAGLINIVSFDLLSKLEKQ-LKTPFKVVIIDESHFLKNSRTARCRAAMPVLKVAKRVILLSGTPAMSRPAELYTQIIAVKPTFFP-QFHAFGLRYCDAKRMPWGWDYSGSSNLGELKLLLEEAVMLRRLKSDVLSQLPAKQRKIVVIAPGRINARTRAALDAAAKEMTTKDKTKQQQKDALILFFNRTAEAKIPSVIEYILDLLESGREKFLVFAHHKVVLDAITQELERK 748          

HSP 2 Score: 123.25 bits (308), Expect = 3.347e-113
Identity = 67/143 (46.85%), Postives = 95/143 (66.43%), Query Frame = 2
Query: 1340 IGYVRIDGNVTSENKRVRTEKFQTDESIQIAILSXXXXXXXXXXXXXXXXVFGELFWNPGILLQAENRCHRIGQKDYVNIHYLVAEQTADDYIWPLVQSKMELLTKVGLNKENFKNSDTKRLEESFSEKDTNTKILDYFQSDF 1768
            + ++RIDG+ +S  +    ++FQ  E   +A+LSI AA  G+T ++A LVVF ELFWNPG+L+QAE+R HRIGQ   V IHYLVA+ TADDY+WPL+Q K+++L + GL++ NF  S+     +   +     KI D FQ  F
Sbjct:  750 VQHIRIDGSTSSAEREDLCQQFQLSERHAVAVLSITAANMGLTFSSADLVVFAELFWNPGVLIQAEDRVHRIGQTSSVGIHYLVAKGTADDYLWPLIQEKIKVLAEAGLSETNF--SEMTESTDYLYKDPKQQKIYDLFQKSF 890          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 vs. Ensembl Human
Match: SMARCAL1 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a like 1 [Source:HGNC Symbol;Acc:HGNC:11102])

HSP 1 Score: 306.99 bits (785), Expect = 3.347e-113
Identity = 176/426 (41.31%), Postives = 263/426 (61.74%), Query Frame = 3
Query:   87 VLYSHERFEIIIGYNERVINVIKSIKSSEYDQNTRKWNILLTKYKETVTALNKLGILDITLLPNYVIKIFNHKI--NNLTLPPDPISRVSDENYLKVDAKIRESLFPFQVQGVKYMIGRHGRCLLADDMGLGKSVQSLGAASYYRDEWPLLIISPSSVKMAWRDQVKKWIT--EPVDILVIDTSKDIKHENFEHLNKNSIILVSYDLVSRLSSHLLKFNFKVIIMDESHFIKSGLTARAKGCIPLAKKANRLFLLSGTPALSRPSEMFTQIDVIAPSLYNGYFKEFGNRYCDPQFTNWGINYNGSSNTSELQILLNEGIMLRRLKSEVLGQLPEKRREVILLASKFLE---KASLKRHADIMMKDNLKSLQRRGALLEYFHATGKAKIDAIKNYIDDLLESPR-KFLFFAHHSEVLNAVEDQIIKK 1340
            +L S   FE  I Y++ +I + K + S  YD  TRKW+ LL ++ + +  +  L  + +  LP  +   F  ++   +L+L PD    V + +  +VD K+  +L PFQ  GV + I + GR LLADDMGLGK++Q++  A++YR EWPLL++ PSSV+  W     +W+    P  I V+ T KD        L    I +VS+DL+S+L    LK  FKV+I+DESHF+K+  TAR +  +P+ K A R+ LLSGTPA+SRP+E++TQI  + P+ +   F  FG RYCD +   WG +Y+GSSN  EL++LL E +MLRRLKS+VL QLP K+R+++++A   +    +A+L   A  M   +    Q++ AL+ +F+ T +AKI ++  YI DLLES R KFL FAHH  VL+A+  ++ +K
Sbjct:  336 MLISRAYFEADISYSQDLIALFKQMDSRRYDVKTRKWSFLLEEHSKLIAKVRCLPQVQLDPLPTTLTLAFASQLKKTSLSLTPD----VPEADLSEVDPKLVSNLMPFQRAGVNFAIAKGGRLLLADDMGLGKTIQAICIAAFYRKEWPLLVVVPSSVRFTWEQAFLRWLPSLSPDCINVVVTGKD-------RLTAGLINIVSFDLLSKLEKQ-LKTPFKVVIIDESHFLKNSRTARCRAAMPVLKVAKRVILLSGTPAMSRPAELYTQIIAVKPTFFP-QFHAFGLRYCDAKRMPWGWDYSGSSNLGELKLLLEEAVMLRRLKSDVLSQLPAKQRKIVVIAPGRINARTRAALDAAAKEMTTKDKTKQQQKDALILFFNRTAEAKIPSVIEYILDLLESGREKFLVFAHHKVVLDAITQELERK 748          

HSP 2 Score: 123.25 bits (308), Expect = 3.347e-113
Identity = 67/143 (46.85%), Postives = 95/143 (66.43%), Query Frame = 2
Query: 1340 IGYVRIDGNVTSENKRVRTEKFQTDESIQIAILSXXXXXXXXXXXXXXXXVFGELFWNPGILLQAENRCHRIGQKDYVNIHYLVAEQTADDYIWPLVQSKMELLTKVGLNKENFKNSDTKRLEESFSEKDTNTKILDYFQSDF 1768
            + ++RIDG+ +S  +    ++FQ  E   +A+LSI AA  G+T ++A LVVF ELFWNPG+L+QAE+R HRIGQ   V IHYLVA+ TADDY+WPL+Q K+++L + GL++ NF  S+     +   +     KI D FQ  F
Sbjct:  750 VQHIRIDGSTSSAEREDLCQQFQLSERHAVAVLSITAANMGLTFSSADLVVFAELFWNPGVLIQAEDRVHRIGQTSSVGIHYLVAKGTADDYLWPLIQEKIKVLAEAGLSETNF--SEMTESTDYLYKDPKQQKIYDLFQKSF 890          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 vs. Ensembl Human
Match: SMARCAL1 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a like 1 [Source:HGNC Symbol;Acc:HGNC:11102])

HSP 1 Score: 269.626 bits (688), Expect = 7.809e-102
Identity = 165/426 (38.73%), Postives = 247/426 (57.98%), Query Frame = 3
Query:   87 VLYSHERFEIIIGYNERVINVIKSIKSSEYDQNTRKWNILLTKYKETVTALNKLGILDITLLPNYVIKIFNHKI--NNLTLPPDPISRVSDENYLKVDAKIRESLFPFQVQGVKYMIGRHGRCLLADDMGLGKSVQSLGAASYYRDEWPLLIISPSSVKMAWRDQVKKWIT--EPVDILVIDTSKDIKHENFEHLNKNSIILVSYDLVSRLSSHLLKFNFKVIIMDESHFIKSGLTARAKGCIPLAKKANRLFLLSGTPALSRPSEMFTQIDVIAPSLYNGYFKEFGNRYCDPQFTNWGINYNGSSNTSELQILLNEGIMLRRLKSEVLGQLPEKRREVILLASKFLE---KASLKRHADIMMKDNLKSLQRRGALLEYFHATGKAKIDAIKNYIDDLLESPR-KFLFFAHHSEVLNAVEDQIIKK 1340
            +L S   FE  I Y++ +I + K + S  YD  TRKW+ LL ++ + +  +  L  + +  LP  +   F  ++   +L+L PD    V + +  +VD K+  +L PFQ  GV + I + GR LLADDMGLGK++Q++  A++YR EWPLL++ PSSV+  W     +W+    P  I V+ T KD        L    I +VS+DL+S+L    LK  FKV+I+                       A R+ LLSGTPA+SRP+E++TQI  + P+ +   F  FG RYCD +   WG +Y+GSSN  EL++LL E +MLRRLKS+VL QLP K+R+++++A   +    +A+L   A  M   +    Q++ AL+ +F+ T +AKI ++  YI DLLES R KFL FAHH  VL+A+  ++ +K
Sbjct:  200 MLISRAYFEADISYSQDLIALFKQMDSRRYDVKTRKWSFLLEEHSKLIAKVRCLPQVQLDPLPTTLTLAFASQLKKTSLSLTPD----VPEADLSEVDPKLVSNLMPFQRAGVNFAIAKGGRLLLADDMGLGKTIQAICIAAFYRKEWPLLVVVPSSVRFTWEQAFLRWLPSLSPDCINVVVTGKD-------RLTAGLINIVSFDLLSKLEKQ-LKTPFKVVII----------------------VAKRVILLSGTPAMSRPAELYTQIIAVKPTFFP-QFHAFGLRYCDAKRMPWGWDYSGSSNLGELKLLLEEAVMLRRLKSDVLSQLPAKQRKIVVIAPGRINARTRAALDAAAKEMTTKDKTKQQQKDALILFFNRTAEAKIPSVIEYILDLLESGREKFLVFAHHKVVLDAITQELERK 590          

HSP 2 Score: 122.865 bits (307), Expect = 7.809e-102
Identity = 67/143 (46.85%), Postives = 95/143 (66.43%), Query Frame = 2
Query: 1340 IGYVRIDGNVTSENKRVRTEKFQTDESIQIAILSXXXXXXXXXXXXXXXXVFGELFWNPGILLQAENRCHRIGQKDYVNIHYLVAEQTADDYIWPLVQSKMELLTKVGLNKENFKNSDTKRLEESFSEKDTNTKILDYFQSDF 1768
            + ++RIDG+ +S  +    ++FQ  E   +A+LSI AA  G+T ++A LVVF ELFWNPG+L+QAE+R HRIGQ   V IHYLVA+ TADDY+WPL+Q K+++L + GL++ NF  S+     +   +     KI D FQ  F
Sbjct:  592 VQHIRIDGSTSSAEREDLCQQFQLSERHAVAVLSITAANMGLTFSSADLVVFAELFWNPGVLIQAEDRVHRIGQTSSVGIHYLVAKGTADDYLWPLIQEKIKVLAEAGLSETNF--SEMTESTDYLYKDPKQQKIYDLFQKSF 732          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 vs. Ensembl Human
Match: ZRANB3 (zinc finger RANBP2-type containing 3 [Source:HGNC Symbol;Acc:HGNC:25249])

HSP 1 Score: 224.557 bits (571), Expect = 2.298e-78
Identity = 126/337 (37.39%), Postives = 204/337 (60.53%), Query Frame = 3
Query:  378 KIRESLFPFQVQGVKYMIGRHGRCLLADDMGLGKSVQSLGAASYYRDEWPLLIISPSSVKMAWRDQVKKWITE--PVDILVIDTSKDIKHENFEHLNKNSIILVSYDLVSRLSSHLLKF----NFKVIIMDESHFIKSGLTARAKGCIPLAKKANRLFLLSGTPALSRPSEMFTQIDVIAPSLYNGYFKEFGNRYCDPQFTNWG----INYNGSSNTSELQILLNEGIMLRRLKSEVLGQLPEKRREVILL-----ASKFLEKASLKRHADIMMKDNLKSLQR-RGALLEYFHATGKAKIDAIKNYIDDLLESPR-KFLFFAHHSEVLNAVEDQIIK 1337
            ++R  L PFQ  G+ + + R+GRC++AD+MGLGK++Q++G   +Y++EWPLLI+ PSS++  W ++++KWI E  P +I VI    D++      ++ + + ++ Y L++  +  L+      NFKV+I+DESH++KS    R++  +P+ +KA R  LL+GTPAL RP E+F QI+ + P  + G + ++  RYC+     +G     +  G+SN +EL  LL++ IM+RRLK+EVL QLP K R+ I       A+K L   S +    IM   N  +++   G +   F  T  AK  A+K+YI  +L++   KFL FAHH  +L A  + +I+
Sbjct:   32 RLRAKLLPFQKDGIIFALKRNGRCMVADEMGLGKTIQAIGITYFYKEEWPLLIVVPSSLRYPWTEEIEKWIPELSPEEINVIQNKTDVR-----RMSTSKVTVLGYGLLTADAKTLIDALNNQNFKVVIVDESHYMKSRNATRSRILLPIVQKARRAILLTGTPALGRPEELFMQIEALFPQKF-GRWTDYAKRYCNAHIRYFGKRPQWDCRGASNLNELHQLLSD-IMIRRLKTEVLTQLPPKVRQRIPFDLPSAAAKEL-NTSFEEWEKIMRTPNSGAMETVMGLITRMFKQTAIAKAGAVKDYIKMMLQNDSLKFLVFAHHLSMLQACTEAVIE 360          

HSP 2 Score: 89.7373 bits (221), Expect = 2.298e-78
Identity = 52/104 (50.00%), Postives = 71/104 (68.27%), Query Frame = 2
Query: 1337 KIGYVRIDGNVTSENKRVRTEKFQTDESIQIAILSXXXXXXXXXXXXXXXXVFGELFWNPGILLQAENRCHRIGQKDYVNIHYLVAEQTADDYIWPLVQSKMEL 1648
            K  Y+RIDG+V+S  +     +FQ D   ++AILSI AAG G+T TAA+ VVF EL+W+PG + QAE+R HRIGQ   VNIHYL+A  T D  +W ++  K ++
Sbjct:  362 KTRYIRIDGSVSSSERIHLVNQFQKDPDTRVAILSIQAAGQGLTFTAASHVVFAELYWDPGHIKQAEDRAHRIGQCSSVNIHYLIANGTLDTLMWGMLNRKAQV 465          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 vs. Ensembl Human
Match: ZRANB3 (zinc finger RANBP2-type containing 3 [Source:HGNC Symbol;Acc:HGNC:25249])

HSP 1 Score: 224.172 bits (570), Expect = 2.602e-78
Identity = 126/337 (37.39%), Postives = 204/337 (60.53%), Query Frame = 3
Query:  378 KIRESLFPFQVQGVKYMIGRHGRCLLADDMGLGKSVQSLGAASYYRDEWPLLIISPSSVKMAWRDQVKKWITE--PVDILVIDTSKDIKHENFEHLNKNSIILVSYDLVSRLSSHLLKF----NFKVIIMDESHFIKSGLTARAKGCIPLAKKANRLFLLSGTPALSRPSEMFTQIDVIAPSLYNGYFKEFGNRYCDPQFTNWG----INYNGSSNTSELQILLNEGIMLRRLKSEVLGQLPEKRREVILL-----ASKFLEKASLKRHADIMMKDNLKSLQR-RGALLEYFHATGKAKIDAIKNYIDDLLESPR-KFLFFAHHSEVLNAVEDQIIK 1337
            ++R  L PFQ  G+ + + R+GRC++AD+MGLGK++Q++G   +Y++EWPLLI+ PSS++  W ++++KWI E  P +I VI    D++      ++ + + ++ Y L++  +  L+      NFKV+I+DESH++KS    R++  +P+ +KA R  LL+GTPAL RP E+F QI+ + P  + G + ++  RYC+     +G     +  G+SN +EL  LL++ IM+RRLK+EVL QLP K R+ I       A+K L   S +    IM   N  +++   G +   F  T  AK  A+K+YI  +L++   KFL FAHH  +L A  + +I+
Sbjct:   32 RLRAKLLPFQKDGIIFALKRNGRCMVADEMGLGKTIQAIGITYFYKEEWPLLIVVPSSLRYPWTEEIEKWIPELSPEEINVIQNKTDVR-----RMSTSKVTVLGYGLLTADAKTLIDALNNQNFKVVIVDESHYMKSRNATRSRILLPIVQKARRAILLTGTPALGRPEELFMQIEALFPQKF-GRWTDYAKRYCNAHIRYFGKRPQWDCRGASNLNELHQLLSD-IMIRRLKTEVLTQLPPKVRQRIPFDLPSAAAKEL-NTSFEEWEKIMRTPNSGAMETVMGLITRMFKQTAIAKAGAVKDYIKMMLQNDSLKFLVFAHHLSMLQACTEAVIE 360          

HSP 2 Score: 89.7373 bits (221), Expect = 2.602e-78
Identity = 52/104 (50.00%), Postives = 71/104 (68.27%), Query Frame = 2
Query: 1337 KIGYVRIDGNVTSENKRVRTEKFQTDESIQIAILSXXXXXXXXXXXXXXXXVFGELFWNPGILLQAENRCHRIGQKDYVNIHYLVAEQTADDYIWPLVQSKMEL 1648
            K  Y+RIDG+V+S  +     +FQ D   ++AILSI AAG G+T TAA+ VVF EL+W+PG + QAE+R HRIGQ   VNIHYL+A  T D  +W ++  K ++
Sbjct:  362 KTRYIRIDGSVSSSERIHLVNQFQKDPDTRVAILSIQAAGQGLTFTAASHVVFAELYWDPGHIKQAEDRAHRIGQCSSVNIHYLIANGTLDTLMWGMLNRKAQV 465          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 vs. Ensembl Celegans
Match: smrc-1 (SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q8MNV7])

HSP 1 Score: 238.81 bits (608), Expect = 4.408e-91
Identity = 152/418 (36.36%), Postives = 231/418 (55.26%), Query Frame = 3
Query:  126 YNERVINVIKSIKSSEYDQNTRKWNILLTKYKETVTALNKLGILDITL--LPNYVIKIFNHKINNLTLPPDPISRVSDENYLKVDAKIRESLFPFQVQGVKYMIGRHGRCLLADDMGLGKSVQSLGAASYYRDEWPLLIISPSSVKMAWRDQVKKWITEPVDILVIDTSKDIKHENFEHLNKNSIILVSYDLVSRLSSHLLKFNFKVIIMDESHFIKSGLTARAKGCIPLAKKANRLFLLSGTPALSRPSEMFTQIDVIAPSLYNGYFKEFGNRYCDPQFTNWGINYNGSSNTSELQILLNEGIMLRRLKSEVLGQLPEKRREVILLASKFLEKAS---LKRHADIMMKDNLKSLQRR-GALLEYFHATGKAKIDAIKNYIDDLLES-------PRKFLFFAHHSEVLNAVEDQIIKK 1340
            ++  VI++IK + S  YD   R W +  + +      L     + + L  LP  +I + N K         P +  SD N + +D  + E LFP+Q +GV + + R GR LLAD+MGLGKSVQ+L  A YY+ +WPLLI+ P+SVK AW+ Q+  +      I ++D S D   +       N++ ++SY+ +      L K  ++ II DESH +K G   R K    L+K A  + LLSGTPALSRPSE+FTQI +I   L+   F EF  RYCD +   +     G +N+ EL  ++ + +M+RRLK++VL  LPEKRREV+ ++   ++       K  AD    + + S++R+  +LLE++  TG  K  A+  +I   LE+       PRK L FAHH  VL+ ++ ++ K+
Sbjct:  115 FHSAVIDLIKQVPSRNYDPAKRSWTVASSDHITISNILKNATAVKVELEPLPQNIIGLTNFK---------PKAAPSDLNTV-MDPSLIERLFPYQKEGVIFALERDGRILLADEMGLGKSVQALTIARYYKADWPLLIVCPASVKGAWKKQLNTFFPIIHRIFIVDKSSDPLPDV---CTSNTVAIMSYEQMVLKHDILKKEKYRTIIFDESHMLKDGKARRTKVATDLSKVALHVILLSGTPALSRPSELFTQIRLIDHKLFTN-FHEFAIRYCDGKQGRFCFEAKGCTNSEELAAIMFKRLMIRRLKADVLKDLPEKRREVVYVSGPTIDARMDDLQKARADY---EKVNSMERKHESLLEFYSLTGIVKAAAVCEHI---LENYFYPDAPPRKVLIFAHHQIVLDTIQVEVNKR 512          

HSP 2 Score: 116.701 bits (291), Expect = 4.408e-91
Identity = 63/126 (50.00%), Postives = 94/126 (74.60%), Query Frame = 2
Query: 1328 NYQKIGYVRIDGNVTSENKRVRTEKFQTDESIQIAILSXXXXXXXXXXXXXXXXVFGELFWNPGILLQAENRCHRIGQKDYVNIHYLVAEQTADDYIWPLVQSKMELLTKVGLNKENFKNSDTKRL 1705
            N +K+G +RIDG   S  +    + FQTD++I++A+LSI AAG GITLTAA++VVF E+ +NPG L+QAE+R HR+GQKD V + YL+A++TADD +W +VQ K+++L +V L+ + F+ +D   L
Sbjct:  510 NKRKLGSIRIDGKTPSHRRTALCDSFQTDDNIRVAVLSITAAGVGITLTAASVVVFAEIHFNPGYLVQAEDRAHRVGQKDSVFVQYLIAKKTADDVMWNMVQQKLDVLGQVSLSSDTFRTADKMHL 635          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 vs. Ensembl Celegans
Match: smrc-1 (SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q8MNV7])

HSP 1 Score: 238.81 bits (608), Expect = 4.556e-91
Identity = 152/418 (36.36%), Postives = 231/418 (55.26%), Query Frame = 3
Query:  126 YNERVINVIKSIKSSEYDQNTRKWNILLTKYKETVTALNKLGILDITL--LPNYVIKIFNHKINNLTLPPDPISRVSDENYLKVDAKIRESLFPFQVQGVKYMIGRHGRCLLADDMGLGKSVQSLGAASYYRDEWPLLIISPSSVKMAWRDQVKKWITEPVDILVIDTSKDIKHENFEHLNKNSIILVSYDLVSRLSSHLLKFNFKVIIMDESHFIKSGLTARAKGCIPLAKKANRLFLLSGTPALSRPSEMFTQIDVIAPSLYNGYFKEFGNRYCDPQFTNWGINYNGSSNTSELQILLNEGIMLRRLKSEVLGQLPEKRREVILLASKFLEKAS---LKRHADIMMKDNLKSLQRR-GALLEYFHATGKAKIDAIKNYIDDLLES-------PRKFLFFAHHSEVLNAVEDQIIKK 1340
            ++  VI++IK + S  YD   R W +  + +      L     + + L  LP  +I + N K         P +  SD N + +D  + E LFP+Q +GV + + R GR LLAD+MGLGKSVQ+L  A YY+ +WPLLI+ P+SVK AW+ Q+  +      I ++D S D   +       N++ ++SY+ +      L K  ++ II DESH +K G   R K    L+K A  + LLSGTPALSRPSE+FTQI +I   L+   F EF  RYCD +   +     G +N+ EL  ++ + +M+RRLK++VL  LPEKRREV+ ++   ++       K  AD    + + S++R+  +LLE++  TG  K  A+  +I   LE+       PRK L FAHH  VL+ ++ ++ K+
Sbjct:  116 FHSAVIDLIKQVPSRNYDPAKRSWTVASSDHITISNILKNATAVKVELEPLPQNIIGLTNFK---------PKAAPSDLNTV-MDPSLIERLFPYQKEGVIFALERDGRILLADEMGLGKSVQALTIARYYKADWPLLIVCPASVKGAWKKQLNTFFPIIHRIFIVDKSSDPLPDV---CTSNTVAIMSYEQMVLKHDILKKEKYRTIIFDESHMLKDGKARRTKVATDLSKVALHVILLSGTPALSRPSELFTQIRLIDHKLFTN-FHEFAIRYCDGKQGRFCFEAKGCTNSEELAAIMFKRLMIRRLKADVLKDLPEKRREVVYVSGPTIDARMDDLQKARADY---EKVNSMERKHESLLEFYSLTGIVKAAAVCEHI---LENYFYPDAPPRKVLIFAHHQIVLDTIQVEVNKR 513          

HSP 2 Score: 116.701 bits (291), Expect = 4.556e-91
Identity = 63/126 (50.00%), Postives = 94/126 (74.60%), Query Frame = 2
Query: 1328 NYQKIGYVRIDGNVTSENKRVRTEKFQTDESIQIAILSXXXXXXXXXXXXXXXXVFGELFWNPGILLQAENRCHRIGQKDYVNIHYLVAEQTADDYIWPLVQSKMELLTKVGLNKENFKNSDTKRL 1705
            N +K+G +RIDG   S  +    + FQTD++I++A+LSI AAG GITLTAA++VVF E+ +NPG L+QAE+R HR+GQKD V + YL+A++TADD +W +VQ K+++L +V L+ + F+ +D   L
Sbjct:  511 NKRKLGSIRIDGKTPSHRRTALCDSFQTDDNIRVAVLSITAAGVGITLTAASVVVFAEIHFNPGYLVQAEDRAHRVGQKDSVFVQYLIAKKTADDVMWNMVQQKLDVLGQVSLSSDTFRTADKMHL 636          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 vs. Ensembl Celegans
Match: smrc-1 (SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q8MNV7])

HSP 1 Score: 238.81 bits (608), Expect = 4.710e-91
Identity = 152/418 (36.36%), Postives = 231/418 (55.26%), Query Frame = 3
Query:  126 YNERVINVIKSIKSSEYDQNTRKWNILLTKYKETVTALNKLGILDITL--LPNYVIKIFNHKINNLTLPPDPISRVSDENYLKVDAKIRESLFPFQVQGVKYMIGRHGRCLLADDMGLGKSVQSLGAASYYRDEWPLLIISPSSVKMAWRDQVKKWITEPVDILVIDTSKDIKHENFEHLNKNSIILVSYDLVSRLSSHLLKFNFKVIIMDESHFIKSGLTARAKGCIPLAKKANRLFLLSGTPALSRPSEMFTQIDVIAPSLYNGYFKEFGNRYCDPQFTNWGINYNGSSNTSELQILLNEGIMLRRLKSEVLGQLPEKRREVILLASKFLEKAS---LKRHADIMMKDNLKSLQRR-GALLEYFHATGKAKIDAIKNYIDDLLES-------PRKFLFFAHHSEVLNAVEDQIIKK 1340
            ++  VI++IK + S  YD   R W +  + +      L     + + L  LP  +I + N K         P +  SD N + +D  + E LFP+Q +GV + + R GR LLAD+MGLGKSVQ+L  A YY+ +WPLLI+ P+SVK AW+ Q+  +      I ++D S D   +       N++ ++SY+ +      L K  ++ II DESH +K G   R K    L+K A  + LLSGTPALSRPSE+FTQI +I   L+   F EF  RYCD +   +     G +N+ EL  ++ + +M+RRLK++VL  LPEKRREV+ ++   ++       K  AD    + + S++R+  +LLE++  TG  K  A+  +I   LE+       PRK L FAHH  VL+ ++ ++ K+
Sbjct:  119 FHSAVIDLIKQVPSRNYDPAKRSWTVASSDHITISNILKNATAVKVELEPLPQNIIGLTNFK---------PKAAPSDLNTV-MDPSLIERLFPYQKEGVIFALERDGRILLADEMGLGKSVQALTIARYYKADWPLLIVCPASVKGAWKKQLNTFFPIIHRIFIVDKSSDPLPDV---CTSNTVAIMSYEQMVLKHDILKKEKYRTIIFDESHMLKDGKARRTKVATDLSKVALHVILLSGTPALSRPSELFTQIRLIDHKLFTN-FHEFAIRYCDGKQGRFCFEAKGCTNSEELAAIMFKRLMIRRLKADVLKDLPEKRREVVYVSGPTIDARMDDLQKARADY---EKVNSMERKHESLLEFYSLTGIVKAAAVCEHI---LENYFYPDAPPRKVLIFAHHQIVLDTIQVEVNKR 516          

HSP 2 Score: 116.701 bits (291), Expect = 4.710e-91
Identity = 63/126 (50.00%), Postives = 94/126 (74.60%), Query Frame = 2
Query: 1328 NYQKIGYVRIDGNVTSENKRVRTEKFQTDESIQIAILSXXXXXXXXXXXXXXXXVFGELFWNPGILLQAENRCHRIGQKDYVNIHYLVAEQTADDYIWPLVQSKMELLTKVGLNKENFKNSDTKRL 1705
            N +K+G +RIDG   S  +    + FQTD++I++A+LSI AAG GITLTAA++VVF E+ +NPG L+QAE+R HR+GQKD V + YL+A++TADD +W +VQ K+++L +V L+ + F+ +D   L
Sbjct:  514 NKRKLGSIRIDGKTPSHRRTALCDSFQTDDNIRVAVLSITAAGVGITLTAASVVVFAEIHFNPGYLVQAEDRAHRVGQKDSVFVQYLIAKKTADDVMWNMVQQKLDVLGQVSLSSDTFRTADKMHL 639          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 vs. Ensembl Celegans
Match: swsn-4 (SWI/SNF nucleosome remodeling complex component; SWI2/SNF2-like protein [Source:UniProtKB/TrEMBL;Acc:G5EF53])

HSP 1 Score: 87.0409 bits (214), Expect = 2.772e-17
Identity = 72/263 (27.38%), Postives = 130/263 (49.43%), Query Frame = 3
Query:  393 LFPFQVQGVKYMIGRHGRCL---LADDMGLGKSVQSLGAASYY----RDEWPLLIISPSSVKMAWRDQVKKWITEPVDILVIDTSKDIKHENFEHLNKNS--IILVSYDLVSRLSSHLLKFNFKVIIMDESHFIKS---GLTARAKGCIPLAKKANRLFLLSGTPALSRPSEMFTQIDVIAPSLYN--GYFKEFGNRYCDPQFTNWGINYNGSSNTSELQILLNE------GIMLRRLKSEVLGQLPEKRREVILLASKFLEK 1121
            L P+Q++G+++M+  +   L   LAD+MGLGK++Q++   +Y     ++  P L+I P S    W+++  KW    V  ++   +KD +      + K +  +++ +Y+ V +  + L K  +K +I+DE H +K+    LT    G       A    LL+GTP  ++  E++  ++ + PS+++  G F+++ N      F   G       N  E  +++          +LRRLK EV  QLP+K   VI      L+K
Sbjct:  533 LKPYQIKGLEWMVSLYNNNLNGILADEMGLGKTIQTISLVTYLMEVKQNNGPYLVIVPLSTLSNWQNEFAKWAPS-VTTIIYKGTKDARRRVEGQIRKGAFNVLMTTYEYVIKEKALLGKIRWKYMIIDEGHRLKNHNCKLTLMLNGFF----HAQHRLLLTGTPLQNKLPELWALLNFLLPSIFSSCGTFEQWFN----APFATTGEKV--ELNQEETMLIIRRLHKVLRPFLLRRLKKEVESQLPDKTEYVIKCDQSALQK 784          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 vs. Ensembl Celegans
Match: Y116A8C.13 (pep chromosome:WBcel235:IV:16950066:16962868:1 gene:WBGene00013792.1 transcript:Y116A8C.13b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y116A8C.13)

HSP 1 Score: 83.5741 bits (205), Expect = 1.990e-16
Identity = 83/296 (28.04%), Postives = 132/296 (44.59%), Query Frame = 3
Query:  363 LKVDAKIRESLFPFQVQGVKYMIGRHGR----------CLLADDMGLGKSVQSLGAASYYRDEWPL--------------LIISPSSVKMAWRDQVKKW---ITEPVDILVIDTSKDIKHENFEHLNKNSIILVSYDLVSRLSSHLLKFNFKVIIMDESHFIKSGLTARAKGCIPLAKKANRLFLLSGTPALSRPSEMFTQIDVIAPSLYNGYFKEFGNRYCDPQFTNWGINYNGSSNTSELQILLNEGIMLRRLKSEV-LGQLPEKRREVILLASKFLEKASLKRHADIMMKDNL 1166
            + VD +    L P Q  G++++  R  R           +LADDMGLGKS+Q++ A       W L              LII PSS+   W+ +  KW   +  P  I +  T+ DI       +     +++SYDL  R    L    F V++ DE H +K+ L  + +  + L+ +  R  +L+GTP  +   E ++ +D + PS++ G   EF  + C             S    +L  L++E  MLRR  ++V L  LPEK   ++  A+  ++K       D M  D L
Sbjct:   83 VTVDTRFARHLRPHQKSGIQFIFDRLRRGSGKNGGGGGAILADDMGLGKSLQTMAAT------WALLKGSKTAQQLANSCLIIVPSSLVNNWKAEFDKWWRLMRFPAVIAL--TANDITTYQ-STIKLMPYLVISYDLAQRHVEKLKIIRFDVMVCDEGHKLKN-LDGKLRKTL-LSLEIPRRLILTGTPMQNDFEEFYSLLDFVRPSVF-GSIVEF-RKMC-------------SDRPEQLNELIDE-CMLRRTAADVDLKHLPEKHEYILFCAASPIQKHVHSEICDYMTGDAL 351          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 vs. Ensembl Fly
Match: Marcal1 (gene:FBgn0031655 transcript:FBtr0078992)

HSP 1 Score: 224.942 bits (572), Expect = 3.512e-82
Identity = 139/426 (32.63%), Postives = 228/426 (53.52%), Query Frame = 3
Query:   72 IPTSLVLYSHERFEI-IIGYNERVINVIKSIKSSEYDQNTRKWNILLTKYKETVTALNKLG-ILDITLLPNYVIKIFNHKINNLTLPPDPISRVSDENYL-KVDAKIRESLFPFQVQGVKYMIGRHGRCLLADDMGLGKSVQSLGAASYYRDEWPLLIISPSSVKMAWRDQVKKWITE-PVDILVIDTSKDIKHENFEHLNKNSIILVSYDLVSRLSSHLLKFNFKVIIMDESHFIKSGLTARAKGCIPLAKKANRLFLLSGTPALSRPSEMFTQIDVIAPSLYNGYFKEFGNRYCDPQFTNWGINYNGSSNTSELQILLNEGIMLRRLKSEVLGQLPEKRREVILLASKFL-EKASLKRHADIMMKDNLKSLQRRGA---LLEYFHATGKAKIDAIKNYIDDLLESPRKFLFFAHHSEVLNAVED 1325
            I  +L L S  RF     GY+E+++ V K++ +  YD  TR W+  L+ Y+   T    L   + +  +P  V+ +          PP     V + + L  ++ K+ + L PFQ  GV + I + GR ++ D+MGLGK+ Q+L  A Y++D+WPLL+ + +S + +W   +   + + P+  +       + + N  ++ +  +++ SY+++ R    L++  F  II DESH +K+           L  +A R+ LLSGTPALSRP E+FTQ+ +I     N  F EF  RYCD + + +G + NG SN  EL+++L+   MLRR K EVL QL EK RE ++L    +   A  K   D   K+ LK+ + R     LL ++  T + K  A+  Y+  L++  +KF+ FAHH  +++A+ D
Sbjct:  148 ITCNLYLISTHRFAAQTSGYHEQLVTVFKNMPTKCYDGQTRIWSFDLSDYQSLKTHAADLKPYVHMNGIPKKVLDLCGQ-------PP----VVPERSVLASIEPKLADQLMPFQQDGVCFAIAQKGRIMICDEMGLGKTYQALAVADYFKDDWPLLVCTTASTRDSWAKHIMDLLPKVPIHYV------QVLNNNQLYVGEAKVLITSYNMMERHEDKLMQRKFGFIIFDESHTLKNSKAKCTTTAKRLTDQAKRVVLLSGTPALSRPLELFTQLQMIDGKFMN--FMEFTTRYCDGKQSTFGWDANGQSNLEELKVILHLKYMLRRTKVEVLPQLAEKNRETVVLDPALVWTNAETKETLDAFNKE-LKTAKGRATEEILLRFYARTAEVKTRAVCAYLKTLVKEQKKFIIFAHHRVMMDAISD 553          

HSP 2 Score: 101.293 bits (251), Expect = 3.512e-82
Identity = 60/141 (42.55%), Postives = 89/141 (63.12%), Query Frame = 2
Query: 1337 KIGYVRIDGNVTSENKRVRTEKFQTDESIQIAILSXXXXXXXXXXXXXXXXVFGELFWNPGILLQAENRCHRIGQKDYVNIHYLVAEQTADDYIWPLVQSKMELLTKVGLNKENFKNS-------DTKRLEESFSEKDTNT 1738
            K+ Y+RIDG   S+++    + FQ   S ++A+LS+ A  +GITLTAA ++VF EL WNP  L QAE+R HRIGQ   V   YL+A  TADD IW ++++K E+L+KVG+  EN + +        + ++EE FS   + +
Sbjct:  559 KVHYIRIDGQTRSDHRSDSVDTFQKKSSCKVALLSLKACNSGITLTAAEIIVFAELDWNPSTLAQAESRAHRIGQTKPVICRYLIAHNTADDIIWNMLKNKQEVLSKVGIFAENLQKATHTAAPTSSHKIEEYFSPSTSTS 699          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 vs. Ensembl Fly
Match: dom (gene:FBgn0020306 transcript:FBtr0342890)

HSP 1 Score: 85.8853 bits (211), Expect = 9.125e-17
Identity = 68/249 (27.31%), Postives = 126/249 (50.60%), Query Frame = 3
Query:  381 IRESLFPFQVQGVKYMIGRHGRCL---LADDMGLGKSVQSLGAASYY---RDEW-PLLIISPSSVKMAWRDQVKKWITEPVDILVIDTSKD--IKHENFEHLNKNSIILVSYDLVSRLSSHLLKFNFKVIIMDESHFIKSGLTARAKGCIPLAKKANRLFLLSGTPALSRPSEMFTQIDVIAPSLYNGYFKEFGNRYCDPQ--FTNWGINYNGSSNTSELQILLNEGIMLRRLKSEVLGQLPEKRREVI 1094
            ++ SL  +Q  G+ +++  + R L   LAD+MGLGK++Q++   ++    +  W P LI+ PSSV + W  + KKW      +    + K+  +K   +   N   + + SY LV +      +  +K +I+DE+  IK+  + R +  + L     R  LL+GTP  +   E+++ +  + P +++ + +EF   + +P        + YN +  T   +++     +LRRLK EV  Q+P+K   VI
Sbjct:  945 LKHSLREYQHIGLDWLVTMNERKLNGILADEMGLGKTIQTIALLAHLACAKGNWGPHLIVVPSSVMLNWEMEFKKWCPGFKILTYYGSQKERKLKRVGWTKPNAFHVCITSYKLVVQDQQSFRRKKWKYLILDEAQNIKNFKSQRWQ--LLLNFSTERRLLLTGTPLQNDLMELWSLMHFLMPYVFSSH-REFKEWFSNPMTGMIEGNMEYNETLITRLHKVI--RPFLLRRLKKEVEKQMPKKYEHVI 1188          

HSP 2 Score: 63.929 bits (154), Expect = 5.414e-10
Identity = 54/149 (36.24%), Postives = 79/149 (53.02%), Query Frame = 2
Query: 1328 NYQKIGYVRIDGNVTSENKRVRTEKFQTDESIQIAILSXXXXXXXXXXXXXXXXVFGELFWNPGILLQAENRCHRIGQKDYVNIHYLVAEQTADDYIWPLVQSKMELLTKVGLNKEN-----FKNSDTKRL--------EESFSEKDTN 1735
            NY    Y+R+DG+   E +++  E+F  D+ I   ILS  + G GI LT A  V+F +  WNP +  QA++RCHRIGQ   V+I+ LV+E+T +  I      K  +L+ + +   N     FK+S  K L        +ES  EK  N
Sbjct: 1730 NYHGHIYLRLDGSTRVEQRQILMERFNGDKRIFCFILSTRSGGVGINLTGADTVIFYDSDWNPTMDAQAQDRCHRIGQTRDVHIYRLVSERTIEVNILKKANQK-RMLSDMAIEGGNFTTTYFKSSTIKDLFTMEQSEQDESSQEKSEN 1877          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 vs. Ensembl Fly
Match: dom (gene:FBgn0020306 transcript:FBtr0071603)

HSP 1 Score: 85.8853 bits (211), Expect = 1.001e-16
Identity = 68/249 (27.31%), Postives = 126/249 (50.60%), Query Frame = 3
Query:  381 IRESLFPFQVQGVKYMIGRHGRCL---LADDMGLGKSVQSLGAASYY---RDEW-PLLIISPSSVKMAWRDQVKKWITEPVDILVIDTSKD--IKHENFEHLNKNSIILVSYDLVSRLSSHLLKFNFKVIIMDESHFIKSGLTARAKGCIPLAKKANRLFLLSGTPALSRPSEMFTQIDVIAPSLYNGYFKEFGNRYCDPQ--FTNWGINYNGSSNTSELQILLNEGIMLRRLKSEVLGQLPEKRREVI 1094
            ++ SL  +Q  G+ +++  + R L   LAD+MGLGK++Q++   ++    +  W P LI+ PSSV + W  + KKW      +    + K+  +K   +   N   + + SY LV +      +  +K +I+DE+  IK+  + R +  + L     R  LL+GTP  +   E+++ +  + P +++ + +EF   + +P        + YN +  T   +++     +LRRLK EV  Q+P+K   VI
Sbjct:  910 LKHSLREYQHIGLDWLVTMNERKLNGILADEMGLGKTIQTIALLAHLACAKGNWGPHLIVVPSSVMLNWEMEFKKWCPGFKILTYYGSQKERKLKRVGWTKPNAFHVCITSYKLVVQDQQSFRRKKWKYLILDEAQNIKNFKSQRWQ--LLLNFSTERRLLLTGTPLQNDLMELWSLMHFLMPYVFSSH-REFKEWFSNPMTGMIEGNMEYNETLITRLHKVI--RPFLLRRLKKEVEKQMPKKYEHVI 1153          

HSP 2 Score: 63.5438 bits (153), Expect = 6.466e-10
Identity = 54/149 (36.24%), Postives = 79/149 (53.02%), Query Frame = 2
Query: 1328 NYQKIGYVRIDGNVTSENKRVRTEKFQTDESIQIAILSXXXXXXXXXXXXXXXXVFGELFWNPGILLQAENRCHRIGQKDYVNIHYLVAEQTADDYIWPLVQSKMELLTKVGLNKEN-----FKNSDTKRL--------EESFSEKDTN 1735
            NY    Y+R+DG+   E +++  E+F  D+ I   ILS  + G GI LT A  V+F +  WNP +  QA++RCHRIGQ   V+I+ LV+E+T +  I      K  +L+ + +   N     FK+S  K L        +ES  EK  N
Sbjct: 1695 NYHGHIYLRLDGSTRVEQRQILMERFNGDKRIFCFILSTRSGGVGINLTGADTVIFYDSDWNPTMDAQAQDRCHRIGQTRDVHIYRLVSERTIEVNILKKANQK-RMLSDMAIEGGNFTTTYFKSSTIKDLFTMEQSEQDESSQEKSEN 1842          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 vs. Ensembl Fly
Match: dom (gene:FBgn0020306 transcript:FBtr0071602)

HSP 1 Score: 85.8853 bits (211), Expect = 1.026e-16
Identity = 68/249 (27.31%), Postives = 126/249 (50.60%), Query Frame = 3
Query:  381 IRESLFPFQVQGVKYMIGRHGRCL---LADDMGLGKSVQSLGAASYY---RDEW-PLLIISPSSVKMAWRDQVKKWITEPVDILVIDTSKD--IKHENFEHLNKNSIILVSYDLVSRLSSHLLKFNFKVIIMDESHFIKSGLTARAKGCIPLAKKANRLFLLSGTPALSRPSEMFTQIDVIAPSLYNGYFKEFGNRYCDPQ--FTNWGINYNGSSNTSELQILLNEGIMLRRLKSEVLGQLPEKRREVI 1094
            ++ SL  +Q  G+ +++  + R L   LAD+MGLGK++Q++   ++    +  W P LI+ PSSV + W  + KKW      +    + K+  +K   +   N   + + SY LV +      +  +K +I+DE+  IK+  + R +  + L     R  LL+GTP  +   E+++ +  + P +++ + +EF   + +P        + YN +  T   +++     +LRRLK EV  Q+P+K   VI
Sbjct:  910 LKHSLREYQHIGLDWLVTMNERKLNGILADEMGLGKTIQTIALLAHLACAKGNWGPHLIVVPSSVMLNWEMEFKKWCPGFKILTYYGSQKERKLKRVGWTKPNAFHVCITSYKLVVQDQQSFRRKKWKYLILDEAQNIKNFKSQRWQ--LLLNFSTERRLLLTGTPLQNDLMELWSLMHFLMPYVFSSH-REFKEWFSNPMTGMIEGNMEYNETLITRLHKVI--RPFLLRRLKKEVEKQMPKKYEHVI 1153          

HSP 2 Score: 63.5438 bits (153), Expect = 6.039e-10
Identity = 54/149 (36.24%), Postives = 79/149 (53.02%), Query Frame = 2
Query: 1328 NYQKIGYVRIDGNVTSENKRVRTEKFQTDESIQIAILSXXXXXXXXXXXXXXXXVFGELFWNPGILLQAENRCHRIGQKDYVNIHYLVAEQTADDYIWPLVQSKMELLTKVGLNKEN-----FKNSDTKRL--------EESFSEKDTN 1735
            NY    Y+R+DG+   E +++  E+F  D+ I   ILS  + G GI LT A  V+F +  WNP +  QA++RCHRIGQ   V+I+ LV+E+T +  I      K  +L+ + +   N     FK+S  K L        +ES  EK  N
Sbjct: 1695 NYHGHIYLRLDGSTRVEQRQILMERFNGDKRIFCFILSTRSGGVGINLTGADTVIFYDSDWNPTMDAQAQDRCHRIGQTRDVHIYRLVSERTIEVNILKKANQK-RMLSDMAIEGGNFTTTYFKSSTIKDLFTMEQSEQDESSQEKSEN 1842          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 vs. Ensembl Fly
Match: kis (gene:FBgn0266557 transcript:FBtr0299837)

HSP 1 Score: 82.8037 bits (203), Expect = 9.506e-16
Identity = 82/337 (24.33%), Postives = 151/337 (44.81%), Query Frame = 3
Query:  390 SLFPFQVQGVKYM----IGRHGRCLLADDMGLGKSVQSLG---AASYYRDEWPLLIISPSSVKMAWRDQVKKWITEPVDILVIDTSKDIKHENFEHLNKN------------SIILVSYDLVSRLSSHLLKFNFKVIIMDESHFIKSGLTARAKGCIPLAKKANRLFLLSGTPALSRPSEMFTQIDVIAPSLYNG---YFKEFGNRYCDPQFTNWGINYNGSSNTSELQILLNEGIMLRRLKSEVLGQLPEKRREVILLASKFLEKASLKRHADIMMKDNLKSLQRRGALLEYFHATGKAKIDA-IKNYIDDLLESPRKFLFFAHHSEVLNAVEDQI 1331
            SL P+Q++G+ ++       H  C+LAD+MGLGK++QSL    +   Y    P L+I+P S    W+ + + W    V +     +     +++E+  K             ++++ +++++      L  FN+++ ++DE+H +K+      +G   L        LLSGTP  +  SE+F+ ++ + PS ++    +  EFG+   + +              ++LQ LL   +MLRRLK +V   L  K   +I +                    N++    RG L + F    K    A I N ++ ++E  +  +    H  +LN  E+QI
Sbjct: 2028 SLRPYQLEGLNWLKFSWYNTHN-CILADEMGLGKTIQSLTFVHSVYEYGIRGPFLVIAPLSTIPNWQREFEGWTDMNVVVYHGSVTSKQMIQDYEYYYKTESGKVLKEPIKFNVLITTFEMIVTDYMDLKAFNWRLCVIDEAHRLKNRNCKLLEGLRQL--NLEHRVLLSGTPLQNNISELFSLLNFLEPSQFSSQEEFMSEFGSLRTEEE-------------VNKLQALLKP-MMLRRLKDDVEKSLAPKEETIIEVELT-----------------NIQKKYYRGILEQNFSFLKKGTTSANIPNLMNTMMELRKCCI----HPYLLNGAEEQI 2326          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 vs. Ensembl Zebrafish
Match: zranb3 (zinc finger, RAN-binding domain containing 3 [Source:ZFIN;Acc:ZDB-GENE-060712-1])

HSP 1 Score: 218.779 bits (556), Expect = 1.807e-78
Identity = 126/343 (36.73%), Postives = 203/343 (59.18%), Query Frame = 3
Query:  378 KIRESLFPFQVQGVKYMIGRHGRCLLADDMGLGKSVQSLGAASYYRDEWPLLIISPSSVKMAWRDQVKKWITE--PVDILVIDTSKDIKHENFEHLNKNSIILVSYDLVSRLSSHLL----KFNFKVIIMDESHFIKSGLTARAKGCIPLAKKANRLFLLSGTPALSRPSEMFTQIDVIAPSLYNGYFKEFGNRYCDPQFTNWGI----NYNGSSNTSELQILLNEGIMLRRLKSEVLGQLPEKRREVILLASKFLEKASLKRHADIMMKDNLKSLQRRGALLE-------YFHATGKAKIDAIKNYIDDLLESPR-KFLFFAHHSEVLNAVEDQIIKKLAMF 1352
            K+RE L PFQ +GV + + R+GRC++AD+MGLGK++Q++  A  ++ EWPLLI+ PSS+K  W ++++KWI E  P DI ++++  D        ++ + + ++ Y L++  +  LL    K  F V+++DESH++KS   AR+K  +P+ + A R  LL+GTPAL RP E+F QID + P  + G + ++ N+YC+  +  +G     +  G+S+  EL   L+E IM+RRLK++VL QLP K R+ I       + A+ +  A     + L S +     +E        +  T  AK  A+K+YI  +LES + KFL FAHH  +L A  + +I+  A +
Sbjct:   29 KLREKLMPFQREGVCFALSRNGRCMIADEMGLGKTIQAISVAYIFKQEWPLLIVVPSSLKYPWIEELEKWIPELDPRDINLVESKTDTM-----SISTSKVTILGYGLLTTDARALLEALNKQQFAVVLVDESHYLKSRNAARSKILVPIIQSAKRAILLTGTPALGRPEELFMQIDALYPRRF-GTWSDYANKYCNAHYRYFGARRQWDCRGASHLDELHKRLSE-IMIRRLKNQVLTQLPPKIRQRIPF--DLPKDAAKEASASFEQWEKLMSSESENQFVEVMSLITHMYKQTAVAKAGAVKDYIKMMLESEQLKFLVFAHHLSMLQACTEAVIEAKAGY 362          

HSP 2 Score: 95.5153 bits (236), Expect = 1.807e-78
Identity = 56/111 (50.45%), Postives = 75/111 (67.57%), Query Frame = 2
Query: 1337 KIGYVRIDGNVTSENKRVRTEKFQTDESIQIAILSXXXXXXXXXXXXXXXXVFGELFWNPGILLQAENRCHRIGQKDYVNIHYLVAEQTADDYIWPLVQSKMELLTKVGLN 1669
            K GY+RIDG+V S  +     +FQ D   ++A+LSI AAG G+T TAA+ VVF EL+WNPG + QAE+R HRIGQ   V+IHYL+A+ T D  +W ++  K E +T   LN
Sbjct:  359 KAGYIRIDGSVPSAERIQLVHRFQNDPDTRVAVLSIQAAGQGLTFTAASHVVFAELYWNPGHIKQAEDRAHRIGQTATVHIHYLIAKGTFDTVMWAMLNRK-ETVTGSALN 468          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 vs. Ensembl Zebrafish
Match: zranb3 (zinc finger, RAN-binding domain containing 3 [Source:ZFIN;Acc:ZDB-GENE-060712-1])

HSP 1 Score: 218.394 bits (555), Expect = 1.915e-78
Identity = 126/343 (36.73%), Postives = 203/343 (59.18%), Query Frame = 3
Query:  378 KIRESLFPFQVQGVKYMIGRHGRCLLADDMGLGKSVQSLGAASYYRDEWPLLIISPSSVKMAWRDQVKKWITE--PVDILVIDTSKDIKHENFEHLNKNSIILVSYDLVSRLSSHLL----KFNFKVIIMDESHFIKSGLTARAKGCIPLAKKANRLFLLSGTPALSRPSEMFTQIDVIAPSLYNGYFKEFGNRYCDPQFTNWGI----NYNGSSNTSELQILLNEGIMLRRLKSEVLGQLPEKRREVILLASKFLEKASLKRHADIMMKDNLKSLQRRGALLE-------YFHATGKAKIDAIKNYIDDLLESPR-KFLFFAHHSEVLNAVEDQIIKKLAMF 1352
            K+RE L PFQ +GV + + R+GRC++AD+MGLGK++Q++  A  ++ EWPLLI+ PSS+K  W ++++KWI E  P DI ++++  D        ++ + + ++ Y L++  +  LL    K  F V+++DESH++KS   AR+K  +P+ + A R  LL+GTPAL RP E+F QID + P  + G + ++ N+YC+  +  +G     +  G+S+  EL   L+E IM+RRLK++VL QLP K R+ I       + A+ +  A     + L S +     +E        +  T  AK  A+K+YI  +LES + KFL FAHH  +L A  + +I+  A +
Sbjct:   31 KLREKLMPFQREGVCFALSRNGRCMIADEMGLGKTIQAISVAYIFKQEWPLLIVVPSSLKYPWIEELEKWIPELDPRDINLVESKTDTM-----SISTSKVTILGYGLLTTDARALLEALNKQQFAVVLVDESHYLKSRNAARSKILVPIIQSAKRAILLTGTPALGRPEELFMQIDALYPRRF-GTWSDYANKYCNAHYRYFGARRQWDCRGASHLDELHKRLSE-IMIRRLKNQVLTQLPPKIRQRIPF--DLPKDAAKEASASFEQWEKLMSSESENQFVEVMSLITHMYKQTAVAKAGAVKDYIKMMLESEQLKFLVFAHHLSMLQACTEAVIEAKAGY 364          

HSP 2 Score: 95.5153 bits (236), Expect = 1.915e-78
Identity = 56/111 (50.45%), Postives = 75/111 (67.57%), Query Frame = 2
Query: 1337 KIGYVRIDGNVTSENKRVRTEKFQTDESIQIAILSXXXXXXXXXXXXXXXXVFGELFWNPGILLQAENRCHRIGQKDYVNIHYLVAEQTADDYIWPLVQSKMELLTKVGLN 1669
            K GY+RIDG+V S  +     +FQ D   ++A+LSI AAG G+T TAA+ VVF EL+WNPG + QAE+R HRIGQ   V+IHYL+A+ T D  +W ++  K E +T   LN
Sbjct:  361 KAGYIRIDGSVPSAERIQLVHRFQNDPDTRVAVLSIQAAGQGLTFTAASHVVFAELYWNPGHIKQAEDRAHRIGQTATVHIHYLIAKGTFDTVMWAMLNRK-ETVTGSALN 470          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 vs. Ensembl Zebrafish
Match: zranb3 (zinc finger, RAN-binding domain containing 3 [Source:ZFIN;Acc:ZDB-GENE-060712-1])

HSP 1 Score: 157.147 bits (396), Expect = 5.567e-43
Identity = 85/221 (38.46%), Postives = 138/221 (62.44%), Query Frame = 3
Query:  462 DMGLGKSVQSLGAASYYRDEWPLLIISPSSVKMAWRDQVKKWITE--PVDILVIDTSKDIKHENFEHLNKNSIILVSYDLVSRLSSHLL----KFNFKVIIMDESHFIKSGLTARAKGCIPLAKKANRLFLLSGTPALSRPSEMFTQIDVIAPSLYNGYFKEFGNRYCDPQFTNWGI----NYNGSSNTSELQILLNEGIMLRRLKSEVLGQLPEKRREVI 1094
             MGLGK++Q++  A  ++ EWPLLI+ PSS+K  W ++++KWI E  P DI ++++  D        ++ + + ++ Y L++  +  LL    K  F V+++DESH++KS   AR+K  +P+ + A R  LL+GTPAL RP E+F QID + P  + G + ++ N+YC+  +  +G     +  G+S+  EL   L+E IM+RRLK++VL QLP K R+ I
Sbjct:    2 QMGLGKTIQAISVAYIFKQEWPLLIVVPSSLKYPWIEELEKWIPELDPRDINLVESKTDTMS-----ISTSKVTILGYGLLTTDARALLEALNKQQFAVVLVDESHYLKSRNAARSKILVPIIQSAKRAILLTGTPALGRPEELFMQIDALYPRRF-GTWSDYANKYCNAHYRYFGARRQWDCRGASHLDELHKRLSE-IMIRRLKNQVLTQLPPKIRQRI 215          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 vs. Ensembl Zebrafish
Match: smarcal1 (pep chromosome:GRCz11:9:52479142:52490579:-1 gene:ENSDARG00000102265.2 transcript:ENSDART00000161667.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:smarcal1)

HSP 1 Score: 141.739 bits (356), Expect = 3.941e-36
Identity = 70/173 (40.46%), Postives = 103/173 (59.54%), Query Frame = 3
Query:   54 KKDTSKIPTSLVLYSHERFEIIIGYNERVINVIKSIKSSEYDQNTRKWNILLTKYKETVTALNKLGILDITLLPNYVIKIFNHKINNLTLPPDPISRVSDENYLKVDAKIRESLFPFQVQGVKYMIGRHGRCLLADDMGLGKSVQSLGAASYYRDEWPLLIISPSSVKMAWRD 572
            +K  + I    VL S  R E+ IGY   VI + K + S  YD  TRKW  LL  Y + +  LN+L  ++   LP+ V++ F+ +    T    P+   +D ++  +D ++  SL PFQ  GV + + R GR LLADDMGLGK+VQ++  A+YYR EWPLL+++PSSV+  W +
Sbjct:  229 QKPGATIKGKCVLVSRSRLEVDIGYQADVIGIFKQMPSKSYDMKTRKWTFLLEDYGKLMADLNELPTVETEPLPHAVLQSFSSQFEK-TESRAPVPPEADLSH--IDPQLTRSLMPFQRDGVNFAVSREGRLLLADDMGLGKTVQAICIAAYYRSEWPLLVVAPSSVRFTWAE 398          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 vs. Ensembl Zebrafish
Match: btaf1 (BTAF1 RNA polymerase II, B-TFIID transcription factor-associated [Source:ZFIN;Acc:ZDB-GENE-021025-1])

HSP 1 Score: 92.0485 bits (227), Expect = 1.315e-18
Identity = 81/270 (30.00%), Postives = 126/270 (46.67%), Query Frame = 3
Query:  354 ENYLKVDAKIRESLFPFQVQGVKYMI-----GRHGRCLLADDMGLGKSVQS---------LGAASYYR----DEWPL--LIISPSSVKMAWRDQVKKWITEPVDILVIDTSKDIKHENFEH-LNKNSIILVSYDLVSRLSSHLLKFNFKVIIMDESHFIKSGLTARAKGCIPLAKKANRLFLLSGTPALSRPSEMFTQIDVIAPSLYNGYFKEFGNRYCDPQFTNWGINYNGSSNTSELQILLNEGI-------MLRRLKSEVLGQLPEK 1079
            ENY K+   I+  L  +Q  GV ++        HG  +L DDMGLGK++QS         L A  Y R    D  PL  +++ P ++   W D+V K+ ++     +  T    +    +H + K+++I+ SYD+V           F   I+DE H IK+G T  +K    L   AN   +LSGTP  +   E+++  D + P  + G  ++F  RY  P   +   +   SS   E  +L  E +       +LRR+K +VL  LP K
Sbjct: 1260 ENY-KIPVPIKAELRKYQQDGVNWLAFLNKYKLHG--ILCDDMGLGKTLQSICILAGDHFLRAQEYTRTKAPDSCPLPSIVVCPPTLTGHWVDEVGKFCSKEFLNPLHYTGPPTERARLQHQVKKHNLIVASYDVVRNDVEFFRDIKFNYCILDEGHVIKNGKTKLSKAIKQLT--ANYRLILSGTPIQNNVLELWSLFDFLMPG-FLGTERQFAARYGKPILASR--DAKSSSREQEAGVLAMEALHRQVLPFLLRRMKDDVLQDLPPK 1521          

HSP 2 Score: 61.2326 bits (147), Expect = 4.130e-9
Identity = 49/140 (35.00%), Postives = 78/140 (55.71%), Query Frame = 2
Query: 1340 IGYVRIDGNVTSENKRVRTEKFQTDESIQIAILSXXXXXXXXXXXXXXXXVFGELFWNPGILLQAENRCHRIGQKDYVNIHYLVAEQTADDYIWPLVQSKMELLTKVGLNKEN--FKNSDTKRLEESFS-EKDTNTKILD 1750
            + Y+R+DG+V +  +     +F  D SI + +L+    G G+ LT A  VVF E  WNP   LQA +R HRIGQK  VN++ L+   T ++ I  L + KM +   V +++EN   ++  T++L   F+ +KD   +  D
Sbjct: 1678 VTYLRLDGSVQAGLRHSIVSRFNNDPSIDVLLLTTHVGGLGLNLTGADTVVFVEHDWNPMRDLQAMDRAHRIGQKRVVNVYRLITRGTLEEKIMGLQKFKMTIANTV-ISQENASLQSMGTEQLLNLFTLDKDDKAEKCD 1816          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 vs. Ensembl Xenopus
Match: ankrd6 (ankyrin repeat domain 6 [Source:Xenbase;Acc:XB-GENE-478656])

HSP 1 Score: 303.523 bits (776), Expect = 1.035e-115
Identity = 173/425 (40.71%), Postives = 269/425 (63.29%), Query Frame = 3
Query:   84 LVLYSHERFEIIIGYNERVINVIKSIKSSEYDQNTRKWNILLTKYKETVTALNKLGILDITLLPNYVIKIFNHKINNLTLPPDPISRVSDENYLKVDAKIRESLFPFQVQGVKYMIGRHGRCLLADDMGLGKSVQSLGAASYYRDEWPLLIISPSSVKMAWRDQVKKWITE--PVDILVIDTSKDIKHENFEHLNKNSIILVSYDLVSRLSSHLLKFNFKVIIMDESHFIKSGLTARAKGCIPLAKKANRLFLLSGTPALSRPSEMFTQIDVIAPSLYNGYFKEFGNRYCDPQFTNWGINYNGSSNTSELQILLNEGIMLRRLKSEVLGQLPEKRREVILLASKFL--EKASLKRHADIMMKDNLKS-LQRRGALLEYFHATGKAKIDAIKNYIDDLLESPR-KFLFFAHHSEVLNAVEDQIIKK 1340
             +L S  RFE+ IGY+  +I + K + +  YD  TRKW+ +L  Y++ + ++  +  +++  LP  V++ F  +    T+  + I  V   +  +VD+K+  +L PFQ  GV + + R GR LLADDMGLGK++Q++  A+YYR EWPL +++PSSV+  W +  ++W+    P  + VI T +D +  +        I +VS+DL+ ++   +    F+VII+DESHF+K+  TAR K  +PL K A R+ LLSGTPA+SRP+E++TQI  + PS +   F +FG RYCD +   WG +Y+GSSN +EL++LL E IM+RRLKSEVL QLP K+R+++++A + +  +  +    A   M    KS +Q + ALL +++ T +AKI ++  YI DLLES R KFL FAHH  VL+ + +++ KK
Sbjct:  339 CILVSRSRFEMEIGYHAEIIGLFKQMNTRNYDTKTRKWSFMLEDYQKLMESVRNIQQVEVEPLPRPVLQAFAPQFGKTTIIREEIPEV---DLSQVDSKLGSNLMPFQRDGVNFAVSREGRLLLADDMGLGKTIQAICIAAYYRKEWPL-VVAPSSVRFTWAEAFQRWLPSIRPESVNVIVTGRDSQSASL-------INIVSFDLLGKMDKQIAA-TFQVIIIDESHFLKNVKTARCKAAMPLLKSAKRVMLLSGTPAMSRPAELYTQIAAVRPSFFP-RFHDFGIRYCDAKQMPWGWDYSGSSNLNELKLLLEESIMIRRLKSEVLSQLPAKQRKMVVVAPEGITAKTKAALAAAAKEMAKGFKSKVQEKEALLLFYNRTAEAKIRSVLEYIMDLLESGREKFLVFAHHKLVLDHICEELGKK 750          

HSP 2 Score: 135.576 bits (340), Expect = 1.035e-115
Identity = 73/146 (50.00%), Postives = 101/146 (69.18%), Query Frame = 2
Query: 1340 IGYVRIDGNVTSENKRVRTEKFQTDESIQIAILSXXXXXXXXXXXXXXXXVFGELFWNPGILLQAENRCHRIGQKDYVNIHYLVAEQTADDYIWPLVQSKMELLTKVGLNKENFKNSDTKRLEESFSEKDTNTKILDYFQSDFIED 1777
            + Y+RIDGN +S +++    KFQ  E   +A+LSI AA  G+TL++A LVVF ELFWNPG+L+QAE+R HRIGQ   VNIHYLVA+ TADDY+WP++Q K+++L + GL++ NF  S+T    + F +      I D FQ  F E+
Sbjct:  752 VPYIRIDGNTSSADRQSLCHKFQMSEKSCVAVLSITAANMGLTLSSADLVVFAELFWNPGVLIQAEDRVHRIGQTSSVNIHYLVAKGTADDYLWPMIQEKIKVLGQAGLSEANF--SETTESTDYFYKDPKQKTIYDLFQRSFSEE 895          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 vs. Ensembl Xenopus
Match: ankrd6 (ankyrin repeat domain 6 [Source:Xenbase;Acc:XB-GENE-478656])

HSP 1 Score: 286.574 bits (732), Expect = 1.287e-110
Identity = 166/432 (38.43%), Postives = 260/432 (60.19%), Query Frame = 3
Query:   54 KKDTSKIPTSLVLYSHERFEIIIGYNERVINVIKSIKSSEYDQNTRKWNILLTKYKETVTALNKLGILDITLLPNYVIKIFNHKINNLTLPPDPISRVSDENYLKVDAKIRESLFPFQVQGVKYMIGRHGRCLLADDMGLGKSVQSLGAASYYRDEWPLLIISPSSVKMAWRDQVKKWIT--EPVDILVIDTSKDIKHENFEHLNKNSIILVSYDLVSRLSSHLLKFNFKVIIMDESHFIKSGLTARAKGCIPLAKKANRLFLLSGTPALSRPSEMFTQIDVIAPSLYNGYFKEFGNRYCDPQFTNWGINYNGSSNTSELQILLNEGIMLRRLKSEVLGQLPEKRREVILLASKFLEKASLKRHADIMMKDNLKSLQRRGALLEYFHATGKAKIDAIKNYIDDLLESPR-KFLFFAHHSEVLNAVEDQIIKK 1340
            ++ ++ +    +L S  RFE+ IGY+  +I + K + +  YD  TRKW+ +L  Y++ + ++  +  +++  LP  V++ F  +    T+  + I  V   +  +VD+K+  +L PFQ  GV + + R GR LLADDMGLGK++Q++  A+YYR EW             W +  ++W+    P  + VI T +D +  +        I +VS+DL+ ++   +    F+VII+DESHF+K+  TAR K  +PL K A R+ LLSGTPA+SRP+E++TQI  + PS +   F +FG RYCD +   WG +Y+GSSN +EL++LL E IM+RRLKSEVL QLP K+R+++++A +            I  K   K +Q + ALL +++ T +AKI ++  YI DLLES R KFL FAHH  VL+ + +++ KK
Sbjct:  254 QRPSATLRGRCILVSRSRFEMEIGYHAEIIGLFKQMNTRNYDTKTRKWSFMLEDYQKLMESVRNIQQVEVEPLPRPVLQAFAPQFGKTTIIREEIPEV---DLSQVDSKLGSNLMPFQRDGVNFAVSREGRLLLADDMGLGKTIQAICIAAYYRKEW-----------FTWAEAFQRWLPSIRPESVNVIVTGRDSQSASL-------INIVSFDLLGKMDKQIAA-TFQVIIIDESHFLKNVKTARCKAAMPLLKSAKRVMLLSGTPAMSRPAELYTQIAAVRPSFFP-RFHDFGIRYCDAKQMPWGWDYSGSSNLNELKLLLEESIMIRRLKSEVLSQLPAKQRKMVVVAPE-----------GITAKTKAK-VQEKEALLLFYNRTAEAKIRSVLEYIMDLLESGREKFLVFAHHKLVLDHICEELGKK 650          

HSP 2 Score: 135.576 bits (340), Expect = 1.287e-110
Identity = 73/146 (50.00%), Postives = 101/146 (69.18%), Query Frame = 2
Query: 1340 IGYVRIDGNVTSENKRVRTEKFQTDESIQIAILSXXXXXXXXXXXXXXXXVFGELFWNPGILLQAENRCHRIGQKDYVNIHYLVAEQTADDYIWPLVQSKMELLTKVGLNKENFKNSDTKRLEESFSEKDTNTKILDYFQSDFIED 1777
            + Y+RIDGN +S +++    KFQ  E   +A+LSI AA  G+TL++A LVVF ELFWNPG+L+QAE+R HRIGQ   VNIHYLVA+ TADDY+WP++Q K+++L + GL++ NF  S+T    + F +      I D FQ  F E+
Sbjct:  652 VPYIRIDGNTSSADRQSLCHKFQMSEKSCVAVLSITAANMGLTLSSADLVVFAELFWNPGVLIQAEDRVHRIGQTSSVNIHYLVAKGTADDYLWPMIQEKIKVLGQAGLSEANF--SETTESTDYFYKDPKQKTIYDLFQRSFSEE 795          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 vs. Ensembl Xenopus
Match: ankrd6 (ankyrin repeat domain 6 [Source:Xenbase;Acc:XB-GENE-478656])

HSP 1 Score: 283.878 bits (725), Expect = 8.012e-110
Identity = 167/425 (39.29%), Postives = 259/425 (60.94%), Query Frame = 3
Query:   84 LVLYSHERFEIIIGYNERVINVIKSIKSSEYDQNTRKWNILLTKYKETVTALNKLGILDITLLPNYVIKIFNHKINNLTLPPDPISRVSDENYLKVDAKIRESLFPFQVQGVKYMIGRHGRCLLADDMGLGKSVQSLGAASYYRDEWPLLIISPSSVKMAWRDQVKKWITE--PVDILVIDTSKDIKHENFEHLNKNSIILVSYDLVSRLSSHLLKFNFKVIIMDESHFIKSGLTARAKGCIPLAKKANRLFLLSGTPALSRPSEMFTQIDVIAPSLYNGYFKEFGNRYCDPQFTNWGINYNGSSNTSELQILLNEGIMLRRLKSEVLGQLPEKRREVILLASKFL--EKASLKRHADIMMKDNLKS-LQRRGALLEYFHATGKAKIDAIKNYIDDLLESPR-KFLFFAHHSEVLNAVEDQIIKK 1340
             +L S  RFE+ IGY+  +I + K + +  YD  TRKW+ +L  Y++ + ++  +  +++  LP  V++ F  +    T+  + I  V   +  +VD+K+  +L PFQ  GV + + R GR LLADDMGLGK++Q++  A+YYR EW             W +  ++W+    P  + VI T +D +  +        I +VS+DL+ ++   +    F+VII+DESHF+K+  TAR K  +PL K A R+ LLSGTPA+SRP+E++TQI  + PS +   F +FG RYCD +   WG +Y+GSSN +EL++LL E IM+RRLKSEVL QLP K+R+++++A + +  +  +    A   M    KS +Q + ALL +++ T +AKI ++  YI DLLES R KFL FAHH  VL+ + +++ KK
Sbjct:  325 CILVSRSRFEMEIGYHAEIIGLFKQMNTRNYDTKTRKWSFMLEDYQKLMESVRNIQQVEVEPLPRPVLQAFAPQFGKTTIIREEIPEV---DLSQVDSKLGSNLMPFQRDGVNFAVSREGRLLLADDMGLGKTIQAICIAAYYRKEW-----------FTWAEAFQRWLPSIRPESVNVIVTGRDSQSASL-------INIVSFDLLGKMDKQIAA-TFQVIIIDESHFLKNVKTARCKAAMPLLKSAKRVMLLSGTPAMSRPAELYTQIAAVRPSFFP-RFHDFGIRYCDAKQMPWGWDYSGSSNLNELKLLLEESIMIRRLKSEVLSQLPAKQRKMVVVAPEGITAKTKAALAAAAKEMAKGFKSKVQEKEALLLFYNRTAEAKIRSVLEYIMDLLESGREKFLVFAHHKLVLDHICEELGKK 726          

HSP 2 Score: 135.576 bits (340), Expect = 8.012e-110
Identity = 73/146 (50.00%), Postives = 101/146 (69.18%), Query Frame = 2
Query: 1340 IGYVRIDGNVTSENKRVRTEKFQTDESIQIAILSXXXXXXXXXXXXXXXXVFGELFWNPGILLQAENRCHRIGQKDYVNIHYLVAEQTADDYIWPLVQSKMELLTKVGLNKENFKNSDTKRLEESFSEKDTNTKILDYFQSDFIED 1777
            + Y+RIDGN +S +++    KFQ  E   +A+LSI AA  G+TL++A LVVF ELFWNPG+L+QAE+R HRIGQ   VNIHYLVA+ TADDY+WP++Q K+++L + GL++ NF  S+T    + F +      I D FQ  F E+
Sbjct:  728 VPYIRIDGNTSSADRQSLCHKFQMSEKSCVAVLSITAANMGLTLSSADLVVFAELFWNPGVLIQAEDRVHRIGQTSSVNIHYLVAKGTADDYLWPMIQEKIKVLGQAGLSEANF--SETTESTDYFYKDPKQKTIYDLFQRSFSEE 871          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 vs. Ensembl Xenopus
Match: ankrd6 (ankyrin repeat domain 6 [Source:Xenbase;Acc:XB-GENE-478656])

HSP 1 Score: 283.493 bits (724), Expect = 1.117e-109
Identity = 167/425 (39.29%), Postives = 259/425 (60.94%), Query Frame = 3
Query:   84 LVLYSHERFEIIIGYNERVINVIKSIKSSEYDQNTRKWNILLTKYKETVTALNKLGILDITLLPNYVIKIFNHKINNLTLPPDPISRVSDENYLKVDAKIRESLFPFQVQGVKYMIGRHGRCLLADDMGLGKSVQSLGAASYYRDEWPLLIISPSSVKMAWRDQVKKWITE--PVDILVIDTSKDIKHENFEHLNKNSIILVSYDLVSRLSSHLLKFNFKVIIMDESHFIKSGLTARAKGCIPLAKKANRLFLLSGTPALSRPSEMFTQIDVIAPSLYNGYFKEFGNRYCDPQFTNWGINYNGSSNTSELQILLNEGIMLRRLKSEVLGQLPEKRREVILLASKFL--EKASLKRHADIMMKDNLKS-LQRRGALLEYFHATGKAKIDAIKNYIDDLLESPR-KFLFFAHHSEVLNAVEDQIIKK 1340
             +L S  RFE+ IGY+  +I + K + +  YD  TRKW+ +L  Y++ + ++  +  +++  LP  V++ F  +    T+  + I  V   +  +VD+K+  +L PFQ  GV + + R GR LLADDMGLGK++Q++  A+YYR EW             W +  ++W+    P  + VI T +D +  +        I +VS+DL+ ++   +    F+VII+DESHF+K+  TAR K  +PL K A R+ LLSGTPA+SRP+E++TQI  + PS +   F +FG RYCD +   WG +Y+GSSN +EL++LL E IM+RRLKSEVL QLP K+R+++++A + +  +  +    A   M    KS +Q + ALL +++ T +AKI ++  YI DLLES R KFL FAHH  VL+ + +++ KK
Sbjct:  320 CILVSRSRFEMEIGYHAEIIGLFKQMNTRNYDTKTRKWSFMLEDYQKLMESVRNIQQVEVEPLPRPVLQAFAPQFGKTTIIREEIPEV---DLSQVDSKLGSNLMPFQRDGVNFAVSREGRLLLADDMGLGKTIQAICIAAYYRKEW-----------FTWAEAFQRWLPSIRPESVNVIVTGRDSQSASL-------INIVSFDLLGKMDKQIAA-TFQVIIIDESHFLKNVKTARCKAAMPLLKSAKRVMLLSGTPAMSRPAELYTQIAAVRPSFFP-RFHDFGIRYCDAKQMPWGWDYSGSSNLNELKLLLEESIMIRRLKSEVLSQLPAKQRKMVVVAPEGITAKTKAALAAAAKEMAKGFKSKVQEKEALLLFYNRTAEAKIRSVLEYIMDLLESGREKFLVFAHHKLVLDHICEELGKK 721          

HSP 2 Score: 135.191 bits (339), Expect = 1.117e-109
Identity = 73/146 (50.00%), Postives = 101/146 (69.18%), Query Frame = 2
Query: 1340 IGYVRIDGNVTSENKRVRTEKFQTDESIQIAILSXXXXXXXXXXXXXXXXVFGELFWNPGILLQAENRCHRIGQKDYVNIHYLVAEQTADDYIWPLVQSKMELLTKVGLNKENFKNSDTKRLEESFSEKDTNTKILDYFQSDFIED 1777
            + Y+RIDGN +S +++    KFQ  E   +A+LSI AA  G+TL++A LVVF ELFWNPG+L+QAE+R HRIGQ   VNIHYLVA+ TADDY+WP++Q K+++L + GL++ NF  S+T    + F +      I D FQ  F E+
Sbjct:  723 VPYIRIDGNTSSADRQSLCHKFQMSEKSCVAVLSITAANMGLTLSSADLVVFAELFWNPGVLIQAEDRVHRIGQTSSVNIHYLVAKGTADDYLWPMIQEKIKVLGQAGLSEANF--SETTESTDYFYKDPKQKTIYDLFQRSFSEE 866          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 vs. Ensembl Xenopus
Match: ankrd6 (ankyrin repeat domain 6 [Source:Xenbase;Acc:XB-GENE-478656])

HSP 1 Score: 282.722 bits (722), Expect = 2.000e-109
Identity = 168/435 (38.62%), Postives = 262/435 (60.23%), Query Frame = 3
Query:   54 KKDTSKIPTSLVLYSHERFEIIIGYNERVINVIKSIKSSEYDQNTRKWNILLTKYKETVTALNKLGILDITLLPNYVIKIFNHKINNLTLPPDPISRVSDENYLKVDAKIRESLFPFQVQGVKYMIGRHGRCLLADDMGLGKSVQSLGAASYYRDEWPLLIISPSSVKMAWRDQVKKWITE--PVDILVIDTSKDIKHENFEHLNKNSIILVSYDLVSRLSSHLLKFNFKVIIMDESHFIKSGLTARAKGCIPLAKKANRLFLLSGTPALSRPSEMFTQIDVIAPSLYNGYFKEFGNRYCDPQFTNWGINYNGSSNTSELQILLNEGIMLRRLKSEVLGQLPEKRREVILLASKFL--EKASLKRHADIMMKDNLKS-LQRRGALLEYFHATGKAKIDAIKNYIDDLLESPR-KFLFFAHHSEVLNAVEDQIIKK 1340
            KK +       V ++  RF + +GY+  +I + K+I S  YD  TRKW+ +L  Y++ + ++  +  +++  LP  V++ F  +    T+  + I  V   +  +VD+K+  +L PFQ  GV + + R GR LLADDMGLGK++Q++  A+YYR EW             W +  ++W+    P  + VI T +D +  +        I +VS+DL+ ++   +    F+VII+DESHF+K+  TAR K  +PL K A R+ LLSGTPA+SRP+E++TQI  + PS +   F +FG RYCD +   WG +Y+GSSN +EL++LL E IM+RRLKSEVL QLP K+R+++++A + +  +  +    A   M    KS +Q + ALL +++ T +AKI ++  YI DLLES R KFL FAHH  VL+ + +++ KK
Sbjct:  226 KKASGATRGRCVKHAESRFRVEVGYSAELIALFKTIPSKNYDTKTRKWSFMLEDYQKLMESVRNIQQVEVEPLPRPVLQAFAPQFGKTTIIREEIPEV---DLSQVDSKLGSNLMPFQRDGVNFAVSREGRLLLADDMGLGKTIQAICIAAYYRKEW-----------FTWAEAFQRWLPSIRPESVNVIVTGRDSQSASL-------INIVSFDLLGKMDKQIAA-TFQVIIIDESHFLKNVKTARCKAAMPLLKSAKRVMLLSGTPAMSRPAELYTQIAAVRPSFFP-RFHDFGIRYCDAKQMPWGWDYSGSSNLNELKLLLEESIMIRRLKSEVLSQLPAKQRKMVVVAPEGITAKTKAALAAAAKEMAKGFKSKVQEKEALLLFYNRTAEAKIRSVLEYIMDLLESGREKFLVFAHHKLVLDHICEELGKK 637          

HSP 2 Score: 135.576 bits (340), Expect = 2.000e-109
Identity = 73/146 (50.00%), Postives = 101/146 (69.18%), Query Frame = 2
Query: 1340 IGYVRIDGNVTSENKRVRTEKFQTDESIQIAILSXXXXXXXXXXXXXXXXVFGELFWNPGILLQAENRCHRIGQKDYVNIHYLVAEQTADDYIWPLVQSKMELLTKVGLNKENFKNSDTKRLEESFSEKDTNTKILDYFQSDFIED 1777
            + Y+RIDGN +S +++    KFQ  E   +A+LSI AA  G+TL++A LVVF ELFWNPG+L+QAE+R HRIGQ   VNIHYLVA+ TADDY+WP++Q K+++L + GL++ NF  S+T    + F +      I D FQ  F E+
Sbjct:  639 VPYIRIDGNTSSADRQSLCHKFQMSEKSCVAVLSITAANMGLTLSSADLVVFAELFWNPGVLIQAEDRVHRIGQTSSVNIHYLVAKGTADDYLWPMIQEKIKVLGQAGLSEANF--SETTESTDYFYKDPKQKTIYDLFQRSFSEE 782          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 vs. Ensembl Mouse
Match: Smarcal1 (SWI/SNF related matrix associated, actin dependent regulator of chromatin, subfamily a-like 1 [Source:MGI Symbol;Acc:MGI:1859183])

HSP 1 Score: 306.99 bits (785), Expect = 9.684e-115
Identity = 178/424 (41.98%), Postives = 260/424 (61.32%), Query Frame = 3
Query:   87 VLYSHERFEIIIGYNERVINVIKSIKSSEYDQNTRKWNILLTKYKETVTALNKLGILDITLLPNYVIKIFNHKINNLTLPPDPISRVSDENYLKVDAKIRESLFPFQVQGVKYMIGRHGRCLLADDMGLGKSVQSLGAASYYRDEWPLLIISPSSVKMAWRDQVKKWIT--EPVDILVIDTSKDIKHENFEHLNKNSIILVSYDLVSRLSSHLLKFNFKVIIMDESHFIKSGLTARAKGCIPLAKKANRLFLLSGTPALSRPSEMFTQIDVIAPSLYNGYFKEFGNRYCDPQFTNWGINYNGSSNTSELQILLNEGIMLRRLKSEVLGQLPEKRREVILLASKFLEKASLKRHADI---MMKDNLKSLQRRGALLEYFHATGKAKIDAIKNYIDDLLESPR-KFLFFAHHSEVLNAVEDQIIKK 1340
            +L S  RFE+ IGY+E VI + K ++S  YD  TRKW+ LL ++ + +    +L  + +  LP  V   F  ++   +  P   + V + +   VDAK+  SL PFQ +GV + I + GR LLADDMGLGK+VQ++  A++YR EWPLL++ PSSV+  W     +W+    P +I V+ T K         L    + +VS+DL+ +L    LK  FKV+I+DESHF+K+  TAR +  +P+ K A R+ LLSGTPA+SRP+E++TQI  + P+ +   F  FG RYCD +   WG +Y+GSSN  EL++LL E IMLRRLKS+VL QLP K+R+++++    +   +          M KD  K  Q++ ALL +F+ T +AKI  +  YI DLL+S R KFL FAHH  +L+AV  ++ +K
Sbjct:  295 MLISRVRFEVDIGYSEAVIGLFKQMESRSYDIKTRKWSFLLEEHNKLIARSRELKQVQLDPLPKTVTLAFASQLEKTS--PKLKADVPEADLSGVDAKLVSSLMPFQREGVSFAISKRGRLLLADDMGLGKTVQAICIAAFYRKEWPLLVVVPSSVRFTWEQAFLRWLPSLSPENINVVVTGKG-------RLTAGLVNIVSFDLLCKLERQ-LKTPFKVVIIDESHFLKNIKTARCRAAVPILKVAKRVILLSGTPAMSRPAELYTQIIAVKPTFFP-QFHAFGLRYCDAKRLPWGWDYSGSSNLGELKLLLEEAIMLRRLKSDVLSQLPAKQRKMVVVNPGRISSRAKAALDAAAKEMTKDKTKQ-QQKEALLVFFNRTAEAKIPCVVEYILDLLDSGREKFLVFAHHKVILDAVAKELERK 706          

HSP 2 Score: 127.872 bits (320), Expect = 9.684e-115
Identity = 77/179 (43.02%), Postives = 111/179 (62.01%), Query Frame = 2
Query: 1322 RSNYQKIGYVRIDGNVTSENKRVRTEKFQTDESIQIAILSXXXXXXXXXXXXXXXXVFGELFWNPGILLQAENRCHRIGQKDYVNIHYLVAEQTADDYIWPLVQSKMELLTKVGLNKENFKNSDTKRLEES--FSEKDTNTK-ILDYFQSDFIEDIQFEEFIDLNIEFPQTESKNEYGN 1849
            R N Q   ++RIDG+  S ++  + ++FQ  +   +A+LSI AA  G+T + A LVVF ELFWNPG+L+QAE+R HRIGQ + V+IHYLVA+ TADDY+WPL+Q K+++L + GL++ NF       + E+  +  KD   K I D FQ  F +D    EF++    F    +    GN
Sbjct:  705 RKNVQ---HIRIDGSTPSADREAQCQRFQLSKGHTVALLSITAANMGLTFSTADLVVFAELFWNPGVLIQAEDRVHRIGQTNSVSIHYLVAKGTADDYLWPLIQEKIKVLGEAGLSETNFSE-----MTEATDYVHKDPKQKTIYDLFQQSFEDDGNDMEFLEAAESFELGSTSGTSGN 875          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 vs. Ensembl Mouse
Match: Smarcal1 (SWI/SNF related matrix associated, actin dependent regulator of chromatin, subfamily a-like 1 [Source:MGI Symbol;Acc:MGI:1859183])

HSP 1 Score: 306.99 bits (785), Expect = 9.684e-115
Identity = 178/424 (41.98%), Postives = 260/424 (61.32%), Query Frame = 3
Query:   87 VLYSHERFEIIIGYNERVINVIKSIKSSEYDQNTRKWNILLTKYKETVTALNKLGILDITLLPNYVIKIFNHKINNLTLPPDPISRVSDENYLKVDAKIRESLFPFQVQGVKYMIGRHGRCLLADDMGLGKSVQSLGAASYYRDEWPLLIISPSSVKMAWRDQVKKWIT--EPVDILVIDTSKDIKHENFEHLNKNSIILVSYDLVSRLSSHLLKFNFKVIIMDESHFIKSGLTARAKGCIPLAKKANRLFLLSGTPALSRPSEMFTQIDVIAPSLYNGYFKEFGNRYCDPQFTNWGINYNGSSNTSELQILLNEGIMLRRLKSEVLGQLPEKRREVILLASKFLEKASLKRHADI---MMKDNLKSLQRRGALLEYFHATGKAKIDAIKNYIDDLLESPR-KFLFFAHHSEVLNAVEDQIIKK 1340
            +L S  RFE+ IGY+E VI + K ++S  YD  TRKW+ LL ++ + +    +L  + +  LP  V   F  ++   +  P   + V + +   VDAK+  SL PFQ +GV + I + GR LLADDMGLGK+VQ++  A++YR EWPLL++ PSSV+  W     +W+    P +I V+ T K         L    + +VS+DL+ +L    LK  FKV+I+DESHF+K+  TAR +  +P+ K A R+ LLSGTPA+SRP+E++TQI  + P+ +   F  FG RYCD +   WG +Y+GSSN  EL++LL E IMLRRLKS+VL QLP K+R+++++    +   +          M KD  K  Q++ ALL +F+ T +AKI  +  YI DLL+S R KFL FAHH  +L+AV  ++ +K
Sbjct:  295 MLISRVRFEVDIGYSEAVIGLFKQMESRSYDIKTRKWSFLLEEHNKLIARSRELKQVQLDPLPKTVTLAFASQLEKTS--PKLKADVPEADLSGVDAKLVSSLMPFQREGVSFAISKRGRLLLADDMGLGKTVQAICIAAFYRKEWPLLVVVPSSVRFTWEQAFLRWLPSLSPENINVVVTGKG-------RLTAGLVNIVSFDLLCKLERQ-LKTPFKVVIIDESHFLKNIKTARCRAAVPILKVAKRVILLSGTPAMSRPAELYTQIIAVKPTFFP-QFHAFGLRYCDAKRLPWGWDYSGSSNLGELKLLLEEAIMLRRLKSDVLSQLPAKQRKMVVVNPGRISSRAKAALDAAAKEMTKDKTKQ-QQKEALLVFFNRTAEAKIPCVVEYILDLLDSGREKFLVFAHHKVILDAVAKELERK 706          

HSP 2 Score: 127.872 bits (320), Expect = 9.684e-115
Identity = 77/179 (43.02%), Postives = 111/179 (62.01%), Query Frame = 2
Query: 1322 RSNYQKIGYVRIDGNVTSENKRVRTEKFQTDESIQIAILSXXXXXXXXXXXXXXXXVFGELFWNPGILLQAENRCHRIGQKDYVNIHYLVAEQTADDYIWPLVQSKMELLTKVGLNKENFKNSDTKRLEES--FSEKDTNTK-ILDYFQSDFIEDIQFEEFIDLNIEFPQTESKNEYGN 1849
            R N Q   ++RIDG+  S ++  + ++FQ  +   +A+LSI AA  G+T + A LVVF ELFWNPG+L+QAE+R HRIGQ + V+IHYLVA+ TADDY+WPL+Q K+++L + GL++ NF       + E+  +  KD   K I D FQ  F +D    EF++    F    +    GN
Sbjct:  705 RKNVQ---HIRIDGSTPSADREAQCQRFQLSKGHTVALLSITAANMGLTFSTADLVVFAELFWNPGVLIQAEDRVHRIGQTNSVSIHYLVAKGTADDYLWPLIQEKIKVLGEAGLSETNFSE-----MTEATDYVHKDPKQKTIYDLFQQSFEDDGNDMEFLEAAESFELGSTSGTSGN 875          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 vs. Ensembl Mouse
Match: Zranb3 (zinc finger, RAN-binding domain containing 3 [Source:MGI Symbol;Acc:MGI:1918362])

HSP 1 Score: 231.876 bits (590), Expect = 1.414e-80
Identity = 140/363 (38.57%), Postives = 215/363 (59.23%), Query Frame = 3
Query:  324 PPDPISRVSDENYLKVD---AKIRESLFPFQVQGVKYMIGRHGRCLLADDMGLGKSVQSLGAASYYRDEWPLLIISPSSVKMAWRDQVKKWIT--EPVDILVIDTSKDIKHENFEHLNKNSIILVSYDLVSRLSSHLLKF----NFKVIIMDESHFIKSGLTARAKGCIPLAKKANRLFLLSGTPALSRPSEMFTQIDVIAPSLYNGYFKEFGNRYCDPQFTNWG----INYNGSSNTSELQILLNEGIMLRRLKSEVLGQLPEKRREVILL-----ASKFLEKASLKRHADIMMKDNLKSLQR-RGALLEYFHATGKAKIDAIKNYIDDLLESPR-KFLFFAHHSEVLNAVEDQIIKKLAMF 1352
            P   IS ++ E+Y ++D    K+R  L PFQ  G+ + + R GRC++AD+MGLGK++Q++  A +Y++EWPLLI+ PSS++  W ++++KWI   EP +I V+    DI       +  + + ++ Y L++  +  LL      NF+V+I+DESH++KS   AR+K  +P+ +KA R  LL+GTPAL RP E+F QI+ + P  + G + E+  RYC+     +G     +  G+SN SEL  LLN+ IM+RRLKSEVL QLP K R+ I       A K L  AS +    +M   N  +++   G +   F  T  AK  A+K+YI  LL++   KFL FAHH  +L A  + +I+  + +
Sbjct:   11 PTPQISCLTSESYTQLDFLPDKLRTKLLPFQKDGIVFALRRDGRCMVADEMGLGKTIQAIAIAYFYKEEWPLLIVVPSSLRYPWIEELEKWIPELEPEEINVVMNKTDIG-----RIPGSRVTVLGYGLLTTDAETLLDALNTQNFRVVIVDESHYMKSRTAARSKILLPMVQKARRAILLTGTPALGRPEELFMQIEALFPQKF-GTWIEYAKRYCNAHVRYFGKRRQWDCRGASNLSELHQLLND-IMIRRLKSEVLSQLPPKVRQRIPFDLPPAAVKEL-NASFEEWQKLMRAPNSGAMETVMGLITRMFKQTAIAKAGAVKDYIKMLLQNDSLKFLVFAHHLSMLQACTEAVIESKSRY 365          

HSP 2 Score: 89.3521 bits (220), Expect = 1.414e-80
Identity = 51/101 (50.50%), Postives = 69/101 (68.32%), Query Frame = 2
Query: 1346 YVRIDGNVTSENKRVRTEKFQTDESIQIAILSXXXXXXXXXXXXXXXXVFGELFWNPGILLQAENRCHRIGQKDYVNIHYLVAEQTADDYIWPLVQSKMEL 1648
            Y+RIDG+V S  +     +FQ D   ++AILSI AAG G+T TAA+ VVF EL+W+PG + QAE+R HRIGQ   VNIHYL+A  T D  +W ++  K ++
Sbjct:  365 YIRIDGSVPSSERIHLVNQFQKDPDTRVAILSIQAAGQGLTFTAASHVVFAELYWDPGHIKQAEDRAHRIGQCSSVNIHYLIANGTLDSLMWAMLNRKAQV 465          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 vs. Ensembl Mouse
Match: Zranb3 (zinc finger, RAN-binding domain containing 3 [Source:MGI Symbol;Acc:MGI:1918362])

HSP 1 Score: 231.876 bits (590), Expect = 1.414e-80
Identity = 140/363 (38.57%), Postives = 215/363 (59.23%), Query Frame = 3
Query:  324 PPDPISRVSDENYLKVD---AKIRESLFPFQVQGVKYMIGRHGRCLLADDMGLGKSVQSLGAASYYRDEWPLLIISPSSVKMAWRDQVKKWIT--EPVDILVIDTSKDIKHENFEHLNKNSIILVSYDLVSRLSSHLLKF----NFKVIIMDESHFIKSGLTARAKGCIPLAKKANRLFLLSGTPALSRPSEMFTQIDVIAPSLYNGYFKEFGNRYCDPQFTNWG----INYNGSSNTSELQILLNEGIMLRRLKSEVLGQLPEKRREVILL-----ASKFLEKASLKRHADIMMKDNLKSLQR-RGALLEYFHATGKAKIDAIKNYIDDLLESPR-KFLFFAHHSEVLNAVEDQIIKKLAMF 1352
            P   IS ++ E+Y ++D    K+R  L PFQ  G+ + + R GRC++AD+MGLGK++Q++  A +Y++EWPLLI+ PSS++  W ++++KWI   EP +I V+    DI       +  + + ++ Y L++  +  LL      NF+V+I+DESH++KS   AR+K  +P+ +KA R  LL+GTPAL RP E+F QI+ + P  + G + E+  RYC+     +G     +  G+SN SEL  LLN+ IM+RRLKSEVL QLP K R+ I       A K L  AS +    +M   N  +++   G +   F  T  AK  A+K+YI  LL++   KFL FAHH  +L A  + +I+  + +
Sbjct:   11 PTPQISCLTSESYTQLDFLPDKLRTKLLPFQKDGIVFALRRDGRCMVADEMGLGKTIQAIAIAYFYKEEWPLLIVVPSSLRYPWIEELEKWIPELEPEEINVVMNKTDIG-----RIPGSRVTVLGYGLLTTDAETLLDALNTQNFRVVIVDESHYMKSRTAARSKILLPMVQKARRAILLTGTPALGRPEELFMQIEALFPQKF-GTWIEYAKRYCNAHVRYFGKRRQWDCRGASNLSELHQLLND-IMIRRLKSEVLSQLPPKVRQRIPFDLPPAAVKEL-NASFEEWQKLMRAPNSGAMETVMGLITRMFKQTAIAKAGAVKDYIKMLLQNDSLKFLVFAHHLSMLQACTEAVIESKSRY 365          

HSP 2 Score: 89.3521 bits (220), Expect = 1.414e-80
Identity = 51/101 (50.50%), Postives = 69/101 (68.32%), Query Frame = 2
Query: 1346 YVRIDGNVTSENKRVRTEKFQTDESIQIAILSXXXXXXXXXXXXXXXXVFGELFWNPGILLQAENRCHRIGQKDYVNIHYLVAEQTADDYIWPLVQSKMEL 1648
            Y+RIDG+V S  +     +FQ D   ++AILSI AAG G+T TAA+ VVF EL+W+PG + QAE+R HRIGQ   VNIHYL+A  T D  +W ++  K ++
Sbjct:  365 YIRIDGSVPSSERIHLVNQFQKDPDTRVAILSIQAAGQGLTFTAASHVVFAELYWDPGHIKQAEDRAHRIGQCSSVNIHYLIANGTLDSLMWAMLNRKAQV 465          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 vs. Ensembl Mouse
Match: Chd1l (chromodomain helicase DNA binding protein 1-like [Source:MGI Symbol;Acc:MGI:1915308])

HSP 1 Score: 86.2705 bits (212), Expect = 6.411e-17
Identity = 76/290 (26.21%), Postives = 147/290 (50.69%), Query Frame = 3
Query:  327 PDPISRVSDENYLKVDAKIRESLFPFQVQGVKYMI----GRHGRCLLADDMGLGKSVQSLGAASY----YRDEWPLLIISPSSVKMAWRDQVKKWITEPVDILVIDTSKDIKHENFEHLNKNS---IILVSYDLVSRLSSHLLKFNFKVIIMDESHFIKSGLTARAKGCIPLAKKANRLFLLSGTPALSRPSEMFTQIDVIAPSLY-NGYFKEFGNRYCDPQFTNWGINYNGSSNTSELQILLNEGIMLRRLKSEVLGQLPEKRREVILLASKFLEKASLKRHADIMMKD 1160
            P+P+     E  L+        L  +Q++GV +++     ++G C+L D+MGLGK+ Q++    Y      DE P L++ P SV   W+++++++    +  +     K+ +    + L + S   ++L +Y++  + +S L  F++ V+ +DE+H +K+  +   +     +  A    LL+GTP  +   E+++ + V+ P L+     ++F  RY D +          S + SEL  LL +  +LRR+K++V  +LP+K   V+      L+K   K +  I+MKD
Sbjct:   18 PEPLRTRVQEPDLQQWGLTGIRLRSYQLEGVNWLVQCFHCQNG-CILGDEMGLGKTCQTIALLIYLVGRLNDEGPFLVLCPLSVLSNWKEEMERF-APGLSCVTYTGDKEERARLQQDLRQESGFHVLLTTYEICLKDASFLKSFSWSVLAVDEAHRLKNQSSLLHRTLSEFS--AVFRLLLTGTPIQNSLRELYSLLCVVEPDLFCREQVEDFVQRYQDIE--------KESKSASELHRLL-QPFLLRRVKAQVATELPKKTEVVVYHGMSALQK---KYYKAILMKD 291          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 vs. UniProt/SwissProt
Match: sp|B2ZFP3|SMAL1_DANRE (SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Danio rerio OX=7955 GN=smarcal1 PE=2 SV=1)

HSP 1 Score: 321.242 bits (822), Expect = 6.929e-119
Identity = 184/439 (41.91%), Postives = 267/439 (60.82%), Query Frame = 3
Query:   54 KKDTSKIPTSLVLYSHERFEIIIGYNERVINVIKSIKSSEYDQNTRKWNILLTKYKETVTALNKLGILDITLLPNYVIKIFNHKINNLTLPPDPISRVSDENYLKVDAKIRESLFPFQVQGVKYMIGRHGRCLLADDMGLGKSVQSLGAASYYRDEWPLLIISPSSVKMAWRDQVKKWI--TEPVDILVIDTSKDIKHENFEHLNKNSIILVSYDLVSRLSSHLLKFNFKVIIMDESHFIKSGLTARAKGCIPLAKKANRLFLLSGTPALSRPSEMFTQIDVIAPSLYNGYFKEFGNRYCDPQFTNWGINYNGSSNTSELQILLNEGIMLRRLKSEVLGQLPEKRREVILLASKFLE---KASLKRHADIMMKDNLKSLQRRGALLEYFHATGKAKIDAIKNYIDDLLESPR-KFLFFAHHSEVLNAVEDQIIKKLAMF 1352
            +K  + I    VL S  R E+ IGY   VI + K + S  YD  TRKW  LL  Y + +  LN+L  ++   LP+ V++ F+ +    T    P+   +D ++  +D ++  SL PFQ  GV + + R GR LLADDMGLGK+VQ++  A+YYR EWPLL+++PSSV+  W +  ++W+   +P  I V+   KD        L    I ++SYDL++++        F VIIMDESHF+K+  TAR +  +PL K A R+ LLSGTPA+SRP+E++TQI  + P+L+   F +FG RYCD +   WG +Y+ SSN +EL++LL E +MLRRLKSEVL QLP K+R+V+ + +  +    KA+L   A  + K      Q + ALL +F+ T +AKI AI  YI D+LE  R KFL FAHH  VL+++  ++ +K   F
Sbjct:  229 QKPGATIKGKCVLVSRSRLEVDIGYQADVIGIFKQMPSKSYDMKTRKWTFLLEDYGKLMADLNELPTVETEPLPHAVLQSFSSQFEK-TQSQAPVPPEADLSH--IDPQLTRSLMPFQRDGVNFAVSREGRLLLADDMGLGKTVQAICIAAYYRSEWPLLVVAPSSVRFTWAEAFRRWLPSVKPDSINVVVKGKD-------SLRSGLINIISYDLLNKMDKQPPSSPFNVIIMDESHFLKNMKTARCRAALPLLKTAKRVILLSGTPAMSRPAELYTQIQAVRPALFP-RFHDFGTRYCDAKQLPWGWDYSSSSNLTELKLLLEESLMLRRLKSEVLSQLPAKQRKVVTVTTDGINSRTKAALNAAARELAKGYHNKSQEKEALLVFFNHTAEAKIRAIMEYISDMLECGREKFLVFAHHKLVLDSITKELGEKSISF 656          

HSP 2 Score: 130.568 bits (327), Expect = 6.929e-119
Identity = 72/150 (48.00%), Postives = 104/150 (69.33%), Query Frame = 2
Query: 1334 QKIGYVRIDGNVTSENKRVRTEKFQTDESIQIAILSXXXXXXXXXXXXXXXXVFGELFWNPGILLQAENRCHRIGQKDYVNIHYLVAEQTADDYIWPLVQSKMELLTKVGLNKENF-KNSDTKRLEESFSEKDT-NTKILDYFQSDFIED 1777
            + I ++RIDG+  S  +++  E+FQ  +   +A+LSI AA  G+TL +A LVVF ELFWNPG+L+QAE+R HRIGQ   V+IHYLVA+ TADDY+WP++Q+KM +L +VGL++ N  +N+++     SF  +D     I + FQ  F ED
Sbjct:  652 KSISFIRIDGSTPSAERQLLCERFQASQQSCVAVLSITAANMGLTLHSAALVVFAELFWNPGVLIQAEDRVHRIGQTSNVDIHYLVAKGTADDYLWPMIQAKMNVLEQVGLSESNISENAES----ASFHSRDRQQLTITEMFQRSFDED 797          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 vs. UniProt/SwissProt
Match: sp|Q498E7|SMAL1_XENLA (SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Xenopus laevis OX=8355 GN=smarcal1 PE=2 SV=1)

HSP 1 Score: 311.997 bits (798), Expect = 2.920e-117
Identity = 175/425 (41.18%), Postives = 269/425 (63.29%), Query Frame = 3
Query:   84 LVLYSHERFEIIIGYNERVINVIKSIKSSEYDQNTRKWNILLTKYKETVTALNKLGILDITLLPNYVIKIFNHKINNLTLPPDPISRVSDENYLKVDAKIRESLFPFQVQGVKYMIGRHGRCLLADDMGLGKSVQSLGAASYYRDEWPLLIISPSSVKMAWRDQVKKWITE--PVDILVIDTSKDIKHENFEHLNKNSIILVSYDLVSRLSSHLLKFNFKVIIMDESHFIKSGLTARAKGCIPLAKKANRLFLLSGTPALSRPSEMFTQIDVIAPSLYNGYFKEFGNRYCDPQFTNWGINYNGSSNTSELQILLNEGIMLRRLKSEVLGQLPEKRREVILLASKFLE--KASLKRHADIMMKDNLKS-LQRRGALLEYFHATGKAKIDAIKNYIDDLLESPR-KFLFFAHHSEVLNAVEDQIIKK 1340
             +L S  RFE+ IGY+  +I + K + +  YD  TRKW+ +L  Y++ + ++  +  +++  LP  V++ F  +    T+    ++ + D +   VD+K+  +L PFQ  GV + I R GR LLADDMGLGK++Q++  A+YYR EWPLL+++PSSV+  W +   +W+    P  + VI T +D +  N        I ++S+DL+ ++   +   NFKVII+DESHF+K+  TAR K  +PL K A R+ LLSGTPA+SRP+E++TQI  + P+ +   F +FG RYCD +   WG +Y+GSSN +EL++LL E IM+RRLKSEVL QLP K+R+++++A + +     +    A   M    KS +Q + ALL +++ T +AKI ++  YI DLLES R KFL FAHH  VL+ + +++ KK
Sbjct:  357 CILISRSRFEMEIGYHTEIIGLFKQMNTRNYDTKTRKWSFMLEDYQKLMESVRNIQQVEVEPLPRPVLQAFAPQFEKTTIS---LAEIEDVDLSHVDSKLIGNLMPFQRDGVNFAISREGRLLLADDMGLGKTIQAICIAAYYRKEWPLLVVAPSSVRFTWAEAFHRWLPSLNPESVNVIVTGRDSQSANL-------INIISFDLLGKMDKQIAA-NFKVIIIDESHFLKNVKTARCKAAMPLLKSAKRVMLLSGTPAMSRPAELYTQIAAVRPTFFP-RFHDFGIRYCDAKQMPWGWDYSGSSNLNELKLLLEESIMIRRLKSEVLSQLPAKQRKMVVVAPEGITAKTKAALAAAAKEMAKGFKSKVQEKEALLLFYNRTAEAKIRSVLEYIIDLLESGREKFLVFAHHKLVLDNICEELGKK 769          

HSP 2 Score: 134.42 bits (337), Expect = 2.920e-117
Identity = 73/147 (49.66%), Postives = 102/147 (69.39%), Query Frame = 2
Query: 1334 QKIGYVRIDGNVTSENKRVRTEKFQTDESIQIAILSXXXXXXXXXXXXXXXXVFGELFWNPGILLQAENRCHRIGQKDYVNIHYLVAEQTADDYIWPLVQSKMELLTKVGLNKENFKNSDTKRLEESFSEKDTNTKILDYFQSDFIE 1774
            +++ Y+RIDGN +S +++    KFQ  E   +A+LSI AA  G+TL++A LVVF ELFWNPG+L+QAE+R HRIGQ   VNIHYLVA+ TADDY+WP++Q K+++L + GL++ NF  S+T    + F +      I D FQ  F E
Sbjct:  769 KEVPYIRIDGNTSSADRQSLCHKFQFSEKSCVAVLSITAANMGLTLSSADLVVFAELFWNPGVLIQAEDRVHRIGQTSSVNIHYLVAKGTADDYLWPMIQEKIKVLGQAGLSEANF--SETTESTDYFYKDPKQKTIYDLFQRSFSE 913          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 vs. UniProt/SwissProt
Match: sp|Q0P4U8|SMAL1_XENTR (SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Xenopus tropicalis OX=8364 GN=smarcal1 PE=2 SV=1)

HSP 1 Score: 309.301 bits (791), Expect = 6.380e-117
Identity = 174/425 (40.94%), Postives = 270/425 (63.53%), Query Frame = 3
Query:   84 LVLYSHERFEIIIGYNERVINVIKSIKSSEYDQNTRKWNILLTKYKETVTALNKLGILDITLLPNYVIKIFNHKINNLTLPPDPISRVSDENYLKVDAKIRESLFPFQVQGVKYMIGRHGRCLLADDMGLGKSVQSLGAASYYRDEWPLLIISPSSVKMAWRDQVKKWITE--PVDILVIDTSKDIKHENFEHLNKNSIILVSYDLVSRLSSHLLKFNFKVIIMDESHFIKSGLTARAKGCIPLAKKANRLFLLSGTPALSRPSEMFTQIDVIAPSLYNGYFKEFGNRYCDPQFTNWGINYNGSSNTSELQILLNEGIMLRRLKSEVLGQLPEKRREVILLASKFL--EKASLKRHADIMMKDNLKS-LQRRGALLEYFHATGKAKIDAIKNYIDDLLESPR-KFLFFAHHSEVLNAVEDQIIKK 1340
             +L S  RFE+ IGY+  +I + K + +  YD  TRKW+ +L  Y++ + ++  +  +++  LP  V++ F  +    T+  + I  V   +  +VD+K+  +L PFQ  GV + + R GR LLADDMGLGK++Q++  A+YYR EWPLL+++PSSV+  W +  ++W+    P  + VI T +D +  +        I +VS+DL+ ++   +    F+VII+DESHF+K+  TAR K  +PL K A R+ LLSGTPA+SRP+E++TQI  + PS +   F +FG RYCD +   WG +Y+GSSN +EL++LL E IM+RRLKSEVL QLP K+R+++++A + +  +  +    A   M    KS +Q + ALL +++ T +AKI ++  YI DLLES R KFL FAHH  VL+ + +++ KK
Sbjct:  339 CILVSRSRFEMEIGYHAEIIGLFKQMNTRNYDTKTRKWSFMLEDYQKLMESVRNIQQVEVEPLPRPVLQAFAPQFGKTTIIREEIPEV---DLSQVDSKLGSNLMPFQRDGVNFAVSREGRLLLADDMGLGKTIQAICIAAYYRKEWPLLVVAPSSVRFTWAEAFQRWLPSIRPESVNVIVTGRDSQSASL-------INIVSFDLLGKMDKQIAA-TFQVIIIDESHFLKNVKTARCKAAMPLLKSAKRVMLLSGTPAMSRPAELYTQIAAVRPSFFP-RFHDFGIRYCDAKQMPWGWDYSGSSNLNELKLLLEESIMIRRLKSEVLSQLPAKQRKMVVVAPEGITAKTKAALAAAAKEMAKGFKSKVQEKEALLLFYNRTAEAKIRSVLEYIMDLLESGREKFLVFAHHKLVLDHICEELGKK 751          

HSP 2 Score: 135.576 bits (340), Expect = 6.380e-117
Identity = 73/146 (50.00%), Postives = 101/146 (69.18%), Query Frame = 2
Query: 1340 IGYVRIDGNVTSENKRVRTEKFQTDESIQIAILSXXXXXXXXXXXXXXXXVFGELFWNPGILLQAENRCHRIGQKDYVNIHYLVAEQTADDYIWPLVQSKMELLTKVGLNKENFKNSDTKRLEESFSEKDTNTKILDYFQSDFIED 1777
            + Y+RIDGN +S +++    KFQ  E   +A+LSI AA  G+TL++A LVVF ELFWNPG+L+QAE+R HRIGQ   VNIHYLVA+ TADDY+WP++Q K+++L + GL++ NF  S+T    + F +      I D FQ  F E+
Sbjct:  753 VPYIRIDGNTSSADRQSLCHKFQMSEKSCVAVLSITAANMGLTLSSADLVVFAELFWNPGVLIQAEDRVHRIGQTSSVNIHYLVAKGTADDYLWPMIQEKIKVLGQAGLSEANF--SETTESTDYFYKDPKQKTIYDLFQRSFSEE 896          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 vs. UniProt/SwissProt
Match: sp|Q8BJL0|SMAL1_MOUSE (SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Mus musculus OX=10090 GN=Smarcal1 PE=1 SV=1)

HSP 1 Score: 306.99 bits (785), Expect = 5.880e-114
Identity = 178/424 (41.98%), Postives = 260/424 (61.32%), Query Frame = 3
Query:   87 VLYSHERFEIIIGYNERVINVIKSIKSSEYDQNTRKWNILLTKYKETVTALNKLGILDITLLPNYVIKIFNHKINNLTLPPDPISRVSDENYLKVDAKIRESLFPFQVQGVKYMIGRHGRCLLADDMGLGKSVQSLGAASYYRDEWPLLIISPSSVKMAWRDQVKKWIT--EPVDILVIDTSKDIKHENFEHLNKNSIILVSYDLVSRLSSHLLKFNFKVIIMDESHFIKSGLTARAKGCIPLAKKANRLFLLSGTPALSRPSEMFTQIDVIAPSLYNGYFKEFGNRYCDPQFTNWGINYNGSSNTSELQILLNEGIMLRRLKSEVLGQLPEKRREVILLASKFLEKASLKRHADI---MMKDNLKSLQRRGALLEYFHATGKAKIDAIKNYIDDLLESPR-KFLFFAHHSEVLNAVEDQIIKK 1340
            +L S  RFE+ IGY+E VI + K ++S  YD  TRKW+ LL ++ + +    +L  + +  LP  V   F  ++   +  P   + V + +   VDAK+  SL PFQ +GV + I + GR LLADDMGLGK+VQ++  A++YR EWPLL++ PSSV+  W     +W+    P +I V+ T K         L    + +VS+DL+ +L    LK  FKV+I+DESHF+K+  TAR +  +P+ K A R+ LLSGTPA+SRP+E++TQI  + P+ +   F  FG RYCD +   WG +Y+GSSN  EL++LL E IMLRRLKS+VL QLP K+R+++++    +   +          M KD  K  Q++ ALL +F+ T +AKI  +  YI DLL+S R KFL FAHH  +L+AV  ++ +K
Sbjct:  295 MLISRVRFEVDIGYSEAVIGLFKQMESRSYDIKTRKWSFLLEEHNKLIARSRELKQVQLDPLPKTVTLAFASQLEKTS--PKLKADVPEADLSGVDAKLVSSLMPFQREGVSFAISKRGRLLLADDMGLGKTVQAICIAAFYRKEWPLLVVVPSSVRFTWEQAFLRWLPSLSPENINVVVTGKG-------RLTAGLVNIVSFDLLCKLERQ-LKTPFKVVIIDESHFLKNIKTARCRAAVPILKVAKRVILLSGTPAMSRPAELYTQIIAVKPTFFP-QFHAFGLRYCDAKRLPWGWDYSGSSNLGELKLLLEEAIMLRRLKSDVLSQLPAKQRKMVVVNPGRISSRAKAALDAAAKEMTKDKTKQ-QQKEALLVFFNRTAEAKIPCVVEYILDLLDSGREKFLVFAHHKVILDAVAKELERK 706          

HSP 2 Score: 127.872 bits (320), Expect = 5.880e-114
Identity = 77/179 (43.02%), Postives = 111/179 (62.01%), Query Frame = 2
Query: 1322 RSNYQKIGYVRIDGNVTSENKRVRTEKFQTDESIQIAILSXXXXXXXXXXXXXXXXVFGELFWNPGILLQAENRCHRIGQKDYVNIHYLVAEQTADDYIWPLVQSKMELLTKVGLNKENFKNSDTKRLEES--FSEKDTNTK-ILDYFQSDFIEDIQFEEFIDLNIEFPQTESKNEYGN 1849
            R N Q   ++RIDG+  S ++  + ++FQ  +   +A+LSI AA  G+T + A LVVF ELFWNPG+L+QAE+R HRIGQ + V+IHYLVA+ TADDY+WPL+Q K+++L + GL++ NF       + E+  +  KD   K I D FQ  F +D    EF++    F    +    GN
Sbjct:  705 RKNVQ---HIRIDGSTPSADREAQCQRFQLSKGHTVALLSITAANMGLTFSTADLVVFAELFWNPGVLIQAEDRVHRIGQTNSVSIHYLVAKGTADDYLWPLIQEKIKVLGEAGLSETNFSE-----MTEATDYVHKDPKQKTIYDLFQQSFEDDGNDMEFLEAAESFELGSTSGTSGN 875          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 vs. UniProt/SwissProt
Match: sp|Q9NZC9|SMAL1_HUMAN (SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Homo sapiens OX=9606 GN=SMARCAL1 PE=1 SV=1)

HSP 1 Score: 306.99 bits (785), Expect = 1.480e-112
Identity = 176/426 (41.31%), Postives = 263/426 (61.74%), Query Frame = 3
Query:   87 VLYSHERFEIIIGYNERVINVIKSIKSSEYDQNTRKWNILLTKYKETVTALNKLGILDITLLPNYVIKIFNHKI--NNLTLPPDPISRVSDENYLKVDAKIRESLFPFQVQGVKYMIGRHGRCLLADDMGLGKSVQSLGAASYYRDEWPLLIISPSSVKMAWRDQVKKWIT--EPVDILVIDTSKDIKHENFEHLNKNSIILVSYDLVSRLSSHLLKFNFKVIIMDESHFIKSGLTARAKGCIPLAKKANRLFLLSGTPALSRPSEMFTQIDVIAPSLYNGYFKEFGNRYCDPQFTNWGINYNGSSNTSELQILLNEGIMLRRLKSEVLGQLPEKRREVILLASKFLE---KASLKRHADIMMKDNLKSLQRRGALLEYFHATGKAKIDAIKNYIDDLLESPR-KFLFFAHHSEVLNAVEDQIIKK 1340
            +L S   FE  I Y++ +I + K + S  YD  TRKW+ LL ++ + +  +  L  + +  LP  +   F  ++   +L+L PD    V + +  +VD K+  +L PFQ  GV + I + GR LLADDMGLGK++Q++  A++YR EWPLL++ PSSV+  W     +W+    P  I V+ T KD        L    I +VS+DL+S+L    LK  FKV+I+DESHF+K+  TAR +  +P+ K A R+ LLSGTPA+SRP+E++TQI  + P+ +   F  FG RYCD +   WG +Y+GSSN  EL++LL E +MLRRLKS+VL QLP K+R+++++A   +    +A+L   A  M   +    Q++ AL+ +F+ T +AKI ++  YI DLLES R KFL FAHH  VL+A+  ++ +K
Sbjct:  336 MLISRAYFEADISYSQDLIALFKQMDSRRYDVKTRKWSFLLEEHSKLIAKVRCLPQVQLDPLPTTLTLAFASQLKKTSLSLTPD----VPEADLSEVDPKLVSNLMPFQRAGVNFAIAKGGRLLLADDMGLGKTIQAICIAAFYRKEWPLLVVVPSSVRFTWEQAFLRWLPSLSPDCINVVVTGKD-------RLTAGLINIVSFDLLSKLEKQ-LKTPFKVVIIDESHFLKNSRTARCRAAMPVLKVAKRVILLSGTPAMSRPAELYTQIIAVKPTFFP-QFHAFGLRYCDAKRMPWGWDYSGSSNLGELKLLLEEAVMLRRLKSDVLSQLPAKQRKIVVIAPGRINARTRAALDAAAKEMTTKDKTKQQQKDALILFFNRTAEAKIPSVIEYILDLLESGREKFLVFAHHKVVLDAITQELERK 748          

HSP 2 Score: 123.25 bits (308), Expect = 1.480e-112
Identity = 67/143 (46.85%), Postives = 95/143 (66.43%), Query Frame = 2
Query: 1340 IGYVRIDGNVTSENKRVRTEKFQTDESIQIAILSXXXXXXXXXXXXXXXXVFGELFWNPGILLQAENRCHRIGQKDYVNIHYLVAEQTADDYIWPLVQSKMELLTKVGLNKENFKNSDTKRLEESFSEKDTNTKILDYFQSDF 1768
            + ++RIDG+ +S  +    ++FQ  E   +A+LSI AA  G+T ++A LVVF ELFWNPG+L+QAE+R HRIGQ   V IHYLVA+ TADDY+WPL+Q K+++L + GL++ NF  S+     +   +     KI D FQ  F
Sbjct:  750 VQHIRIDGSTSSAEREDLCQQFQLSERHAVAVLSITAANMGLTFSSADLVVFAELFWNPGVLIQAEDRVHRIGQTSSVGIHYLVAKGTADDYLWPLIQEKIKVLAEAGLSETNF--SEMTESTDYLYKDPKQQKIYDLFQKSF 890          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 vs. TrEMBL
Match: G4VHE4 (Harp (Smarcal1)-related OS=Schistosoma mansoni OX=6183 GN=Smp_131000 PE=3 SV=1)

HSP 1 Score: 374.015 bits (959), Expect = 1.051e-133
Identity = 191/436 (43.81%), Postives = 278/436 (63.76%), Query Frame = 3
Query:   87 VLYSHERFEIIIGYNERVINVIKSIKSSEYDQNTRKWNILLTKYKETVTALNKLGILDITLLPNYVIKIFNHKINNLTLPPDPISRVSDENYLKVDAK---------IRESLFPFQVQGVKYMIGRHGRCLLADDMGLGKSVQSLGAASYYRDEWPLLIISPSSVKMAWRDQVKKWITEPVD-----ILVIDTSKDIKHENFEHLNKNSIILVSYDLVSRLSSHLLKFNFKVIIMDESHFIKSGLTARAKGCIPLAKKANRLFLLSGTPALSRPSEMFTQIDVIAPSLYNGYFKEFGNRYCDPQFTNWGINYNGSSNTSELQILLNEGIMLRRLKSEVLGQLPEKRREVILLASKFLEKASLKRHADIMMKDNLKSLQRRGALLEYFHATGKAKIDAIKNYIDDLLESPRKFLFFAHHSEVLNAVEDQIIKKLAMF 1352
             L S  RFE+   Y+  +  + KS+ S +YD  TR+W+  L++Y E V  +  +  L +  LP  VIKIF  +I   ++ P        +N  ++D           +  +LFPFQ  GV   + R GR LLADDMGLGK++QSL  AS Y  EWPLLII+PSSV+ +WRDQ+ +W+ +P++     I V+++ KDI  ++++  N + I ++SYDL+SR    LLK  + V+I DESHFIK+   AR K   P+ K A R+ LLSGTPA+SRP+E+F QI  I+P+L+ G F EFG RYC  +   WG +Y+G SN +ELQ++L + IM+RR+K++VL QLP KRRE+++L    ++K +L RHA  M+ D L S ++R AL EYFH TG  K+ AI+ Y+ DL+E   KFL FAHH++VL++++  + +K   F
Sbjct:   77 TLCSANRFEVHARYHVGLTQLFKSMDSKQYDSQTRRWSFDLSEYNEFVKKVKNIDELHLEELPYAVIKIFRKRI---SMKPGADDLKDHDNNDEIDHSTLKDRIPDDLLATLFPFQKDGVCLALKRSGRVLLADDMGLGKTIQSLAIASAYYSEWPLLIITPSSVRFSWRDQIIRWLGKPLNLNLTHITVVNSGKDI-MDDWDSFNSSPITIISYDLMSRYGKELLKRRYGVVIADESHFIKNIKAARTKAATPILKWAKRVILLSGTPAMSRPAELFPQISAISPNLFQGGFHEFGLRYCSAKECPWGWDYSGCSNMTELQLVLEKSIMIRRVKADVLSQLPPKRRELVVLDPSVIKKGNLGRHAKTMLTDKLSSKEKRSALFEYFHETGSVKLPAIEQYVLDLIECGHKFLLFAHHTDVLDSLDKLLSEKSIRF 508          

HSP 2 Score: 134.806 bits (338), Expect = 1.051e-133
Identity = 81/155 (52.26%), Postives = 112/155 (72.26%), Query Frame = 2
Query: 1334 QKIGYVRIDGNVTSENKRVRTEKFQTDESIQIAILSXXXXXXXXXXXXXXXXVFGELFWNPGILLQAENRCHRIGQKDYVNIHYLVAEQTADDYIWPLVQSKMELLTKVGLNKENFKNSD-TKRLEESFSEKDTNTKILDYFQSDFIEDIQFEEF 1795
            + I ++RIDG   SE + V  + FQ ++  ++A+LSI AAGTG+ LTAA LV+F ELFWNPG L+QAE+R +RIGQ D V I YL+AEQTADD+IWPLV+ K+++L+K GLN+E F+ +D T RL  +  E+    KILDYF+ +  +   FEE+
Sbjct:  504 KSIRFIRIDGRTNSEQRSVVCQIFQKEDDCRVALLSITAAGTGLHLTAANLVIFAELFWNPGALVQAEDRAYRIGQMDSVLIRYLIAEQTADDFIWPLVERKLDVLSKAGLNRETFRMADSTTRLGSNTLEQQ---KILDYFKKELND---FEEW 652          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 vs. TrEMBL
Match: A0A4E0RVC4 (SWI:SNF matrix associated OS=Fasciola hepatica OX=6192 GN=D915_004081 PE=3 SV=1)

HSP 1 Score: 362.844 bits (930), Expect = 2.921e-133
Identity = 185/424 (43.63%), Postives = 266/424 (62.74%), Query Frame = 3
Query:   90 LYSHERFEIIIGYNERVINVIKSIKSSEYDQNTRKWNILLTKYKETVTALNKLGILDITLLPNYVIKIFNHKINNLTLPPDPISR--VSDENYLKVDAKIRESLFPFQVQGVKYMIGRHGRCLLADDMGLGKSVQSLGAASYYRDEWPLLIISPSSVKMAWRDQVKKWITEPV-----DILVIDTSKDIKHENFEHLNKNSIILVSYDLVSRLSSHLLKFNFKVIIMDESHFIKSGLTARAKGCIPLAKKANRLFLLSGTPALSRPSEMFTQIDVIAPSLYNGYFKEFGNRYCDPQFTNWGINYNGSSNTSELQILLNEGIMLRRLKSEVLGQLPEKRREVILLASKFLEKASLKRHADIMMKDNLKSLQRRGALLEYFHATGKAKIDAIKNYIDDLLESPRKFLFFAHHSEVLNAVEDQIIKK 1340
            L S   FE+   Y+  +  + KS+ + +YD  TRKW+  L+ Y E V     +  + +  LP+ V+KIF   +++    P    +  V   +YL  D  +   L PFQ +GV   + R GR LLADDMGLGK++QSL  A  YR +WPLLI++PSSV+ AWRDQ  +W++ P+     DILV+ T +D+  EN      N I L+SYDL++R S+ +    F ++IMDESHF+K+   AR K  + + K A R+ LLSGTPA+SRP+E++ QI  ++P+++ G F EFG RYC  +   WG +Y+G SN  ELQ+LL   +M+RR K++VL QLP KRRE+++L    +    LKRHA  M    L S Q++ A+LEYFH TG  KI A++ YI DL+E  RKFL +AHH+EVL+A+ + + +K
Sbjct:  141 LVSETMFEVHARYHTGLSELYKSLPTRQYDSKTRKWSFALSDYNEFVKRAKLMPGIVVDGLPSVVLKIFKGSLSSGLAKPKESQKPKVILSDYLPDD--MINYLLPFQREGVSLALARKGRVLLADDMGLGKTIQSLALAVAYRSDWPLLIVTPSSVRFAWRDQCLRWLSGPLQITANDILVVTTGRDL--ENVNRYTANLITLMSYDLMARFSTQIELCRFGMVIMDESHFLKNIKAARTKAALQVVKNAKRVILLSGTPAVSRPAELYPQIQAVSPTIFRGGFHEFGLRYCAAKECPWGWDYSGCSNMVELQLLLESSVMIRRTKADVLHQLPPKRRELVVLDPSIIRSTRLKRHAKAMASTGLSSEQKKSAMLEYFHETGSVKIAALRQYILDLVEVGRKFLLYAHHTEVLDALSNTLSEK 560          

HSP 2 Score: 144.436 bits (363), Expect = 2.921e-133
Identity = 76/148 (51.35%), Postives = 110/148 (74.32%), Query Frame = 2
Query: 1334 QKIGYVRIDGNVTSENKRVRTEKFQTDESIQIAILSXXXXXXXXXXXXXXXXVFGELFWNPGILLQAENRCHRIGQKDYVNIHYLVAEQTADDYIWPLVQSKMELLTKVGLNKENFKNSDTKRLEESFSEKDTNTKILDYFQSDFIED 1777
            + + ++RIDG   SE + V  +KFQ +E+ ++A+LSI AAGTG+ LT+A LVVFGELFWNPG L+QAE+R +RIGQKD V + YL+AE T DDYIWPL++ K+++L+  GLN+E F+ +DT RL  +  E+ +   ILD+ +  F++D
Sbjct:  560 KSVDHIRIDGRTNSEQRSVVCKKFQQEENCRVALLSITAAGTGLNLTSANLVVFGELFWNPGALVQAEDRVYRIGQKDSVVVRYLIAEGTVDDYIWPLIERKLQVLSSAGLNRETFRTADTTRLGPAQPEQQS---ILDFVEHTFVDD 704          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 vs. TrEMBL
Match: A0A504YQ49 (26S proteasome non-ATPase regulatory subunit 14 OS=Fasciola gigantica OX=46835 GN=FGIG_04443 PE=3 SV=1)

HSP 1 Score: 362.844 bits (930), Expect = 2.967e-133
Identity = 185/424 (43.63%), Postives = 266/424 (62.74%), Query Frame = 3
Query:   90 LYSHERFEIIIGYNERVINVIKSIKSSEYDQNTRKWNILLTKYKETVTALNKLGILDITLLPNYVIKIFNHKINNLTLPPDPISR--VSDENYLKVDAKIRESLFPFQVQGVKYMIGRHGRCLLADDMGLGKSVQSLGAASYYRDEWPLLIISPSSVKMAWRDQVKKWITEPV-----DILVIDTSKDIKHENFEHLNKNSIILVSYDLVSRLSSHLLKFNFKVIIMDESHFIKSGLTARAKGCIPLAKKANRLFLLSGTPALSRPSEMFTQIDVIAPSLYNGYFKEFGNRYCDPQFTNWGINYNGSSNTSELQILLNEGIMLRRLKSEVLGQLPEKRREVILLASKFLEKASLKRHADIMMKDNLKSLQRRGALLEYFHATGKAKIDAIKNYIDDLLESPRKFLFFAHHSEVLNAVEDQIIKK 1340
            L S   FE+   Y+  +  + KS+ + +YD  TRKW+  L+ Y E V     +  + +  LP+ V+KIF    ++    P    +  V   +YL  D  +   L PFQ +GV   + R GR LLADDMGLGK++QSL  A  YR +WPLLI++PSSV+ AWRDQ  +W++ P+     DILV+ T +D+  EN      N I L+SYDL++R S+ +    F ++IMDESHF+K+   AR K  + + K A R+ LLSGTPA+SRP+E++ QI  ++P+++ G F EFG RYC  +   WG +Y+G SN +ELQ+LL   +M+RR K++VL QLP KRRE+++L    +    LKRHA  M    L S Q++ A+LEYFH TG  KI A++ YI DL+E  RKFL +AHH+EVL+A+ + + +K
Sbjct:  402 LVSETMFEVHARYHTGLSELYKSLPTRQYDSKTRKWSFALSDYNEFVKRAKLMPGIVVDGLPSIVLKIFKGSFSSGLAKPKESQKPKVILSDYLPDD--MINYLLPFQREGVSLALARKGRVLLADDMGLGKTIQSLALAVAYRSDWPLLIVTPSSVRFAWRDQCLRWLSGPLQITANDILVVTTGRDL--ENVNRYTANLITLMSYDLMARFSTQIELCRFGMVIMDESHFLKNIKAARTKAALQVVKNAKRVILLSGTPAVSRPAELYPQIQAVSPTIFRGGFHEFGLRYCAAKECPWGWDYSGCSNMAELQLLLESSVMIRRTKADVLHQLPPKRRELVVLDPSIIRSTRLKRHAKAMTSTGLSSEQKKSAMLEYFHETGSVKIAALRQYILDLVEVGRKFLLYAHHTEVLDALANTLSEK 821          

HSP 2 Score: 144.821 bits (364), Expect = 2.967e-133
Identity = 76/148 (51.35%), Postives = 111/148 (75.00%), Query Frame = 2
Query: 1334 QKIGYVRIDGNVTSENKRVRTEKFQTDESIQIAILSXXXXXXXXXXXXXXXXVFGELFWNPGILLQAENRCHRIGQKDYVNIHYLVAEQTADDYIWPLVQSKMELLTKVGLNKENFKNSDTKRLEESFSEKDTNTKILDYFQSDFIED 1777
            + + ++RIDG   SE + V  +KFQ +E+ ++A+LSI AAGTG+ LT+A LVVFGELFWNPG L+QAE+R +RIGQKD V + YL+AE T DDYIWPL++ K+++L+  GLN+E F+ +DT RL ++  E+ +   ILD+ +  F++D
Sbjct:  821 KSVDHIRIDGRTNSEQRSVVCKKFQQEENCRVALLSITAAGTGLNLTSANLVVFGELFWNPGALVQAEDRVYRIGQKDSVVVRYLIAEGTVDDYIWPLIERKLQVLSSAGLNRETFRTADTTRLGQAQPEQQS---ILDFVEHTFVDD 965          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 vs. TrEMBL
Match: A0A3Q0KLV0 (Harp (Smarcal1)-related OS=Schistosoma mansoni OX=6183 PE=3 SV=1)

HSP 1 Score: 374.015 bits (959), Expect = 1.019e-131
Identity = 191/436 (43.81%), Postives = 278/436 (63.76%), Query Frame = 3
Query:   87 VLYSHERFEIIIGYNERVINVIKSIKSSEYDQNTRKWNILLTKYKETVTALNKLGILDITLLPNYVIKIFNHKINNLTLPPDPISRVSDENYLKVDAK---------IRESLFPFQVQGVKYMIGRHGRCLLADDMGLGKSVQSLGAASYYRDEWPLLIISPSSVKMAWRDQVKKWITEPVD-----ILVIDTSKDIKHENFEHLNKNSIILVSYDLVSRLSSHLLKFNFKVIIMDESHFIKSGLTARAKGCIPLAKKANRLFLLSGTPALSRPSEMFTQIDVIAPSLYNGYFKEFGNRYCDPQFTNWGINYNGSSNTSELQILLNEGIMLRRLKSEVLGQLPEKRREVILLASKFLEKASLKRHADIMMKDNLKSLQRRGALLEYFHATGKAKIDAIKNYIDDLLESPRKFLFFAHHSEVLNAVEDQIIKKLAMF 1352
             L S  RFE+   Y+  +  + KS+ S +YD  TR+W+  L++Y E V  +  +  L +  LP  VIKIF  +I   ++ P        +N  ++D           +  +LFPFQ  GV   + R GR LLADDMGLGK++QSL  AS Y  EWPLLII+PSSV+ +WRDQ+ +W+ +P++     I V+++ KDI  ++++  N + I ++SYDL+SR    LLK  + V+I DESHFIK+   AR K   P+ K A R+ LLSGTPA+SRP+E+F QI  I+P+L+ G F EFG RYC  +   WG +Y+G SN +ELQ++L + IM+RR+K++VL QLP KRRE+++L    ++K +L RHA  M+ D L S ++R AL EYFH TG  K+ AI+ Y+ DL+E   KFL FAHH++VL++++  + +K   F
Sbjct:  136 TLCSANRFEVHARYHVGLTQLFKSMDSKQYDSQTRRWSFDLSEYNEFVKKVKNIDELHLEELPYAVIKIFRKRI---SMKPGADDLKDHDNNDEIDHSTLKDRIPDDLLATLFPFQKDGVCLALKRSGRVLLADDMGLGKTIQSLAIASAYYSEWPLLIITPSSVRFSWRDQIIRWLGKPLNLNLTHITVVNSGKDI-MDDWDSFNSSPITIISYDLMSRYGKELLKRRYGVVIADESHFIKNIKAARTKAATPILKWAKRVILLSGTPAMSRPAELFPQISAISPNLFQGGFHEFGLRYCSAKECPWGWDYSGCSNMTELQLVLEKSIMIRRVKADVLSQLPPKRRELVVLDPSVIKKGNLGRHAKTMLTDKLSSKEKRSALFEYFHETGSVKLPAIEQYVLDLIECGHKFLLFAHHTDVLDSLDKLLSEKSIRF 567          

HSP 2 Score: 128.257 bits (321), Expect = 1.019e-131
Identity = 71/125 (56.80%), Postives = 96/125 (76.80%), Query Frame = 2
Query: 1334 QKIGYVRIDGNVTSENKRVRTEKFQTDESIQIAILSXXXXXXXXXXXXXXXXVFGELFWNPGILLQAENRCHRIGQKDYVNIHYLVAEQTADDYIWPLVQSKMELLTKVGLNKENFKNSD-TKRL 1705
            + I ++RIDG   SE + V  + FQ ++  ++A+LSI AAGTG+ LTAA LV+F ELFWNPG L+QAE+R +RIGQ D V I YL+AEQTADD+IWPLV+ K+++L+K GLN+E F+ +D T RL
Sbjct:  563 KSIRFIRIDGRTNSEQRSVVCQIFQKEDDCRVALLSITAAGTGLHLTAANLVIFAELFWNPGALVQAEDRAYRIGQMDSVLIRYLIAEQTADDFIWPLVERKLDVLSKAGLNRETFRMADSTTRL 687          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 vs. TrEMBL
Match: A0A183QPK5 (Uncharacterized protein OS=Schistosoma rodhaini OX=6188 PE=3 SV=1)

HSP 1 Score: 370.163 bits (949), Expect = 1.457e-131
Identity = 188/429 (43.82%), Postives = 275/429 (64.10%), Query Frame = 3
Query:  108 FEIIIGYNERVINVIKSIKSSEYDQNTRKWNILLTKYKETVTALNKLGILDITLLPNYVIKIFNHKINNLTLPPDPISRVSDENYLKVDAK---------IRESLFPFQVQGVKYMIGRHGRCLLADDMGLGKSVQSLGAASYYRDEWPLLIISPSSVKMAWRDQVKKWITEPVD-----ILVIDTSKDIKHENFEHLNKNSIILVSYDLVSRLSSHLLKFNFKVIIMDESHFIKSGLTARAKGCIPLAKKANRLFLLSGTPALSRPSEMFTQIDVIAPSLYNGYFKEFGNRYCDPQFTNWGINYNGSSNTSELQILLNEGIMLRRLKSEVLGQLPEKRREVILLASKFLEKASLKRHADIMMKDNLKSLQRRGALLEYFHATGKAKIDAIKNYIDDLLESPRKFLFFAHHSEVLNAVEDQIIKKLAMF 1352
            FE+   Y+  +  + KS+ S +YD  TR+W+  L++Y E V  +  +  L +  LP  V+KIF  +I   ++ P        +N  ++D           +  +LFPFQ  GV   + R GR LLADDMGLGK++QSL  AS Y  EWPLLII+PSSV+ +WRDQ+ +W+ +P++     I V+++ KDI  ++++  N + I ++SYDL+SR    LLK  + V+I DESHFIK+   AR K   P+ K A R+ LLSGTPA+SRP+E+F QI  I+P+L+ G F EFG RYC  +   WG +Y+G SN +ELQ++L + IM+RR+K++VL QLP KRRE+++L    ++K SL RHA  M+ D L S ++R AL EYFH TG  K+ AI+ Y+ DL+E   KFL FAHH++VL++++  + +K   F
Sbjct:   80 FEVHARYHVGLTQLFKSMDSKQYDSQTRRWSFDLSEYNEFVKKVKNIDELHLEELPYAVMKIFRKRI---SMKPGADDLKDHDNNDEIDHSTLKDRIPDDLLATLFPFQKDGVCLALKRSGRVLLADDMGLGKTIQSLAIASAYYSEWPLLIITPSSVRFSWRDQIIRWLGKPLNLNLTHITVVNSGKDI-MDDWDSFNSSPITIISYDLMSRYGKELLKRRYGVVIADESHFIKNIKAARTKAATPILKWAKRVLLLSGTPAMSRPAELFPQISAISPNLFQGGFHEFGLRYCSAKECPWGWDYSGCSNMTELQLVLEKSIMIRRVKADVLSQLPPKRRELVVLDPSIIKKGSLGRHAKTMLADKLSSKEKRSALFEYFHETGSVKLPAIEQYVLDLIECGHKFLLFAHHTDVLDSLDKLLSEKSIRF 504          

HSP 2 Score: 131.724 bits (330), Expect = 1.457e-131
Identity = 80/155 (51.61%), Postives = 111/155 (71.61%), Query Frame = 2
Query: 1334 QKIGYVRIDGNVTSENKRVRTEKFQTDESIQIAILSXXXXXXXXXXXXXXXXVFGELFWNPGILLQAENRCHRIGQKDYVNIHYLVAEQTADDYIWPLVQSKMELLTKVGLNKENFKNSD-TKRLEESFSEKDTNTKILDYFQSDFIEDIQFEEF 1795
            + I ++RIDG   SE + V  + FQ ++  ++A+LSI AAGTG+ LTAA LV+F ELFWNPG L+QAE+R +RIGQ D V I YL+AEQTADD+IWPLV+ K+++L+K GLN+E F+ +D T RL  +  E+    KILD F+ +  +   FEE+
Sbjct:  500 KSIRFIRIDGRTNSEQRSVVCQIFQKEDDCRVALLSITAAGTGLHLTAANLVIFAELFWNPGALVQAEDRAYRIGQMDSVLIRYLIAEQTADDFIWPLVERKLDVLSKAGLNRETFRMADSTTRLGSNTLEQQ---KILDCFKKELND---FEEW 648          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 vs. Ensembl Cavefish
Match: smarcal1 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a like 1 [Source:NCBI gene;Acc:103034271])

HSP 1 Score: 319.701 bits (818), Expect = 5.203e-118
Identity = 182/435 (41.84%), Postives = 262/435 (60.23%), Query Frame = 3
Query:   54 KKDTSKIPTSLVLYSHERFEIIIGYNERVINVIKSIKSSEYDQNTRKWNILLTKYKETVTALNKLGILDITLLPNYVIKIFNHKINNLTLPPDPISRVSDENYLKVDAKIRESLFPFQVQGVKYMIGRHGRCLLADDMGLGKSVQSLGAASYYRDEWPLLIISPSSVKMAWRDQVKKWITEPVD--ILVIDTSKDIKHENFEHLNKNSIILVSYDLVSRLSSHLLKFNFKVIIMDESHFIKSGLTARAKGCIPLAKKANRLFLLSGTPALSRPSEMFTQIDVIAPSLYNGYFKEFGNRYCDPQFTNWGINYNGSSNTSELQILLNEGIMLRRLKSEVLGQLPEKRREVILLASKFLE---KASLKRHADIMMKDNLKSLQRRGALLEYFHATGKAKIDAIKNYIDDLLESPR-KFLFFAHHSEVLNAVEDQIIKK 1340
            +K  + +     L S  R E+ IGY+  VI + K + S  YD  TRKW+ LL  Y   + ALN +  ++I  LP  V++ F+ +           + V + +   VD+ +  SL PFQ  GV + + R GR LLADDMGLGK+VQ++  A+YYR EWPLLI++PSSV+  W +  ++W+       I V+   KD        L    + +VSYDL+ ++    L   F V+IMDESHF+K+  TAR K  +PL K A R+ LLSGTPA+SRP+E++TQI  + P+L+   F +FG RYCD +   WG +Y+GSSN +EL++LL E +MLRRLKSEVL QLP K+R+V+ + +  +    KA+L   A  +       +Q + ALL +F+ T +AKI AI  YI D+LE  R KFL FAHH +VL+++  ++  K
Sbjct:  272 QKPGAMVKGKCTLISRSRLEVDIGYHADVIGIFKQMPSKNYDMKTRKWSFLLEDYGRLLEALNDISAVEIEPLPRAVLQAFSSQFEQSH---SKAAEVPEADLSAVDSTLTRSLMPFQQYGVNFAVSREGRLLLADDMGLGKTVQAICIAAYYRKEWPLLIVTPSSVRFTWAEAFRRWLPSVAADRINVVVKGKD-------SLRSGLVNIVSYDLLGKVDKQHLANPFGVLIMDESHFLKNIKTARCKAALPLLKAAKRVVLLSGTPAMSRPAELYTQILAVRPTLF-PRFHDFGARYCDAKQLPWGWDYSGSSNLTELKLLLEESLMLRRLKSEVLSQLPAKQRKVVTVTTDGINARTKAALSAAAKELANGRHNKMQEKEALLVFFNHTAEAKIRAIMEYISDMLECGREKFLVFAHHKKVLDSISKELTDK 695          

HSP 2 Score: 126.331 bits (316), Expect = 5.203e-118
Identity = 74/147 (50.34%), Postives = 98/147 (66.67%), Query Frame = 2
Query: 1340 IGYVRIDGNVTSENKRVRTEKFQTDESIQIAILSXXXXXXXXXXXXXXXXVFGELFWNPGILLQAENRCHRIGQKDYVNIHYLVAEQTADDYIWPLVQSKMELLTKVGLNKENFKNSDTKRLEESFSEKDTNTK-ILDYFQSDFIED 1777
            + Y+RIDG+  S  ++   E+FQ      +A+LSI AA  G+TL AA LVVF ELFWNPGIL+QAE+R HRIGQ   V+IHYLVA+ TADDY+WP++Q KM +L +VGL++ N  +   K    SF  KD   + I + FQ  F E+
Sbjct:  697 VNYIRIDGSTPSAERQQLCERFQFTHQSCVALLSITAANMGLTLHAADLVVFAELFWNPGILIQAEDRVHRIGQTSCVDIHYLVAKGTADDYLWPMIQEKMNVLEQVGLSESNISD---KAECSSFHSKDPKQQTITEMFQRSFSEE 840          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 vs. Ensembl Cavefish
Match: zranb3 (zinc finger, RAN-binding domain containing 3 [Source:ZFIN;Acc:ZDB-GENE-060712-1])

HSP 1 Score: 206.453 bits (524), Expect = 7.016e-74
Identity = 126/357 (35.29%), Postives = 205/357 (57.42%), Query Frame = 3
Query:  348 SDENYLKVDAKIRESLFPFQVQGVKYMIGRHGRCLLADDMGLGKSVQSLGAASYYRDEWPLLIISPSSVKMAWRDQVKKWITE--PVDILVIDTSKDIKHENFEHLNKNSIILVSYDLVSRLSSHLLKF----NFKVIIMDESHFIKSGLTARAKGCIPLAKKANRLFLLSGTPALSRPSEMFTQIDVIAPSLYNGYFKEFGNRYCDPQFTNWG----INYNGSSNTSELQILLNEGIMLRRLKSEVLGQLPEKRREVILL---------ASKFLEK-ASLKRHADIMMKDNLKSLQR-RGALLEYFHATGKAKIDAIKNYIDDLLESPR-KFLFFAHHSEVLNAVEDQIIKKLAMF 1352
            +DE+ L +  K+++ L  FQ +GVK+ + R GR ++   MGLGK+VQ++  A  YR EWPLLI+ PSS+K  W +++++W+ E  P DI ++++  DI       ++++ + ++ Y L++  +  L++      F ++I+DE+H++KS   AR K  +P+ + A R  LL+GTPAL RP E+F QID + P  + G + ++  +YC+  +  +G     +  G+SN  EL   L+E IM+RRLK+EVL QLP+K R+ I           AS   EK   L R  D     +        G + + +  T  AK  A+K+YI  +LE+ + KFL FAHH  +L A  + +I+  A +
Sbjct:   24 ADEDLLLLPEKLQKRLLQFQREGVKFALSRDGRSVMYITMGLGKTVQAISVAYLYRQEWPLLIVVPSSLKYPWIEELERWVPELRPEDINLVESKADIM-----GISQSKVTVLGYGLLTTDARSLVEVLNQQRFGIVIVDEAHYLKSRNAARTKILVPVIQNAKRAILLTGTPALGRPEELFMQIDALYPRRF-GTWSDYAKKYCNAHYKFFGNRRQWDCRGASNLDELHHRLSE-IMIRRLKAEVLTQLPDKIRQRIPFDLPKEAGKEASMLYEKWERLMRSLDSGESSSENPFSEVMGLITQMYKQTAVAKAGAVKDYIKMMLETEQLKFLVFAHHLSMLQACTEAVIEAKAGY 373          

HSP 2 Score: 92.0485 bits (227), Expect = 7.016e-74
Identity = 57/111 (51.35%), Postives = 76/111 (68.47%), Query Frame = 2
Query: 1337 KIGYVRIDGNVTSENKRVRTEKFQTDESIQIAILSXXXXXXXXXXXXXXXXVFGELFWNPGILLQAENRCHRIGQKDYVNIHYLVAEQTADDYIWPLVQSKMELLTKVGLN 1669
            K GY+RIDG+V S  +     +FQ D   ++AILSI AAG G+TLTAA+ VVF EL+WNPG + QAE+R HRIGQ   V++HYL+A+ T D  +W ++  K E +T   LN
Sbjct:  370 KAGYIRIDGSVPSAERIQLVHRFQNDPDTRVAILSIQAAGQGLTLTAASHVVFAELYWNPGHVKQAEDRAHRIGQTASVHVHYLIAKGTFDMVMWGMLNRK-EKVTGSTLN 479          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 vs. Ensembl Cavefish
Match: chd1l (chromodomain helicase DNA binding protein 1-like [Source:NCBI gene;Acc:393283])

HSP 1 Score: 94.7449 bits (234), Expect = 1.341e-19
Identity = 72/267 (26.97%), Postives = 141/267 (52.81%), Query Frame = 3
Query:  393 LFPFQVQGVKYM---IGRHGRCLLADDMGLGKSVQSLGAASYYRD----EWPLLIISPSSVKMAWRDQVKKWITEPVDILVIDTSKDIKHENFEHLNKNS--IILVSYDLVSRLSSHLLKFNFKVIIMDESHFIKSGLTARAKGCIPLAKKANRLFLLSGTPALSRPSEMFTQIDVIAPSLY-NGYFKEFGNRYCDPQFTNWGINYNGSSNTSELQILLNEGIMLRRLKSEVLGQLPEKRREVILLASKFLEKASLKRHADIMMKDN 1163
            L  +Q+ GVK++   +G    C+L D+MGLGK+ Q++   +Y R     + P L++SP +V   W+ +++++    + ++    +K+ + E    +N     ++L +Y+L  R +  L + N+K++++DE+H +K+  +   +     +   +   LL+GTP  +   E+++ +  I PSL+ +   +EF + Y D Q  +        +   EL  +L +  +LRR+K EV  +LP+K+  V+      L+K   K +  I+MKD 
Sbjct:   34 LRSYQLAGVKWLSEGMGILEGCILGDEMGLGKTCQTISLLAYARGFLGMDGPFLVVSPLTVLENWKQELERFCPS-LSVVCYTGNKEERAELQREINSKQFHVLLTTYELCLRDAQWLKRRNWKILVVDEAHRLKNQASKLHETLSEFS--VDFRLLLTGTPIQNNLQEIYSLLTFIQPSLFPHDATEEFVSSYADVQTED--------TLVKELHKVL-QPFLLRRVKDEVEKKLPQKKELVVYHGMTALQK---KHYKSILMKDT 285          

HSP 2 Score: 53.5286 bits (127), Expect = 8.635e-7
Identity = 41/106 (38.68%), Postives = 63/106 (59.43%), Query Frame = 2
Query: 1343 GYVRIDGNVTSENKRVRTEKFQTDESIQIAILSXXXXXXXXXXXXXXXXVFGELFWNPGILLQAENRCHRIGQKDYVNIHYLVAEQTADDYIWPLVQSKMELLTKV 1660
            GY R+DG+V  E + +  + F+T ++  I +LS  A G G+ LTAA  V+F +  +NP   LQAE R HRIGQ+  V +  L+ + T ++ I+    SK++L   V
Sbjct:  375 GYERLDGSVRGEERNLAIKNFKTKDTF-IFLLSTKAGGVGLNLTAADTVIFVDSDFNPQNDLQAEARAHRIGQERAVKVIRLLGKDTVEEIIYSRAMSKLQLTNTV 479          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 vs. Ensembl Cavefish
Match: btaf1 (B-TFIID TATA-box binding protein associated factor 1 [Source:NCBI gene;Acc:103037828])

HSP 1 Score: 92.8189 bits (229), Expect = 6.823e-19
Identity = 81/270 (30.00%), Postives = 126/270 (46.67%), Query Frame = 3
Query:  354 ENYLKVDAKIRESLFPFQVQGVKYMI-----GRHGRCLLADDMGLGKSVQS---LGAASYYR----------DEWPL--LIISPSSVKMAWRDQVKKWITEPVDILVIDTSKDIKHENFEH-LNKNSIILVSYDLVSRLSSHLLKFNFKVIIMDESHFIKSGLTARAKGCIPLAKKANRLFLLSGTPALSRPSEMFTQIDVIAPSLYNGYFKEFGNRYCDPQFTNWGINYNGSSNTSELQILLNEGI-------MLRRLKSEVLGQLPEK 1079
            ENY K+   I+  L  +Q  GV ++        HG  +L DDMGLGK++QS   L    Y R          D  PL  +++ P ++   W D+V K+ T+     +  T    +    +H + K+++++ SYD+V           F   I+DE H IK+G T  +K    LA  AN   +LSGTP  +   E+++  D + P  + G  ++F  RY  P   +   +   SS   E  +L  E +       +LRR+K +VL  LP K
Sbjct: 1210 ENY-KIPVPIKAELRKYQQDGVNWLAFLNKYKLHG--ILCDDMGLGKTLQSICILAGDHYLRAQEYTKTKAADSCPLPSIVVCPPTLTGHWVDEVGKFCTKEYLNPLHYTGPPTERARLQHQVKKHNLVVASYDVVRNDIDFFRNIKFNYCILDEGHVIKNGKTKLSKAIKQLA--ANYRVILSGTPIQNNVLELWSLFDFLMPG-FLGTERQFAARYGKPILASR--DAKSSSREQEAGVLAMEALHRQVLPFLLRRMKEDVLQDLPPK 1471          

HSP 2 Score: 60.077 bits (144), Expect = 7.675e-9
Identity = 41/107 (38.32%), Postives = 60/107 (56.07%), Query Frame = 2
Query: 1340 IGYVRIDGNVTSENKRVRTEKFQTDESIQIAILSXXXXXXXXXXXXXXXXVFGELFWNPGILLQAENRCHRIGQKDYVNIHYLVAEQTADDYIWPLVQSKMELLTKV 1660
            + Y+R+DG+V +  +     +F  D SI + +L+    G G+ LT A  VVF E  WNP   LQA +R HRIGQK  VN++ L+   T ++ I  L + KM +   V
Sbjct: 1628 VTYLRLDGSVPAGLRHSIVSRFNNDPSIDVLLLTTHVGGLGLNLTGADTVVFVEHDWNPMRDLQAMDRAHRIGQKRVVNVYRLITRGTLEEKIMGLQKFKMSIANTV 1734          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 vs. Ensembl Cavefish
Match: btaf1 (B-TFIID TATA-box binding protein associated factor 1 [Source:NCBI gene;Acc:103037828])

HSP 1 Score: 92.8189 bits (229), Expect = 6.850e-19
Identity = 81/270 (30.00%), Postives = 126/270 (46.67%), Query Frame = 3
Query:  354 ENYLKVDAKIRESLFPFQVQGVKYMI-----GRHGRCLLADDMGLGKSVQS---LGAASYYR----------DEWPL--LIISPSSVKMAWRDQVKKWITEPVDILVIDTSKDIKHENFEH-LNKNSIILVSYDLVSRLSSHLLKFNFKVIIMDESHFIKSGLTARAKGCIPLAKKANRLFLLSGTPALSRPSEMFTQIDVIAPSLYNGYFKEFGNRYCDPQFTNWGINYNGSSNTSELQILLNEGI-------MLRRLKSEVLGQLPEK 1079
            ENY K+   I+  L  +Q  GV ++        HG  +L DDMGLGK++QS   L    Y R          D  PL  +++ P ++   W D+V K+ T+     +  T    +    +H + K+++++ SYD+V           F   I+DE H IK+G T  +K    LA  AN   +LSGTP  +   E+++  D + P  + G  ++F  RY  P   +   +   SS   E  +L  E +       +LRR+K +VL  LP K
Sbjct: 1157 ENY-KIPVPIKAELRKYQQDGVNWLAFLNKYKLHG--ILCDDMGLGKTLQSICILAGDHYLRAQEYTKTKAADSCPLPSIVVCPPTLTGHWVDEVGKFCTKEYLNPLHYTGPPTERARLQHQVKKHNLVVASYDVVRNDIDFFRNIKFNYCILDEGHVIKNGKTKLSKAIKQLA--ANYRVILSGTPIQNNVLELWSLFDFLMPG-FLGTERQFAARYGKPILASR--DAKSSSREQEAGVLAMEALHRQVLPFLLRRMKEDVLQDLPPK 1418          

HSP 2 Score: 60.4622 bits (145), Expect = 6.402e-9
Identity = 46/132 (34.85%), Postives = 73/132 (55.30%), Query Frame = 2
Query: 1340 IGYVRIDGNVTSENKRVRTEKFQTDESIQIAILSXXXXXXXXXXXXXXXXVFGELFWNPGILLQAENRCHRIGQKDYVNIHYLVAEQTADDYIWPLVQSKMELL-TKVGLNKENFKNSDTKRLEESFS-EKD 1729
            + Y+R+DG+V +  +     +F  D SI + +L+    G G+ LT A  VVF E  WNP   LQA +R HRIGQK  VN++ L+   T ++ I  L + KM +  T +  +  + ++  T +L   F+ +KD
Sbjct: 1575 VTYLRLDGSVPAGLRHSIVSRFNNDPSIDVLLLTTHVGGLGLNLTGADTVVFVEHDWNPMRDLQAMDRAHRIGQKRVVNVYRLITRGTLEEKIMGLQKFKMSIANTVISQDNSSLQSMGTDQLLNLFTLDKD 1706          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 vs. Ensembl Sea Lamprey
Match: SMARCAL1 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a like 1 [Source:HGNC Symbol;Acc:HGNC:11102])

HSP 1 Score: 313.538 bits (802), Expect = 3.993e-119
Identity = 177/431 (41.07%), Postives = 260/431 (60.32%), Query Frame = 3
Query:   84 LVLYSHERFEIIIGYNERVINVIKSIKSSEYDQNTRKWNILLTKYKETVTALNKLGILDITLLPNYVIKIFNHKINNLTLPPDPISRVSDENYLKVD-----AKIRESLFPFQVQGVKYMIGRHGRCLLADDMGLGKSVQSLGAASYYRDEWPLLIISPSSVKMAWRDQVKKWIT--EPVDILVIDTSKDIKHENFEHLNKNSIILVSYDLVSRLSSHLLKFNFKVIIMDESHFIKSGLTARAKGCIPLAKKANRLFLLSGTPALSRPSEMFTQIDVIAPSLYNGYFKEFGNRYCDPQFTNWGINYNGSSNTSELQILLNEGIMLRRLKSEVLGQLPEKRREVILLASKFLE---KASLKRHADIMMKDNLKS-LQRRGALLEYFHATGKAKIDAIKNYIDDLLESPR-KFLFFAHHSEVLNAVEDQIIKK 1340
             VL    RFE+ I Y+   I + K I+S  YD  TRKWN LL  Y E ++  +    +    +P  +++ F        LP    SR S E    VD       +  SL PFQ +GV + I + GR L+ADDMGLGK++Q++  A++YR EWPLL+++PSSV+  W +  ++W+   +P  I V+ T +D       + N   + ++SYDL+SR+   L +  F VII DESHF+K+  T R K  +PL KKA R+ LLSGTPA+SRP+E++TQ+  + P ++   F EF  RYC+ +   WG +Y GSSN +EL++LL E +M+RRLK++VL QLP K+R+++++A   ++   KA+L   A  M +   +S  Q + AL+ +F  T +AK+ AI  Y+ DLLES R KFL FAHH  VL+A+   + KK
Sbjct:  352 CVLVGRSRFEVDITYHAEAIGIFKQIESRSYDAVTRKWNFLLEDYCE-LSESSHTEQVHSDCMPEALVRTF--------LPQFERSRASREPLRDVDLSAVGETLTGSLLPFQQEGVNFAIAQEGRVLIADDMGLGKTIQAICVAAFYRAEWPLLVVAPSSVRFTWAEAFRRWLPWLDPQKINVVVTGRD-------NPNSGLVNIISYDLLSRIQGKLEEKGFAVIIADESHFLKNVKTVRCKAALPLLKKARRVLLLSGTPAMSRPAELYTQVAAVQPQIFP-KFHEFALRYCNAKQMPWGWDYTGSSNMAELRLLLEETVMIRRLKADVLSQLPAKQRKMVVVAPGVIDAKAKAALATAAKAMDRAGKQSKTQEKEALMLFFSKTAEAKVSAIVEYVSDLLESGRAKFLVFAHHRVVLDALSAHLGKK 765          

HSP 2 Score: 133.65 bits (335), Expect = 3.993e-119
Identity = 69/130 (53.08%), Postives = 99/130 (76.15%), Query Frame = 2
Query: 1340 IGYVRIDGNVTSENKRVRTEKFQTDESIQIAILSXXXXXXXXXXXXXXXXVFGELFWNPGILLQAENRCHRIGQKDYVNIHYLVAEQTADDYIWPLVQSKMELLTKVGLNKENFKNSDTKRLEESFSEKD 1729
            +G++RIDG+ +S  ++   E+FQ D++I++A+LSI AA  GITL+AA LVVF ELFWNPG+L+QAE+R HRIGQ   VN+HYLVA  T+DDY+WP+VQ K+ +L + GL  ++FKN+ +     ++S KD
Sbjct:  767 VGHIRIDGSTSSAERQALCERFQRDDAIKVAVLSITAANMGITLSAADLVVFSELFWNPGVLIQAEDRVHRIGQLCCVNVHYLVARGTSDDYLWPMVQEKLRILGEAGLCGDSFKNAQST----AYSVKD 892          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 vs. Ensembl Sea Lamprey
Match: zranb3 (zinc finger, RAN-binding domain containing 3 [Source:ZFIN;Acc:ZDB-GENE-060712-1])

HSP 1 Score: 212.231 bits (539), Expect = 5.256e-77
Identity = 124/347 (35.73%), Postives = 198/347 (57.06%), Query Frame = 3
Query:  378 KIRESLFPFQVQGVKYMIGRHGRCLLADDMGLGKSVQSLGAASYYRDEWPLLIISPSSVKMAWRDQVKKWITE--PVDILVIDTSKDIKHENFEHLNKNSIILVSYDLVSR----LSSHLLKFNFKVIIMDESHFIKSGLTARAKGCIPLAKKANRLFLLSGTPALSRPSEMFTQIDVIAPSLYNGYFKEFGNRYCDPQFTNWG-----INYNGSSNTSELQILLNEGIMLRRLKSEVLGQLPEKRREVILLASKFLEKASLKRHADIMMKDNLKSL---------------QRRGALLEYFHATGKAKIDAIKNYIDDLLESPR-KFLFFAHHSEVLNAVEDQIIK 1337
            K+R+ L PFQ QGV++ + + GRC++AD+MGLGK++Q++  A  YR EWP+L++ PSS+K  W ++++KW+ E  P DI +++   DI+      + ++ + ++ Y L++     L   L +  F+V+++DESH++K+    R+   +PL + A R  LL+GTPAL+RP E++ QID + P+ + G + E+  RYCD +   +G      ++ G+SN  EL   LN   M+RRLK EVL QLP K R+ I     F       R  + M+ D  ++L               Q    +   F  T  AK  A+K+YI  LLE+   KFL FAHH  +L A  + +++
Sbjct:    7 KLRQRLMPFQKQGVRFALEKGGRCMIADEMGLGKTIQAIAVAYIYRAEWPMLVVVPSSLKYLWIEELEKWVPELLPGDIHLVENKTDIR-----AVTESRVTVLGYGLLTADATLLVEALQRRRFQVVLVDESHYMKTRTATRSCLLLPLVQGARRALLLTGTPALARPEELYMQIDALYPNRF-GKWTEYAKRYCDARMRFFGRGNRKWDFKGASNLQELHGRLN-AFMIRRLKDEVLTQLPPKIRQRI----PFDLSKEATRELNTML-DEWEALLKLVRSNSCPTSSFVQVMSLITRLFKQTAVAKAGAVKDYIKMLLENDSIKFLVFAHHLVMLQACTEAVVE 341          

HSP 2 Score: 94.7449 bits (234), Expect = 5.256e-77
Identity = 64/153 (41.83%), Postives = 92/153 (60.13%), Query Frame = 2
Query: 1337 KIGYVRIDGNVTSENKRVRTEKFQTDESIQIAILSXXXXXXXXXXXXXXXXVFGELFWNPGILLQAENRCHRIGQKDYVNIHYLVAEQTADDYIWPLVQSKMELLTKVGLNKENFKNSDTKRLEE-SFSEKDTN-----TKILDYFQSDFIED 1777
            K+ Y+RIDG+V +  +     +FQ D SI++A+LSI AAG G+T TAAT VVF EL+W+PG + QAE+R HRIGQ   V+IHYL+A+ T D  +W ++  K+  +T   LN          RLE+    E DT+     +  + +  SD I +
Sbjct:  343 KVRYIRIDGSVPAAERSRLVHQFQNDASIRVAVLSIKAAGQGLTFTAATHVVFAELYWDPGHMKQAEDRAHRIGQCSSVHIHYLIAKGTLDSLLWAMINRKI-FVTSSTLN---------GRLEQLGMQEADTDKCDFLSHAMAWVPSDTIPE 485          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 vs. Ensembl Sea Lamprey
Match: SMARCA5 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 5 [Source:HGNC Symbol;Acc:HGNC:11101])

HSP 1 Score: 82.8037 bits (203), Expect = 1.317e-16
Identity = 72/267 (26.97%), Postives = 136/267 (50.94%), Query Frame = 3
Query:  402 FQVQGVKYMI-----GRHGRCLLADDMGLGKSVQS---LGAASYYRD-EWPLLIISPSSVKMAWRDQVKKWITEPVDILVIDTSKDIK---HENFEHLNKNSIILVSYDLVSRLSSHLLKFNFKVIIMDESHFIKSGLTARAKGCIPLAKKANRLFLLSGTPALSRPSEMFTQIDVIAPSLYNGYFKEFGNRYCDPQFTNWGINYN--GSSNTSELQILLNEGIMLRRLKSEVLGQLPEKRREVILLASKFLEKASLKRHADIMMKD 1160
            +QV+G+ ++I     G +G  +LAD+MGLGK++Q+   LG   ++R+ + P +++ P S    W ++ ++W+     + +I  +KD +    EN     +  + + SY++V R  S   KFN++ +++DE+H IK+   ++    +   K  NRL LL+GTP  +   E+++ ++ + P ++N              F +W    N  G     E   ++    +LRR+K++V   L  K+   I +    L K   + +  I+MKD
Sbjct:  140 YQVRGLNWLISLYENGING--ILADEMGLGKTLQTISLLGYMKHHRNIQGPHMVLVPKSTLHNWMNEFERWVPSLRAVCLIG-NKDQRVATDENVYTKREWDVCVTSYEIVIREKSVFKKFNWRYLVIDEAHRIKNE-KSKLSDIVREFKSTNRL-LLTGTPLQNNLHELWSLLNFLLPDVFNS----------SEDFDSWFDTNNCLGDQELVERLHMVLRPFLLRRIKADVEKSLQPKKEVKIYIG---LSKMQREWYTKILMKD 388          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 vs. Ensembl Sea Lamprey
Match: SMARCA5 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 5 [Source:HGNC Symbol;Acc:HGNC:11101])

HSP 1 Score: 82.0333 bits (201), Expect = 1.769e-16
Identity = 72/267 (26.97%), Postives = 134/267 (50.19%), Query Frame = 3
Query:  402 FQVQGVKYMI-----GRHGRCLLADDMGLGKSVQS---LGAASYYRD-EWPLLIISPSSVKMAWRDQVKKWITEPVDILVIDTSKDIKHENFEHLNKN---SIILVSYDLVSRLSSHLLKFNFKVIIMDESHFIKSGLTARAKGCIPLAKKANRLFLLSGTPALSRPSEMFTQIDVIAPSLYNGYFKEFGNRYCDPQFTNWGINYN--GSSNTSELQILLNEGIMLRRLKSEVLGQLPEKRREVILLASKFLEKASLKRHADIMMKD 1160
            +QV+G+ ++I     G +G  +LAD+MGLGK++Q+   LG   +YR+   P +++ P S    W  + ++W+     + +I   KD +    + +       + + SY+++ R  S   KFN++ +++DE+H IK+   ++    +   K  NRL LL+GTP  +   E+++ ++ + P ++N              FT+W    N  G     E   ++    +LRR+K++V   LP K+   I +    L K   + +  I+MKD
Sbjct:  115 YQVRGLNWLISLYENGING--ILADEMGLGKTLQTISLLGYMKHYRNIPGPHMVLVPKSTLHNWMAEFERWVPSLRAVCLIG-DKDHRVSASQPIVPPIEWDVCVTSYEMIIREKSVFKKFNWRYLVIDEAHRIKNE-KSKLSEIVREFKTTNRL-LLTGTPLQNNLHELWSLLNFLLPDVFNSA----------DTFTSWFDTNNCFGDQQLVERLHMVLRPFLLRRIKADVEKSLPPKKECKIYIG---LSKMQREWYTKILMKD 363          

HSP 2 Score: 52.373 bits (124), Expect = 3.203e-7
Identity = 38/102 (37.25%), Postives = 54/102 (52.94%), Query Frame = 2
Query: 1346 YVRIDGNVTSENKRVRTEKFQT-DESIQIAILSXXXXXXXXXXXXXXXXVFGELFWNPGILLQAENRCHRIGQKDYVNIHYLVAEQTADDYIWPLVQSKMEL 1648
            Y R+DG    E+++V    F   D S  + +LS  A G GI L  A +V+  +  WNP + LQA +R HRIGQK  V +   + E T +D I    + K+ L
Sbjct:  458 YCRLDGQTPHEDRQVSIASFNAPDSSKFVFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAMDRAHRIGQKKVVRVFRFITESTVEDRIVERAEMKLRL 559          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001164.1 (pep scaffold:Pmarinus_7.0:GL482256:352:18794:-1 gene:ENSPMAG00000001030.1 transcript:ENSPMAT00000001164.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 81.2629 bits (199), Expect = 3.625e-16
Identity = 84/296 (28.38%), Postives = 132/296 (44.59%), Query Frame = 3
Query:  381 IRESLFPFQVQGVKYMIGRHGRCL---LADDMGLGKSVQSLGAASYY----RDEWPLLIISPSSVKMAWRDQVKKWITEPVDILVIDTSKDIKHENFEHL--NKNSIILVSYDLVSRLSSHLLKFNFKVIIMDESHFIKSGLTARAKGCIPLAKKANRLFLLSGTPALSRPSEMFTQIDVIAPSLYNGYFKEFGNRYCDPQFTNWGINYNGSSNTSELQILLNEG---------------IMLRRLKSEVLGQLPEKRREVILLASKFLEKASLKRHADIMMKDNLKSLQRRGALL 1196
            I  SL  +QVQG+++M+  +   L   LAD+MGLGK++Q++G  +Y     R   P LII P S    W  +  KW    V I     S   +      L   K +++L +Y+ + +    L K  +K +I+DE H +K+    +    +     A R  LL+GTP  ++  E++  ++ + P+++         + C   F  W   +N     +  ++ LNE                 +LRRLK EV  QLPEK   VI      L+K  L RH           +Q +G LL
Sbjct:  278 INGSLKMYQVQGLEWMVSLYNNNLNGILADEMGLGKTIQTIGLITYLMENKRLNGPYLIIVPLSTLSNWVIEFDKWAPSVVKI-SYKGSPAARRAFMVQLRSGKFNVLLTTYEYIIKDKHVLAKIRWKYMIVDEGHRMKNH-HCKLTQVLNSHYIAPRRLLLTGTPLQNKLPELWALLNFLLPTIF---------KSCS-TFEQW---FNAPFAMTGEKVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVIKCDMSALQKV-LYRH-----------MQAKGVLL 546          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 vs. Ensembl Yeast
Match: ISW2 (ATP-dependent DNA translocase involved in chromatin remodeling; ATPase component that, with Itc1p, forms a complex required for repression of a-specific genes, INO1, and early meiotic genes during mitotic growth; the Isw2 complex exhibits basal levels of chromatin binding throughout the genome as well as target-specific chromatin interactions; targeted by Ume6p- and Sua7p-dependent DNA looping to many loci genome-wide [Source:SGD;Acc:S000005831])

HSP 1 Score: 88.5817 bits (218), Expect = 1.716e-18
Identity = 74/237 (31.22%), Postives = 124/237 (52.32%), Query Frame = 3
Query:  393 LFPFQVQGVKYMIGRHGRCL---LADDMGLGKSVQSLGAASYYRD----EWPLLIISPSSVKMAWRDQVKKWITEPVDILVIDTSKDIKHENFEHL---NKNSIILVSYDLVSRLSSHLLKFNFKVIIMDESHFIKSGLTARAKGCIPLAKKANRLFLLSGTPALSRPSEMFTQIDVIAPSLYNGYFKEFGNRYCDPQFTNWGINYNGSSNTSELQI-----LLNEGIMLRRLKSEV 1058
            L  +QVQG+ ++I  H   L   LAD+MGLGK++Q++    Y R     E P LII P S    WR +  KW T  V++LV+   KD + +   ++    +  +++ SY++V R  + L +  ++ I++DE+H IK+  +A ++  I L    NRL L++GTP  +   E++  ++ + P +       FG+      F  W    N S    E+ I     +LN   +LRR+K++V
Sbjct:  184 LRDYQVQGLNWLISLHENKLSGILADEMGLGKTLQTISFLGYLRYVKQIEGPFLIIVPKSTLDNWRREFLKW-TPNVNVLVLHGDKDTRADIVRNIILEARFDVLITSYEMVIREKNALKRLAWQYIVIDEAHRIKNEQSALSQ-IIRLFYSKNRL-LITGTPLQNNLHELWALLNFLLPDI-------FGDSEL---FDEW-FEQNNSEQDQEIVIQQLHSVLN-PFLLRRVKADV 405          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 vs. Ensembl Yeast
Match: ISW1 (ATPase subunit of imitation-switch (ISWI) class chromatin remodelers; with Ioc3p forms Isw1a complex involved in repression of transcription initiation; with Ioc2p and Ioc4p forms Isw1b complex involved in regulation of transcription elongation; Isw1b recruited to ORFs by H3K36 methylation and acts with Chd1p to prevent trans-histone exchange over coding regions; Isw1p import into nucleus depends on C-terminal bipartite nuclear targeting signal KRIR X19 KKAK [Source:SGD;Acc:S000000449])

HSP 1 Score: 84.3445 bits (207), Expect = 2.810e-17
Identity = 73/275 (26.55%), Postives = 139/275 (50.55%), Query Frame = 3
Query:  375 AKIRESLFPFQVQGVKYMIGRHGR---CLLADDMGLGKSVQSLGAASYYRD----EWPLLIISPSSVKMAWRDQVKKWITEPVDILVIDTSKDIKHENFEHLNKN------SIILVSYDLVSRLSSHLLKFNFKVIIMDESHFIKSGLTARAKGCIPLAKKANRLFLLSGTPALSRPSEMFTQIDVIAPSLYNGYFKEFGNRYCDPQFTNWGINYNGSSNTSELQILLNEGIMLRRLKSEVLGQLPEKRREVILLASKFLEKASLKRHADIMMKD 1160
            A +   L P+Q+QGV +++  H      +LAD+MGLGK++Q++    Y R       P L+I+P S    W  ++ +W T  V+  ++   K+   E  E + K        +++ SY+++ R  S L K N++ II+DE+H IK+  +  ++       + NRL L++GTP  +   E++  ++ + P +++   ++F     D  F++     +      +L  +L +  +LRR+KS+V   L  K+   + +    ++K   K+   I+ KD
Sbjct:  190 AYVNGQLRPYQIQGVNWLVSLHKNKIAGILADEMGLGKTLQTISFLGYLRYIEKIPGPFLVIAPKSTLNNWLREINRW-TPDVNAFILQGDKE---ERAELIQKKLLGCDFDVVIASYEIIIREKSPLKKINWEYIIIDEAHRIKNEESMLSQVLREFTSR-NRL-LITGTPLQNNLHELWALLNFLLPDIFSDA-QDF-----DDWFSSESTEEDQDKIVKQLHTVL-QPFLLRRIKSDVETSLLPKKELNLYVGMSSMQKKWYKK---ILEKD 448          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 vs. Ensembl Yeast
Match: MOT1 (Essential protein involved in regulation of transcription; removes Spt15p (TBP) from DNA via its C-terminal ATPase activity; may have a role in ensuring that soluble TBP is available to bind TATA-less promoters; forms a complex with TBP that binds TATA DNA with high affinity but with altered specificity; the Mot1p-Spt15p-DNA ternary complex contains unbent DNA; coregulates transcription with Spt16p through assembly of preinitiation complex and organization of nucleosomes [Source:SGD;Acc:S000006003])

HSP 1 Score: 82.8037 bits (203), Expect = 1.019e-16
Identity = 81/302 (26.82%), Postives = 131/302 (43.38%), Query Frame = 3
Query:  249 GILDITLLPNYVIKIFNHKINNLTLPPDPISRVSDENYLKVDAKIRESLFPFQVQGVKYMI---GRHGRCLLADDMGLGKSVQSL---GAASYYRDE------------WPLLIISPSSVKMAWRDQVKKWITEPVDILVIDTSKDIKHENFEHLNKNSIILVSYDLVSRLSSHLLKFNFKVIIMDESHFIKSGLTARAKGCIPLAKKANRLFLLSGTPALSRPSEMFTQIDVIAPSLYNGYFKEFGNRYCDPQFTNWGINYNGSSNTSELQILLNEGI-------MLRRLKSEVLGQLPEK 1079
            GI D   LP  ++     + + +    DP    S     K+   I+ +L  +Q  GV ++      H   +L DDMGLGK++Q++    +  Y R E             P LII P S+   W ++  ++    + ++V      ++      L+   II+ SYD+     + L K  +   ++DE H IK+  +  AK    +   AN   +L+GTP  +   E+++  D + P  + G  K F  R+  P   +   N   SS   E  +L  E +       MLRRLK +VL  LP K
Sbjct: 1228 GIADPKGLPEELVASRERERDFIQQMMDP----SKAKPFKLPIAIKATLRKYQQDGVNWLAFLNKYHLHGILCDDMGLGKTLQTICIIASDQYLRKEDYEKTRSVESRALPSLIICPPSLTGHWENEFDQY-APFLKVVVYAGGPTVRLTLRPQLSDADIIVTSYDVARNDLAVLNKTEYNYCVLDEGHIIKNSQSKLAKAVKEIT--ANHRLILTGTPIQNNVLELWSLFDFLMPG-FLGTEKMFQERFAKPIAASR--NSKTSSKEQEAGVLALEALHKQVLPFMLRRLKEDVLSDLPPK 1519          

HSP 2 Score: 63.929 bits (154), Expect = 7.716e-11
Identity = 45/128 (35.16%), Postives = 74/128 (57.81%), Query Frame = 2
Query: 1340 IGYVRIDGNVTSENKRVRTEKFQTDESIQIAILSXXXXXXXXXXXXXXXXVFGELFWNPGILLQAENRCHRIGQKDYVNIHYLVAEQTADDYIWPLVQSKMELLTKVGLNKEN--FKNSDTKRLEESF 1717
            + Y+R+DG++   +++    KF  D SI   +L+    G G+ LT A  V+F E  WNP   LQA +R HRIGQK  VN++ ++ + T ++ I  L + KM + + V +N++N    + DT +L + F
Sbjct: 1674 VTYMRLDGSIDPRDRQKVVRKFNEDPSIDCLLLTTKVGGLGLNLTGADTVIFVEHDWNPMNDLQAMDRAHRIGQKKVVNVYRIITKGTLEEKIMGLQKFKMNIASTV-VNQQNSGLASMDTHQLLDLF 1800          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 vs. Ensembl Yeast
Match: IRC5 (Putative ATPase containing the DEAD/H helicase-related sequence motif; null mutant displays increased levels of spontaneous Rad52p foci; SWAT-GFP and mCherry fusion proteins localize to the nucleus [Source:SGD;Acc:S000001934])

HSP 1 Score: 82.0333 bits (201), Expect = 1.284e-16
Identity = 73/263 (27.76%), Postives = 134/263 (50.95%), Query Frame = 3
Query:  393 LFPFQVQGVKYMI-----GRHGRCLLADDMGLGKSVQSLGAASYYRD---EWPLLIISPSSVKMAWRDQVKKWITEPVDILVIDTS----KDIKHENF-EHLNKNSIILVSYDLVSRLSSHLLKFNFKVIIMDESHFIKSGLTARAKGCIPLAKKANRLFLLSGTPALSRPSEMFTQIDVIAPSLYNGYFKEFGNRYCDPQFTNWGINYNGSSNTSELQILLNEGI---------------MLRRLKSEVLGQ-LPEKRREVI 1094
            L P+Q++G+ ++I     G +G  +LAD+MGLGK+VQS+   ++  +   + P L+ +P S    W ++  K+  +   +    T+    +  K +NF +      I++ SY+++ R +  ++  N+K +I+DE H +K+ +  R    +     +NRL LL+GTP  +  +E+++ ++ I P ++  +  E  N++ D    N G      SN+  L  L+N+ +               +LRRLK  VL   LP KR  +I
Sbjct:  222 LKPYQLEGLNWLITLYENGLNG--ILADEMGLGKTVQSIALLAFIYEMDTKGPFLVTAPLSTLDNWMNEFAKFAPDLPVLKYYGTNGYKERSAKLKNFFKQHGGTGIVITSYEIILRDTDLIMSQNWKFLIVDEGHRLKN-INCRLIKELKKINTSNRL-LLTGTPLQNNLAELWSLLNFIMPDIFADF--EIFNKWFDFDSLNLG----SGSNSEALNKLINDELQKNLISNLHTILKPFLLRRLKKVVLANILPPKREYII 474          

HSP 2 Score: 52.373 bits (124), Expect = 2.367e-7
Identity = 45/123 (36.59%), Postives = 65/123 (52.85%), Query Frame = 2
Query: 1352 RIDGNVTSENKRVRTEKFQTDESIQ-IAILSXXXXXXXXXXXXXXXXVFGELFWNPGILLQAENRCHRIGQKDYVNIHYLVAEQTADDYIWPLVQSKMEL------------LTKVGLNKENF 1681
            RIDG+V +E ++ + EKF + +    I +LS  AAG GI L  A  VV  +  WNP + LQA +RCHRIGQ+  V ++ L  + T +  I     +K  L            L K+ LN+ +F
Sbjct:  648 RIDGSVNNETRKDQLEKFNSSKDKHNIFLLSTRAAGLGINLVGADTVVLFDSDWNPQVDLQAMDRCHRIGQESPVIVYRLCCDNTIEHVILTRAANKRNLERMVIQMGKFNNLKKLALNEGSF 770          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 vs. Ensembl Yeast
Match: STH1 (ATPase component of the RSC chromatin remodeling complex; required for expression of early meiotic genes; promotes base excision repair in chromatin; essential helicase-related protein homologous to Snf2p [Source:SGD;Acc:S000001388])

HSP 1 Score: 81.2629 bits (199), Expect = 2.659e-16
Identity = 66/251 (26.29%), Postives = 127/251 (50.60%), Query Frame = 3
Query:  390 SLFPFQVQGVKYMIG---RHGRCLLADDMGLGKSVQSLGAASYY----RDEWPLLIISPSSVKMAWRDQVKKWITEPVDILVIDTSKDIKHENFEH---LNKNSIILVSYDLVSRLSSHLLKFNFKVIIMDESHFIKSGLTARAKGCIPLAKKANRLFLLSGTPALSRPSEMFTQIDVIAPSLYNGYFKEFGNRYCDPQFTNWGINYNGSSNTSELQILLN------EGIMLRRLKSEVLGQLPEKRREVI 1094
            +L  +Q++G+++M+     H   +LAD+MGLGK++QS+   +Y     +D  P L+I P S    W  + +KW    ++ ++   + + +H + +H   +    ++L +Y+ + +  S L K ++  +I+DE H +K+  +  +       +  NRL +L+GTP  +   E++  ++ + P ++N   K F + +  P F N G          E  +++          +LRRLK EV   LP+K  +VI
Sbjct:  469 TLKEYQLRGLEWMVSLYNNHLNGILADEMGLGKTIQSISLITYLYEVKKDIGPFLVIVPLSTITNWTLEFEKWAP-SLNTIIYKGTPNQRH-SLQHQIRVGNFDVLLTTYEYIIKDKSLLSKHDWAHMIIDEGHRMKNAQSKLSFTISHYYRTRNRL-ILTGTPLQNNLPELWALLNFVLPKIFNSA-KTFEDWFNTP-FANTGTQEKLELTEEETLLIIRRLHKVLRPFLLRRLKKEVEKDLPDKVEKVI 714          

HSP 2 Score: 49.2914 bits (116), Expect = 2.193e-6
Identity = 40/127 (31.50%), Postives = 64/127 (50.39%), Query Frame = 2
Query: 1340 IGYVRIDGNVTSENKRVRTEKFQTDESIQIA-ILSXXXXXXXXXXXXXXXXVFGELFWNPGILLQAENRCHRIGQKDYVNIHYLVAEQTADDYIWPLVQSKMELLTKVGLNKENFKNSDTKRLEESF 1717
            + Y+R+DG+  +E +      F   +S     +LS  A G G+ L  A  V+  +  WNP   LQA++R HRIGQK+ V I  L+   + ++ I      K+++  KV +    F N  T   +E+F
Sbjct:  832 LKYMRLDGSTKTEERTEMLNAFNAPDSDYFCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITTDSVEEVILERAMQKLDIDGKV-IQAGKFDNKSTAEEQEAF 957          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 vs. Ensembl Nematostella
Match: EDO49581 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGQ3])

HSP 1 Score: 325.479 bits (833), Expect = 1.852e-122
Identity = 172/422 (40.76%), Postives = 257/422 (60.90%), Query Frame = 3
Query:   87 VLYSHERFEIIIGYNERVINVIKSIKSSEYDQNTRKWNILLTKYKETVTALNKLGILDITLLPNYVIKIFNHKINNLTLPPDPISRVSDE--NYLKVDAKIRESLFPFQVQGVKYMIGRHGRCLLADDMGLGKSVQSLGAASYYRDEWPLLIISPSSVKMAWRDQVKKWIT--EPVDILVIDTSKDIKHENFEHLNKNSIILVSYDLVSRLSSHLLKFNFKVIIMDESHFIKSGLTARAKGCIPLAKKANRLFLLSGTPALSRPSEMFTQIDVIAPSLYNGYFKEFGNRYCDPQFTNWGINYNGSSNTSELQILLNEGIMLRRLKSEVLGQLPEKRREVILLASKFLEKASLKRHADIMMKDNLKSLQRRGALLEYFHATGKAKIDAIKNYIDDLLESPRKFLFFAHHSEVLNAVEDQIIKK 1340
            +L S  RF + IG++ ++I + K++ S  YD+ T  W+  L  Y+  ++A   L  + +  LP  V+ +F          P  +  +S E  N   VD K+  SL PFQ +GV + I + GR ++ADDMGLGK+VQ++  ASYYR EWPLL+++PSS+++ W+    KW+   +P  I V+ T KD       ++    I ++SYDL+++    L +  F+VII DESHFIK+   AR K  +P+ K A R+ LLSGTPALSRP E++TQI  + P ++   F EFG RYC      WG +Y+G+SN  ELQ++L + IM+RRLK +VL QLP KRR+++LL    ++   L + A  +  +  K  ++ GALL YF  T  +KI A++NY+ DLLE   KFL F HH ++L+A+ D ++ K
Sbjct:    1 MLISSTRFTVKIGFHAQLIALFKTLPSRAYDKATTTWSFSLEDYETLMSASRDLVGVSLEGLPKTVLSLFTKS------SPGTLKSLSTEDINLNCVDTKLVSSLMPFQREGVAFCICQDGRAIIADDMGLGKTVQAICVASYYRKEWPLLVVAPSSMRLTWKQAFIKWLPSLDPQSINVVLTGKD-------NVTAGLINIISYDLLTKFVGKLQEKRFRVIIADESHFIKNNKAARTKTFLPILKAATRVILLSGTPALSRPEELYTQICAVNPRMFPS-FHEFGKRYCAGVENRWGWDYSGASNMEELQLVLEQSIMIRRLKKDVLHQLPSKRRQMVLLDPSLIKVKPLMKAAKEV--ETAKKKEQHGALLNYFCETSASKIAAVRNYVLDLLEGGHKFLVFGHHQDMLDAISDCLMHK 406          

HSP 2 Score: 133.265 bits (334), Expect = 1.852e-122
Identity = 68/122 (55.74%), Postives = 95/122 (77.87%), Query Frame = 2
Query: 1331 YQKIGYVRIDGNVTSENKRVRTEKFQTDESIQIAILSXXXXXXXXXXXXXXXXVFGELFWNPGILLQAENRCHRIGQKDYVNIHYLVAEQTADDYIWPLVQSKMELLTKVGLNKENFKNSDT 1696
            ++K  Y+RIDG   S  +++  ++FQ D++  +A+LSI AA TG+TLT  T VVF ELFWNPG L+QAE+R +RIGQK+ VNIHYLVA+ TADDY+WPL+Q K+++L+K GL K++F  +DT
Sbjct:  405 HKKYSYIRIDGKTPSSKRQMLCDQFQKDKNTVVAVLSITAANTGLTLTEGTAVVFAELFWNPGALVQAEDRVYRIGQKNSVNIHYLVAKGTADDYLWPLIQHKLDVLSKAGLTKDDFSEADT 526          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 vs. Ensembl Nematostella
Match: EDO31943 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWF7])

HSP 1 Score: 108.227 bits (269), Expect = 4.684e-32
Identity = 102/353 (28.90%), Postives = 174/353 (49.29%), Query Frame = 3
Query:  390 SLFPFQVQGVKYM----IGRHGRCLLADDMGLGKSVQSLGA----ASYYRDEWPLLIISPSSVKMAWRDQVKKWITEPVDILVIDTSKD----IKHENFEHLNKNSIILVSYDLVSRLSSHLLKFNFKVIIMDESHFIKSGLTARAKGCIPLAKKANRLFLLSGTPALSRPSEMFTQIDVIAPSLYN-GYFKEFGNRYCDPQFTNWGINYNGSSNT-SELQILLNEGIMLRRLKSEVLGQLPEKRREVILLAS-----KFLEKASLKRHADIMMKD------------NLKSLQRRGALLEYFHA----------TGKAKIDAIKNYIDDLLESPRKFLFFAHHSEVLNAVED 1325
            +L P+Q++GV +M    +  HG C+L D+MGLGK++Q++          +     L++SP SV   W++++K++ T+ + +L +  SK+     K++ F+ +    ++L SY++  R +S L +F++  + +DE+H +K+  +      I    K +   LL+GTP  +   E+++ +  IAPS+++  Y +EF     +  F N      G  NT S+L  LL+   +LRR+KSEV+  LPEK  EVIL A      K   KA L +  DI   D            NL+       L +              T   K+ AI   +  L +   K L F+  + +L+ V+D
Sbjct:   15 TLRPYQLEGVGWMRDCALTGHG-CILGDEMGLGKTIQTISVLLLLKRTIKHTGLFLVLSPLSVMANWKNEIKRF-TKSLKVLSLIGSKEEREITKNKLFQDIKNIDVLLTSYEICLRETSFLQRFHWSAVAVDEAHRLKNSQSLLYTELIQF--KYDFSILLTGTPVQNNLKELYSLLSFIAPSIFDLEYVEEF-----ETAFKNLA---TGRDNTNSDLPQLLSP-FLLRRVKSEVMVDLPEK-SEVILYAGMSELQKKYYKAILMKDYDIFSTDGPSRNKLNSILTNLRKCVNHPYLFDGVEPEPFALGEHLITASGKLHAIDQLLSYLYKRGHKVLMFSQMTRMLDIVQD 353          

HSP 2 Score: 48.521 bits (114), Expect = 4.684e-32
Identity = 39/111 (35.14%), Postives = 55/111 (49.55%), Query Frame = 2
Query: 1328 NYQKIGYVRIDGNVTSENKRVRTEKFQTDESIQIAILSXXXXXXXXXXXXXXXXVFGELFWNPGILLQAENRCHRIGQKDYVNIHYLVAEQTADDYIWPLVQSKMELLTKV 1660
             Y+   Y R+DG+V  E + +  + F  ++   I +LS  A G G+ L +A  V+F +  +NP   LQA  R HRIGQ   V I  LV   T ++ I      KM L   V
Sbjct:  356 GYRGYAYERLDGSVRGEERYIAIKNFNEEQDNFIFLLSTKAGGQGLNLMSADTVIFVDSDYNPQNDLQAAARAHRIGQTRPVKIIRLVGRNTVEEIILKHADDKMRLTNNV 466          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 vs. Ensembl Nematostella
Match: EDO28476 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T6C9])

HSP 1 Score: 104.375 bits (259), Expect = 2.861e-25
Identity = 62/179 (34.64%), Postives = 95/179 (53.07%), Query Frame = 3
Query:  108 FEIIIGYNERVINVIKSIKSSEYDQNTRKWNILLTKYKETVTALNKLGILDITLLPNYVIKIFNHKINNLTLPPDPISRVSDE--NYLKVDAKIRESLFPFQVQGVKYMIGRHGRCLLADDMGLGKSVQSLGAASYYRDEWPLLIISPSSVKMAWRDQVKKWIT--EPVDILVIDTSKD 632
            + ++ G +  V   I  I     D     W + +  Y   V+A   L  + +  LP  V+ +F          P  +  +S E  N   VD K+  SL PFQ +GV + I + GR ++ADDMGLGK+VQ++  AS+YR EWPLL+++PSS+++ W+    KW+   +P  I V+ T KD
Sbjct:    3 WMVVDGVDSCVWLCIVWIAVYGVDSCEWLWMVWIAVY---VSASRDLVGVSLEGLPKTVLSLFTKS------SPGTLKSLSSEDINLNCVDTKLVSSLMPFQREGVAFCICQDGRAIIADDMGLGKTVQAICVASFYRKEWPLLVVAPSSMRLTWKQAFIKWLPSLDPQSINVVLTGKD 172          

HSP 2 Score: 57.3806 bits (137), Expect = 3.331e-9
Identity = 25/43 (58.14%), Postives = 31/43 (72.09%), Query Frame = 3
Query:  819 ANRLFLLSGTPALSRPSEMFTQIDVIAPSLYNGYFKEFGNRYC 947
            A R+ LLSGTPALSRP E++TQI  + P ++   F EFG RYC
Sbjct:  175 ATRVILLSGTPALSRPEELYTQICAVNPRMFPS-FHEFGKRYC 216          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 vs. Ensembl Nematostella
Match: EDO41059 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5B2])

HSP 1 Score: 85.1149 bits (209), Expect = 2.980e-17
Identity = 74/274 (27.01%), Postives = 137/274 (50.00%), Query Frame = 3
Query:  387 ESLFPFQVQGVKYMIGRHGRC---LLADDMGLGKSVQSLGAASYY---RDEWPLLIISPSSVKMAWRDQVKKWITEPVDILVIDTSKDIKHENFEHLNKNS---IILVSYDLVS---RLSSHLLKFNFKVIIMDESHFIKSGLTARAKGCIPLAK-KANRLFLLSGTPALSRPSEMFTQIDVIAPSLYNGYFKE----FGNRYCDPQFTNWGINYNGSSNTSELQILLNEGIMLRRLKSEVLGQLPEKRREVILLASKFLEKASLKRHADIMMK 1157
            +SL P+Q+ G+ ++I  H +    +LAD+MGLGK+VQ++   ++     D+ P LII PSS    W  + K+W       L   + ++  +   E L+++S   +I+ +Y++ +     +S L +     ++ DE H +K+  + R    + L + +A R  LL+GTP  +   E+ + +  + P++++G        FGN+  D    +  I        +E    + +  +LRRLK +VL +LP+K   VI      L  +    H+ +M+K
Sbjct:  111 KSLKPYQLTGLNWLILMHEQGVNGILADEMGLGKTVQAISFIAHLIEKGDDGPHLIIVPSSTLNNWVKEFKQWCPTIRFTLYYGSQEERTYLREEILDEHSDFKVIITTYNMATGGFEDTSFLRQLRPHYVVFDEGHMLKNMQSQRY---LKLTRIRAKRRLLLTGTPMQNDLLELMSLLSFVMPTIFDGRTDGLKLLFGNKKLDRDADSGYI-----KERAEQAKKIMKPFVLRRLKKDVLQELPQKHEHVIHCE---LSTSQKDLHSKLMLK 373          

HSP 2 Score: 51.2174 bits (121), Expect = 1.142e-6
Identity = 36/101 (35.64%), Postives = 60/101 (59.41%), Query Frame = 2
Query: 1346 YVRIDGNVTSENKRVRTEKFQTDESIQIAILSXXXXXXXXXXXXXXXXVFGELFWNPGILLQAENRCHRIGQKDYVNIHYLVAEQTADDYIWPLVQSKMEL 1648
            Y R+DG      ++   + F +D  I + +LS  A G GI LT+A +V+  ++ +NP    QAE+RCHR+GQ   V+++ L+A+ T +D +     SK++L
Sbjct:  513 YFRLDGQTPVVERQPMIDNFNSDPDIFLFLLSTKAGGLGINLTSANVVILHDIDFNPYNDKQAEDRCHRVGQTRDVHVYRLIAKDTVEDNMLKCANSKLKL 613          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 vs. Ensembl Nematostella
Match: EDO39324 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAK3])

HSP 1 Score: 82.4185 bits (202), Expect = 3.381e-16
Identity = 68/250 (27.20%), Postives = 125/250 (50.00%), Query Frame = 3
Query:  381 IRESLFPFQVQGVKYMIGRHGRCL---LADDMGLGKSVQSLGAASYYRDE---W-PLLIISPSSVKMAWRDQVKKWITEPVDILVI---DTSKDIKHENFEHLNKNSIILVSYDLVSRLSSHLLKFNFKVIIMDESHFIKSGLTARAKGCIPLAKKANRLFLLSGTPALSRPSEMFTQIDVIAPSLYNGYFKEFGNRYCDP--QFTNWGINYNGSSNTSELQILLNEGIMLRRLKSEVLGQLPEKRREVI 1094
            +R +L  +Q+ G+ +++  H + L   LAD+MGLGK++Q++   ++   E   W P L++ P+SV + W  + KKW+     IL        + +K + +   N   + + SY LV +      +  +K  I+DE+  IK+  + R +  +     + R  LL+GTP  +   E+++ +  + P L+  + K+F   + +P          YN +      ++L     +LRRLKSEV  Q+P+K   V+
Sbjct:   34 LRGTLREYQLIGLDWLVTMHEKRLNGILADEMGLGKTIQTISLLAHLACEKGIWGPHLVVVPTSVMLNWEMEFKKWLPG-FKILTYYGNQKERKLKRQGWTKCNAFHVCITSYKLVVQDHQAFRRKKWKYFILDEAQNIKNFKSQRWQYLLNF--NSQRRLLLTGTPLQNSLMELWSLMHFLMPHLFQSH-KDFKEWFSNPLTGMIEGSREYNENLVKRLHKVL--RPFLLRRLKSEVETQMPKKYEHVV 277          

HSP 2 Score: 65.4698 bits (158), Expect = 5.474e-11
Identity = 43/121 (35.54%), Postives = 68/121 (56.20%), Query Frame = 2
Query: 1328 NYQKIGYVRIDGNVTSENKRVRTEKFQTDESIQIAILSXXXXXXXXXXXXXXXXVFGELFWNPGILLQAENRCHRIGQKDYVNIHYLVAEQTADDYIWPLVQSKMELLTKVGLNKENFKNS 1690
            NY    Y+R+DG+   E +++  ++F  D  I   ILS  + G G+ LT A  VVF +  WNP +  QA++RCHRIGQ   V+I+ L++E+T ++ I      K  +L  + +   NF  +
Sbjct:  781 NYHGYVYLRLDGSTRVEQRQILMDRFNADSRIFCFILSTRSGGLGVNLTGADTVVFYDSDWNPTMDAQAQDRCHRIGQTRDVHIYRLISERTVEENILKKANQK-RMLGDIAIEGGNFTTA 900          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 vs. Ensembl Medaka
Match: smarcal1 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a like 1 [Source:NCBI gene;Acc:101171039])

HSP 1 Score: 325.479 bits (833), Expect = 1.332e-121
Identity = 177/435 (40.69%), Postives = 265/435 (60.92%), Query Frame = 3
Query:   54 KKDTSKIPTSLVLYSHERFEIIIGYNERVINVIKSIKSSEYDQNTRKWNILLTKYKETVTALNKLGILDITLLPNYVIKIFNHKINNLTLPPDPISRVSDENYLKVDAKIRESLFPFQVQGVKYMIGRHGRCLLADDMGLGKSVQSLGAASYYRDEWPLLIISPSSVKMAWRDQVKKWIT--EPVDILVIDTSKDIKHENFEHLNKNSIILVSYDLVSRLSSHLLKFNFKVIIMDESHFIKSGLTARAKGCIPLAKKANRLFLLSGTPALSRPSEMFTQIDVIAPSLYNGYFKEFGNRYCDPQFTNWGINYNGSSNTSELQILLNEGIMLRRLKSEVLGQLPEKRREVILLASKFLE---KASLKRHADIMMKDNLKSLQRRGALLEYFHATGKAKIDAIKNYIDDLLESPR-KFLFFAHHSEVLNAVEDQIIKK 1340
            +K  + I    +L S  RFE+ I Y+  VI   K + +  YD NTRKW+  LT Y   +  ++ +  +++  LP  +I+ F  + +     P   S + + +   +D  +  SL PFQ +GV + + + GR LLADDMGLGK+VQ++  A+YYR+EWPLL+++PSSV+  W +  ++W+    P  I V+  +KD        L    + +VSYDL++R+        F V+IMDESHF+K+  TAR K  +PL K A R+ LLSGTPA+SRP E++TQI  + P+L+   F EFG RYCD +   WG +Y+GSSN  EL++LL + +MLRRLKSEVL QLP K+R+V+ +    +    KA+L   A  + +++   ++ + ALL +++ T +AK  AI  YI D+LES R KFL FAHH  VL+ +  ++ KK
Sbjct:  273 QKPGAAIKGQCILVSRTRFEVDILYHADVIGAFKQMPTKSYDMNTRKWSFSLTDYGGLLDLISGIAAVEVEPLPRAIIQAFAARFDGSEARP---SDIPEADLSSIDPALTSSLMPFQREGVNFAVAKQGRLLLADDMGLGKTVQAICIAAYYRNEWPLLVVAPSSVRFTWAEAFRRWLPSLSPDCINVVVKAKD-------RLRSGLVNIVSYDLLNRMDKQHPGQPFNVLIMDESHFLKNMKTARCKAALPLLKAAKRVILLSGTPAMSRPCELYTQILAVRPTLFP-RFHEFGLRYCDAREKPWGWDYSGSSNLGELKLLLEDCLMLRRLKSEVLSQLPAKQRKVVTVTIDGVNTRIKAALSAAAAELTRNHRSKIEEKEALLVFYNHTAEAKQQAIMEYITDMLESGREKFLVFAHHKSVLDHITCELDKK 696          

HSP 2 Score: 132.109 bits (331), Expect = 1.332e-121
Identity = 81/173 (46.82%), Postives = 109/173 (63.01%), Query Frame = 2
Query: 1340 IGYVRIDGNVTSENKRVRTEKFQTDESIQIAILSXXXXXXXXXXXXXXXXVFGELFWNPGILLQAENRCHRIGQKDYVNIHYLVAEQTADDYIWPLVQSKMELLTKVGLNKENFKNSDTKRLEESFSEKDTNT-----KILDYFQSDFIEDIQFEEFIDLNIEFPQTESKNEY 1843
            I Y+RIDG+  S  ++   EKFQ      +A+LSI AA  GITL  A LV+F ELFWNPG+L+QAE+R HRIGQ + VNIHYLVA+ TADD++WP++Q+KM +L KVGL++ N   SD  +   SF  K+  +      IL+ FQ  F  D   +E + L       E+ NE+
Sbjct:  698 ISYIRIDGSTPSAERQQLCEKFQYSTKTCVAVLSITAANMGITLHTADLVIFAELFWNPGVLIQAEDRVHRIGQTNNVNIHYLVAKGTADDHLWPMIQAKMNVLEKVGLSESNL--SDNAQ-NSSFHSKEAGSFQDGKTILEMFQRSFSADEDMDEALLL-------EAANEW 860          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 vs. Ensembl Medaka
Match: zranb3 (zinc finger RANBP2-type containing 3 [Source:NCBI gene;Acc:101156957])

HSP 1 Score: 203.756 bits (517), Expect = 5.331e-75
Identity = 122/346 (35.26%), Postives = 197/346 (56.94%), Query Frame = 3
Query:  378 KIRESLFPFQVQGVKYMIGRHGRCLLADDMGLGKSVQSLGAASYYRDEWPLLIISPSSVKMAWRDQVKKWITE--PVDILVIDTSKDIKHENFEHLNKNSIILVSYDLVSR----LSSHLLKFNFKVIIMDESHFIKSGLTARAKGCIPLAKKANRLFLLSGTPALSRPSEMFTQIDVIAPSLYNGYFKEFGNRYCDPQFTNWG----INYNGSSNTSELQILLNEGIMLRRLKSEVLGQLPEKRREVILL----------ASKFLEKASLKRHADIMMKDNLKSLQRRGALLEYFHATGKAKIDAIKNYIDDLLESPR-KFLFFAHHSEVLNAVEDQIIKKLAMF 1352
            K+ + L PFQ +GV++ +  +GRC++AD+MGLGK+VQ++  A  YR EWPLL++ PSS+K  W +++++WI E  P DI +++            +  + + ++ Y L++     L   L +  F V+++DESH++KS   AR K  +PL + ANR  LL+GTPAL RP E+F QID + P  + G + ++  +YC+  +  +G     +  G+SN  EL   L++ IM+RRLK++VL QLP K R+ I            A+ F E   L +     + DN  + +    + + +  T  AK  A+K+YI  +LE+ + KFL F HH  +L A  +  I+  A +
Sbjct:   40 KLLQRLMPFQREGVEFALSLNGRCMIADEMGLGKTVQAIAVAYAYRQEWPLLVVVPSSLKYPWIEELERWIPELQPGDINLVENKSQTT-----GICSSKVTVLGYGLLTTDARPLVEALTRQRFSVVVVDESHYLKSRNAARTKILVPLIQSANRAILLTGTPALGRPEELFMQIDALYPRRF-GTWTDYAKKYCNAHYRYFGPRRQWDCRGASNLEELHRRLSQ-IMIRRLKADVLTQLPPKIRQRIPFDLPKEAAKEAAASFAEWERLMKGLGSGVADNPFT-EVMSLVTQMYKQTAIAKAGAVKDYIKMMLEAEQLKFLVFGHHLTMLQACTEAAIEAKAGY 377          

HSP 2 Score: 98.5969 bits (244), Expect = 5.331e-75
Identity = 58/111 (52.25%), Postives = 76/111 (68.47%), Query Frame = 2
Query: 1337 KIGYVRIDGNVTSENKRVRTEKFQTDESIQIAILSXXXXXXXXXXXXXXXXVFGELFWNPGILLQAENRCHRIGQKDYVNIHYLVAEQTADDYIWPLVQSKMELLTKVGLN 1669
            K GY+RIDG+V +  +     KFQ D  I++AILSI AAG G+T TAA+ VVF EL+WNPG + QAE+R HRIGQ   VN+HYL+A+ T D  +W ++  K E +T   LN
Sbjct:  374 KAGYIRIDGSVPASERNQLVHKFQNDPEIRVAILSIQAAGQGLTFTAASHVVFAELYWNPGHIKQAEDRAHRIGQTSSVNVHYLIAKGTFDTVMWSMLNRK-ETVTGSTLN 483          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 vs. Ensembl Medaka
Match: zranb3 (zinc finger RANBP2-type containing 3 [Source:NCBI gene;Acc:101156957])

HSP 1 Score: 203.371 bits (516), Expect = 6.557e-75
Identity = 122/346 (35.26%), Postives = 197/346 (56.94%), Query Frame = 3
Query:  378 KIRESLFPFQVQGVKYMIGRHGRCLLADDMGLGKSVQSLGAASYYRDEWPLLIISPSSVKMAWRDQVKKWITE--PVDILVIDTSKDIKHENFEHLNKNSIILVSYDLVSR----LSSHLLKFNFKVIIMDESHFIKSGLTARAKGCIPLAKKANRLFLLSGTPALSRPSEMFTQIDVIAPSLYNGYFKEFGNRYCDPQFTNWGI----NYNGSSNTSELQILLNEGIMLRRLKSEVLGQLPEKRREVILL----------ASKFLEKASLKRHADIMMKDNLKSLQRRGALLEYFHATGKAKIDAIKNYIDDLLESPR-KFLFFAHHSEVLNAVEDQIIKKLAMF 1352
            K+ + L PFQ +GV++ +  +GRC++AD+MGLGK+VQ++  A  YR EWPLL++ PSS+K  W +++++WI E  P DI +++            +  + + ++ Y L++     L   L +  F V+++DESH++KS   AR K  +PL + ANR  LL+GTPAL RP E+F QID + P  + G + ++  +YC+  +  +G     +  G+SN  EL   L++ IM+RRLK++VL QLP K R+ I            A+ F E   L +     + DN  + +    + + +  T  AK  A+K+YI  +LE+ + KFL F HH  +L A  +  I+  A +
Sbjct:   40 KLLQRLMPFQREGVEFALSLNGRCMIADEMGLGKTVQAIAVAYAYRQEWPLLVVVPSSLKYPWIEELERWIPELQPGDINLVENKSQTT-----GICSSKVTVLGYGLLTTDARPLVEALTRQRFSVVVVDESHYLKSRNAARTKILVPLIQSANRAILLTGTPALGRPEELFMQIDALYPRRF-GTWTDYAKKYCNAHYRYFGPRRQWDCRGASNLEELHRRLSQ-IMIRRLKADVLTQLPPKIRQRIPFDLPKEAAKEAAASFAEWERLMKGLGSGVADNPFT-EVMSLVTQMYKQTAIAKAGAVKDYIKMMLEAEQLKFLVFGHHLTMLQACTEAAIEAKAGY 377          

HSP 2 Score: 98.5969 bits (244), Expect = 6.557e-75
Identity = 58/111 (52.25%), Postives = 76/111 (68.47%), Query Frame = 2
Query: 1337 KIGYVRIDGNVTSENKRVRTEKFQTDESIQIAILSXXXXXXXXXXXXXXXXVFGELFWNPGILLQAENRCHRIGQKDYVNIHYLVAEQTADDYIWPLVQSKMELLTKVGLN 1669
            K GY+RIDG+V +  +     KFQ D  I++AILSI AAG G+T TAA+ VVF EL+WNPG + QAE+R HRIGQ   VN+HYL+A+ T D  +W ++  K E +T   LN
Sbjct:  374 KAGYIRIDGSVPASERNQLVHKFQNDPEIRVAILSIQAAGQGLTFTAASHVVFAELYWNPGHIKQAEDRAHRIGQTSSVNVHYLIAKGTFDTVMWSMLNRK-ETVTGSTLN 483          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 vs. Ensembl Medaka
Match: zranb3 (zinc finger RANBP2-type containing 3 [Source:NCBI gene;Acc:101156957])

HSP 1 Score: 203.371 bits (516), Expect = 6.557e-75
Identity = 122/346 (35.26%), Postives = 197/346 (56.94%), Query Frame = 3
Query:  378 KIRESLFPFQVQGVKYMIGRHGRCLLADDMGLGKSVQSLGAASYYRDEWPLLIISPSSVKMAWRDQVKKWITE--PVDILVIDTSKDIKHENFEHLNKNSIILVSYDLVSR----LSSHLLKFNFKVIIMDESHFIKSGLTARAKGCIPLAKKANRLFLLSGTPALSRPSEMFTQIDVIAPSLYNGYFKEFGNRYCDPQFTNWGI----NYNGSSNTSELQILLNEGIMLRRLKSEVLGQLPEKRREVILL----------ASKFLEKASLKRHADIMMKDNLKSLQRRGALLEYFHATGKAKIDAIKNYIDDLLESPR-KFLFFAHHSEVLNAVEDQIIKKLAMF 1352
            K+ + L PFQ +GV++ +  +GRC++AD+MGLGK+VQ++  A  YR EWPLL++ PSS+K  W +++++WI E  P DI +++            +  + + ++ Y L++     L   L +  F V+++DESH++KS   AR K  +PL + ANR  LL+GTPAL RP E+F QID + P  + G + ++  +YC+  +  +G     +  G+SN  EL   L++ IM+RRLK++VL QLP K R+ I            A+ F E   L +     + DN  + +    + + +  T  AK  A+K+YI  +LE+ + KFL F HH  +L A  +  I+  A +
Sbjct:   40 KLLQRLMPFQREGVEFALSLNGRCMIADEMGLGKTVQAIAVAYAYRQEWPLLVVVPSSLKYPWIEELERWIPELQPGDINLVENKSQTT-----GICSSKVTVLGYGLLTTDARPLVEALTRQRFSVVVVDESHYLKSRNAARTKILVPLIQSANRAILLTGTPALGRPEELFMQIDALYPRRF-GTWTDYAKKYCNAHYRYFGPRRQWDCRGASNLEELHRRLSQ-IMIRRLKADVLTQLPPKIRQRIPFDLPKEAAKEAAASFAEWERLMKGLGSGVADNPFT-EVMSLVTQMYKQTAIAKAGAVKDYIKMMLEAEQLKFLVFGHHLTMLQACTEAAIEAKAGY 377          

HSP 2 Score: 98.5969 bits (244), Expect = 6.557e-75
Identity = 58/111 (52.25%), Postives = 76/111 (68.47%), Query Frame = 2
Query: 1337 KIGYVRIDGNVTSENKRVRTEKFQTDESIQIAILSXXXXXXXXXXXXXXXXVFGELFWNPGILLQAENRCHRIGQKDYVNIHYLVAEQTADDYIWPLVQSKMELLTKVGLN 1669
            K GY+RIDG+V +  +     KFQ D  I++AILSI AAG G+T TAA+ VVF EL+WNPG + QAE+R HRIGQ   VN+HYL+A+ T D  +W ++  K E +T   LN
Sbjct:  374 KAGYIRIDGSVPASERNQLVHKFQNDPEIRVAILSIQAAGQGLTFTAASHVVFAELYWNPGHIKQAEDRAHRIGQTSSVNVHYLIAKGTFDTVMWSMLNRK-ETVTGSTLN 483          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 vs. Ensembl Medaka
Match: zranb3 (zinc finger RANBP2-type containing 3 [Source:NCBI gene;Acc:101156957])

HSP 1 Score: 202.986 bits (515), Expect = 9.293e-75
Identity = 122/346 (35.26%), Postives = 197/346 (56.94%), Query Frame = 3
Query:  378 KIRESLFPFQVQGVKYMIGRHGRCLLADDMGLGKSVQSLGAASYYRDEWPLLIISPSSVKMAWRDQVKKWITE--PVDILVIDTSKDIKHENFEHLNKNSIILVSYDLVSR----LSSHLLKFNFKVIIMDESHFIKSGLTARAKGCIPLAKKANRLFLLSGTPALSRPSEMFTQIDVIAPSLYNGYFKEFGNRYCDPQFTNWGI----NYNGSSNTSELQILLNEGIMLRRLKSEVLGQLPEKRREVILL----------ASKFLEKASLKRHADIMMKDNLKSLQRRGALLEYFHATGKAKIDAIKNYIDDLLESPR-KFLFFAHHSEVLNAVEDQIIKKLAMF 1352
            K+ + L PFQ +GV++ +  +GRC++AD+MGLGK+VQ++  A  YR EWPLL++ PSS+K  W +++++WI E  P DI +++            +  + + ++ Y L++     L   L +  F V+++DESH++KS   AR K  +PL + ANR  LL+GTPAL RP E+F QID + P  + G + ++  +YC+  +  +G     +  G+SN  EL   L++ IM+RRLK++VL QLP K R+ I            A+ F E   L +     + DN  + +    + + +  T  AK  A+K+YI  +LE+ + KFL F HH  +L A  +  I+  A +
Sbjct:   25 KLLQRLMPFQREGVEFALSLNGRCMIADEMGLGKTVQAIAVAYAYRQEWPLLVVVPSSLKYPWIEELERWIPELQPGDINLVENKSQTT-----GICSSKVTVLGYGLLTTDARPLVEALTRQRFSVVVVDESHYLKSRNAARTKILVPLIQSANRAILLTGTPALGRPEELFMQIDALYPRRF-GTWTDYAKKYCNAHYRYFGPRRQWDCRGASNLEELHRRLSQ-IMIRRLKADVLTQLPPKIRQRIPFDLPKEAAKEAAASFAEWERLMKGLGSGVADNPFT-EVMSLVTQMYKQTAIAKAGAVKDYIKMMLEAEQLKFLVFGHHLTMLQACTEAAIEAKAGY 362          

HSP 2 Score: 98.5969 bits (244), Expect = 9.293e-75
Identity = 58/111 (52.25%), Postives = 76/111 (68.47%), Query Frame = 2
Query: 1337 KIGYVRIDGNVTSENKRVRTEKFQTDESIQIAILSXXXXXXXXXXXXXXXXVFGELFWNPGILLQAENRCHRIGQKDYVNIHYLVAEQTADDYIWPLVQSKMELLTKVGLN 1669
            K GY+RIDG+V +  +     KFQ D  I++AILSI AAG G+T TAA+ VVF EL+WNPG + QAE+R HRIGQ   VN+HYL+A+ T D  +W ++  K E +T   LN
Sbjct:  359 KAGYIRIDGSVPASERNQLVHKFQNDPEIRVAILSIQAAGQGLTFTAASHVVFAELYWNPGHIKQAEDRAHRIGQTSSVNVHYLIAKGTFDTVMWSMLNRK-ETVTGSTLN 468          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 vs. Planmine SMEST
Match: SMESG000045797.1 (SMESG000045797.1)

HSP 1 Score: 880.552 bits (2274), Expect = 0.000e+0
Identity = 428/430 (99.53%), Postives = 428/430 (99.53%), Query Frame = 3
Query:   51 LKKDTSKIPTSLVLYSHERFEIIIGYNERVINVIKSIKSSEYDQNTRKWNILLTKYKETVTALNKLGILDITLLPNYVIKIFNHKINNLTLPPDPISRVSDENYLKVDAKIRESLFPFQVQGVKYMIGRHGRCLLADDMGLGKSVQSLGAASYYRDEWPLLIISPSSVKMAWRDQVKKWITEPVDILVIDTSKDIKHENFEHLNKNSIILVSYDLVSRLSSHLLKFNFKVIIMDESHFIKSGLTARAKGCIPLAKKANRLFLLSGTPALSRPSEMFTQIDVIAPSLYNGYFKEFGNRYCDPQFTNWGINYNGSSNTSELQILLNEGIMLRRLKSEVLGQLPEKRREVILLASKFLEKASLKRHADIMMKDNLKSLQRRGALLEYFHATGKAKIDAIKNYIDDLLESPRKFLFFAHHSEVLNAVEDQIIKK 1340
            LKKDTSKIPTSLVLYSHERFEIIIGYNERVINVIKSIKSSEYD NTRKWNILLTKYKETVTALNKLGILDITLLPN VIKIFNHKINNLTLPPDPISRVSDENYLKVDAKIRESLFPFQVQGVKYMIGRHGRCLLADDMGLGKSVQSLGAASYYRDEWPLLIISPSSVKMAWRDQVKKWITEPVDILVIDTSKDIKHENFEHLNKNSIILVSYDLVSRLSSHLLKFNFKVIIMDESHFIKSGLTARAKGCIPLAKKANRLFLLSGTPALSRPSEMFTQIDVIAPSLYNGYFKEFGNRYCDPQFTNWGINYNGSSNTSELQILLNEGIMLRRLKSEVLGQLPEKRREVILLASKFLEKASLKRHADIMMKDNLKSLQRRGALLEYFHATGKAKIDAIKNYIDDLLESPRKFLFFAHHSEVLNAVEDQIIKK
Sbjct:    9 LKKDTSKIPTSLVLYSHERFEIIIGYNERVINVIKSIKSSEYDHNTRKWNILLTKYKETVTALNKLGILDITLLPNSVIKIFNHKINNLTLPPDPISRVSDENYLKVDAKIRESLFPFQVQGVKYMIGRHGRCLLADDMGLGKSVQSLGAASYYRDEWPLLIISPSSVKMAWRDQVKKWITEPVDILVIDTSKDIKHENFEHLNKNSIILVSYDLVSRLSSHLLKFNFKVIIMDESHFIKSGLTARAKGCIPLAKKANRLFLLSGTPALSRPSEMFTQIDVIAPSLYNGYFKEFGNRYCDPQFTNWGINYNGSSNTSELQILLNEGIMLRRLKSEVLGQLPEKRREVILLASKFLEKASLKRHADIMMKDNLKSLQRRGALLEYFHATGKAKIDAIKNYIDDLLESPRKFLFFAHHSEVLNAVEDQIIKK 438          

HSP 2 Score: 70.8626 bits (172), Expect = 1.348e-12
Identity = 33/36 (91.67%), Postives = 36/36 (100.00%), Query Frame = 2
Query: 1334 QKIGYVRIDGNVTSENKRVRTEKFQTDESIQIAILS 1441
            +K+GYVRIDGNV+SENKRVRTEKFQTDESIQIAILS
Sbjct:  438 KKVGYVRIDGNVSSENKRVRTEKFQTDESIQIAILS 473          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 vs. Planmine SMEST
Match: SMESG000045797.1 (SMESG000045797.1)

HSP 1 Score: 878.241 bits (2268), Expect = 0.000e+0
Identity = 428/430 (99.53%), Postives = 428/430 (99.53%), Query Frame = 3
Query:   51 LKKDTSKIPTSLVLYSHERFEIIIGYNERVINVIKSIKSSEYDQNTRKWNILLTKYKETVTALNKLGILDITLLPNYVIKIFNHKINNLTLPPDPISRVSDENYLKVDAKIRESLFPFQVQGVKYMIGRHGRCLLADDMGLGKSVQSLGAASYYRDEWPLLIISPSSVKMAWRDQVKKWITEPVDILVIDTSKDIKHENFEHLNKNSIILVSYDLVSRLSSHLLKFNFKVIIMDESHFIKSGLTARAKGCIPLAKKANRLFLLSGTPALSRPSEMFTQIDVIAPSLYNGYFKEFGNRYCDPQFTNWGINYNGSSNTSELQILLNEGIMLRRLKSEVLGQLPEKRREVILLASKFLEKASLKRHADIMMKDNLKSLQRRGALLEYFHATGKAKIDAIKNYIDDLLESPRKFLFFAHHSEVLNAVEDQIIKK 1340
            LKKDTSKIPTSLVLYSHERFEIIIGYNERVINVIKSIKSSEYD NTRKWNILLTKYKETVTALNKLGILDITLLPN VIKIFNHKINNLTLPPDPISRVSDENYLKVDAKIRESLFPFQVQGVKYMIGRHGRCLLADDMGLGKSVQSLGAASYYRDEWPLLIISPSSVKMAWRDQVKKWITEPVDILVIDTSKDIKHENFEHLNKNSIILVSYDLVSRLSSHLLKFNFKVIIMDESHFIKSGLTARAKGCIPLAKKANRLFLLSGTPALSRPSEMFTQIDVIAPSLYNGYFKEFGNRYCDPQFTNWGINYNGSSNTSELQILLNEGIMLRRLKSEVLGQLPEKRREVILLASKFLEKASLKRHADIMMKDNLKSLQRRGALLEYFHATGKAKIDAIKNYIDDLLESPRKFLFFAHHSEVLNAVEDQIIKK
Sbjct:    9 LKKDTSKIPTSLVLYSHERFEIIIGYNERVINVIKSIKSSEYDHNTRKWNILLTKYKETVTALNKLGILDITLLPNSVIKIFNHKINNLTLPPDPISRVSDENYLKVDAKIRESLFPFQVQGVKYMIGRHGRCLLADDMGLGKSVQSLGAASYYRDEWPLLIISPSSVKMAWRDQVKKWITEPVDILVIDTSKDIKHENFEHLNKNSIILVSYDLVSRLSSHLLKFNFKVIIMDESHFIKSGLTARAKGCIPLAKKANRLFLLSGTPALSRPSEMFTQIDVIAPSLYNGYFKEFGNRYCDPQFTNWGINYNGSSNTSELQILLNEGIMLRRLKSEVLGQLPEKRREVILLASKFLEKASLKRHADIMMKDNLKSLQRRGALLEYFHATGKAKIDAIKNYIDDLLESPRKFLFFAHHSEVLNAVEDQIIKK 438          

HSP 2 Score: 414.846 bits (1065), Expect = 2.597e-135
Identity = 253/258 (98.06%), Postives = 256/258 (99.22%), Query Frame = 2
Query: 1334 QKIGYVRIDGNVTSENKRVRTEKFQTDESIQIAILSXXXXXXXXXXXXXXXXVFGELFWNPGILLQAENRCHRIGQKDYVNIHYLVAEQTADDYIWPLVQSKMELLTKVGLNKENFKNSDTKRLEESFSEKDTNTKILDYFQSDFIEDIQFEEFIDLNIEFPQTESKNEYGNENLKKIDRNETPKEKIXXXXXXXXXXXXXXXXXYETEPKKHCDMLQSVIKDVNKCKSAEEHQTDFVXXXXXXXXXXXXXGWVSTKR 2107
            +K+GYVRIDGNV+SENKRVRTEKFQTDESIQIAILSIVAAGTGITLTAATLVVFGELFWNPGILLQAENRCHRIGQKDYVNIHYLVAEQTADDYIWPLVQSKMELLTKVGLNKENFKNSDTKRLEESFSEKDTNTKILDYFQSDFIEDIQFEEFIDLNIEFPQTESKNEYGNENLKKID NETPKEKIDSFDDSFDFEFMNEFDSYETEPKKHCDMLQSVIKDVNKCKS EEHQTDFVDNDLDLLLNDDDDGWVSTKR
Sbjct:  438 KKVGYVRIDGNVSSENKRVRTEKFQTDESIQIAILSIVAAGTGITLTAATLVVFGELFWNPGILLQAENRCHRIGQKDYVNIHYLVAEQTADDYIWPLVQSKMELLTKVGLNKENFKNSDTKRLEESFSEKDTNTKILDYFQSDFIEDIQFEEFIDLNIEFPQTESKNEYGNENLKKIDSNETPKEKIDSFDDSFDFEFMNEFDSYETEPKKHCDMLQSVIKDVNKCKSTEEHQTDFVDNDLDLLLNDDDDGWVSTKR 695          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 vs. Planmine SMEST
Match: SMESG000074988.1 (SMESG000074988.1)

HSP 1 Score: 89.3521 bits (220), Expect = 4.533e-18
Identity = 61/211 (28.91%), Postives = 101/211 (47.87%), Query Frame = 3
Query:  372 DAKIRESLFPFQVQGVKYMI-------GRHGR-CLLADDMGLGKSVQSLGAASYYRDEWP---------LLIISPSSVKMAWRDQVKKWITEPVDILVIDTSKDIKHENFEHLNKNSIILVSYDLVSRLSSHLLKFNFKVIIMDESHFIKSGLTARAKGCIPLAKKANRLFLLSGTPALSRPSEMFTQIDVIAPSLYNGYFKEFGNRYCDP 953
            D ++   + P Q+ GV +M          +G   +LAD MGLGK+VQ++   S   ++ P          LI+ PSS+ + W+++ +KWI     I+    S D+  E F    KNS++++SY+++ R    L   +F +I+ DE+H +K G          L  K  R  LL+GTP  +   E F  +    P +     + F  R+ +P
Sbjct:  198 DPRLARRMRPHQIDGVIFMYECVAGFRAHNGTGAILADAMGLGKTVQTIALISIILNQGPYENETLIQKCLIVCPSSLVLNWKNEFEKWIG--TQIIPFCVSGDVSIEKFTQSLKNSVLILSYEMLLRNVEFLHGLSFDLIVCDEAHRLKHGSNKTFIAVESLQIK--RRILLTGTPLQNDMDEFFNLVQFANPGVLGCSKESFRQRFVNP 404          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 vs. Planmine SMEST
Match: SMESG000058195.1 (SMESG000058195.1)

HSP 1 Score: 81.6481 bits (200), Expect = 1.423e-15
Identity = 73/251 (29.08%), Postives = 124/251 (49.40%), Query Frame = 3
Query:  381 IRESLFPFQVQGVKYMIGRHGRCL---LADDMGLGKSVQSLGAASYYRDE---W-PLLIISPSSVKMAWRDQVKKWITEPVDILVIDTS---KDIKHENFEHLNKNSIILVSYDLVSRLSSHLLKFNFKVIIMDESHFIKSGLTARAKGCIPLAKKANRLFLLSGTPALSRPSEMFTQIDVIAPSLYNGYFKEFGNRYCDPQFTNWGINYNGSSNTSELQIL--LNEGIMLRRLKSEVLGQLPEKRREVIL 1097
            IR +L  +Q  G+ ++   + + L   LAD+MGLGK++Q++   SY   E   W P LII P+SV + W  + KKW      IL    S   +  K + +   N   + + SY L  + S    +  +K +I+DE+  IK+  + R +  +     + R  LL+GTP  +   E+++ +  + P+++  + KEF   +  P      I  N   N   ++ L  L    +LRRLK +V  Q+P+K   +I+
Sbjct:  599 IRHTLREYQCVGLDWLAAIYEKRLNGILADEMGLGKTIQTIALLSYLACEKAIWGPHLIIVPTSVILNWEIEFKKWCP-GFKILTYYGSLKERREKRKGWTKTNAFHVCITSYKLAIQDSLSFKRKKWKYLILDEAQNIKNFKSQRWQTLLTF--NSQRRLLLTGTPLQNNLMELWSLMHFLMPNIFQSH-KEFQEWFGSP--LTGMIEGNAEYNEQLVRRLHKLLRPFILRRLKKDVEKQMPKKYEHIIM 843          

HSP 2 Score: 61.2326 bits (147), Expect = 2.416e-9
Identity = 37/97 (38.14%), Postives = 58/97 (59.79%), Query Frame = 2
Query: 1328 NYQKIGYVRIDGNVTSENKRVRTEKFQTDESIQIAILSXXXXXXXXXXXXXXXXVFGELFWNPGILLQAENRCHRIGQKDYVNIHYLVAEQTADDYI 1618
            +Y    Y+R+DG    E +++  E F  D  I + ILS  + G G+ LT A  V+F +  WNP +  QA++RCHRIGQ   V+I+ L+++ T ++ I
Sbjct: 1227 SYLGYRYLRLDGTTKVEQRQLLMESFNQDSRIFVFILSTRSGGLGVNLTGADTVIFYDSDWNPTMDAQAQDRCHRIGQTRDVHIYRLISQMTVEENI 1323          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 vs. Planmine SMEST
Match: SMESG000050888.1 (SMESG000050888.1)

HSP 1 Score: 79.337 bits (194), Expect = 6.454e-15
Identity = 70/282 (24.82%), Postives = 129/282 (45.74%), Query Frame = 3
Query:  318 TLPPDPISRVSDENYLKVDAKIRESLFPFQVQGVKYMIGRHGRCL---LADDMGLGKSVQSLGAASYY----RDEWPLLIISPSSVKMAWRDQVKKWITEPVDILVIDTSKDIKHENFEHLNKN-SIILVSYDLVSRLSSHLLKFNFKVIIMDESHFIKSGLTARAKGCIPLAKKANRLFLLSGTPALSRPSEMFTQIDVIAPSLYNGYFKEFGNRYCDPQFTNWGINYNGSSNTSELQILLNEG---------------IMLRRLKSEVLGQLPEKRREVI 1094
            TL       + +++ L V+ +++E    +Q++G+++++  +   L   LAD+MGLGK++Q++G  +Y     R   P LII P S    W  + +KW    + +L   +    K    +  N N +++L +Y+ + +    L K  +K +I+DE H +K+    +    +     A    LL+GTP  ++  E++  ++ + P ++               F  W   +N     S  ++ LN+                 +LRRLK EV  QLP+K   VI
Sbjct:  546 TLAHSVQEEIREQSSLLVNGQLKE----YQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMEKKRVNGPFLIIVPLSTMSNWALEFEKWAPSVIKVLYKGSPTTRKSIQSQLKNGNFNVLLTTYEYIIKDKCSLSKLKWKYMIIDEGHRMKNH-HCKLTQILNTYYLAPYRLLLTGTPLQNKLPELWALLNFLLPDIFQSV----------NTFEQW---FNAPFAISGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVESQLPDKVEYVI 809          
The following BLAST results are available for this feature:
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SMARCAL13.347e-11341.31SWI/SNF related, matrix associated, actin dependen... [more]
SMARCAL13.347e-11341.31SWI/SNF related, matrix associated, actin dependen... [more]
SMARCAL17.809e-10238.73SWI/SNF related, matrix associated, actin dependen... [more]
ZRANB32.298e-7837.39zinc finger RANBP2-type containing 3 [Source:HGNC ... [more]
ZRANB32.602e-7837.39zinc finger RANBP2-type containing 3 [Source:HGNC ... [more]
back to top
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
smrc-14.408e-9136.36SWI/SNF-related matrix-associated actin-dependent ... [more]
smrc-14.556e-9136.36SWI/SNF-related matrix-associated actin-dependent ... [more]
smrc-14.710e-9136.36SWI/SNF-related matrix-associated actin-dependent ... [more]
swsn-42.772e-1727.38SWI/SNF nucleosome remodeling complex component; S... [more]
Y116A8C.131.990e-1628.04pep chromosome:WBcel235:IV:16950066:16962868:1 gen... [more]
back to top
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Marcal13.512e-8232.63gene:FBgn0031655 transcript:FBtr0078992[more]
dom9.125e-1727.31gene:FBgn0020306 transcript:FBtr0342890[more]
dom1.001e-1627.31gene:FBgn0020306 transcript:FBtr0071603[more]
dom1.026e-1627.31gene:FBgn0020306 transcript:FBtr0071602[more]
kis9.506e-1624.33gene:FBgn0266557 transcript:FBtr0299837[more]
back to top
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zranb31.807e-7836.73zinc finger, RAN-binding domain containing 3 [Sour... [more]
zranb31.915e-7836.73zinc finger, RAN-binding domain containing 3 [Sour... [more]
zranb35.567e-4338.46zinc finger, RAN-binding domain containing 3 [Sour... [more]
smarcal13.941e-3640.46pep chromosome:GRCz11:9:52479142:52490579:-1 gene:... [more]
btaf11.315e-1830.00BTAF1 RNA polymerase II, B-TFIID transcription fac... [more]
back to top
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ankrd61.035e-11540.71ankyrin repeat domain 6 [Source:Xenbase;Acc:XB-GEN... [more]
ankrd61.287e-11038.43ankyrin repeat domain 6 [Source:Xenbase;Acc:XB-GEN... [more]
ankrd68.012e-11039.29ankyrin repeat domain 6 [Source:Xenbase;Acc:XB-GEN... [more]
ankrd61.117e-10939.29ankyrin repeat domain 6 [Source:Xenbase;Acc:XB-GEN... [more]
ankrd62.000e-10938.62ankyrin repeat domain 6 [Source:Xenbase;Acc:XB-GEN... [more]
back to top
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Smarcal19.684e-11541.98SWI/SNF related matrix associated, actin dependent... [more]
Smarcal19.684e-11541.98SWI/SNF related matrix associated, actin dependent... [more]
Zranb31.414e-8038.57zinc finger, RAN-binding domain containing 3 [Sour... [more]
Zranb31.414e-8038.57zinc finger, RAN-binding domain containing 3 [Sour... [more]
Chd1l6.411e-1726.21chromodomain helicase DNA binding protein 1-like [... [more]
back to top
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|B2ZFP3|SMAL1_DANRE6.929e-11941.91SWI/SNF-related matrix-associated actin-dependent ... [more]
sp|Q498E7|SMAL1_XENLA2.920e-11741.18SWI/SNF-related matrix-associated actin-dependent ... [more]
sp|Q0P4U8|SMAL1_XENTR6.380e-11740.94SWI/SNF-related matrix-associated actin-dependent ... [more]
sp|Q8BJL0|SMAL1_MOUSE5.880e-11441.98SWI/SNF-related matrix-associated actin-dependent ... [more]
sp|Q9NZC9|SMAL1_HUMAN1.480e-11241.31SWI/SNF-related matrix-associated actin-dependent ... [more]
back to top
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
G4VHE41.051e-13343.81Harp (Smarcal1)-related OS=Schistosoma mansoni OX=... [more]
A0A4E0RVC42.921e-13343.63SWI:SNF matrix associated OS=Fasciola hepatica OX=... [more]
A0A504YQ492.967e-13343.6326S proteasome non-ATPase regulatory subunit 14 OS... [more]
A0A3Q0KLV01.019e-13143.81Harp (Smarcal1)-related OS=Schistosoma mansoni OX=... [more]
A0A183QPK51.457e-13143.82Uncharacterized protein OS=Schistosoma rodhaini OX... [more]
back to top
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
smarcal15.203e-11841.84SWI/SNF related, matrix associated, actin dependen... [more]
zranb37.016e-7435.29zinc finger, RAN-binding domain containing 3 [Sour... [more]
chd1l1.341e-1926.97chromodomain helicase DNA binding protein 1-like [... [more]
btaf16.823e-1930.00B-TFIID TATA-box binding protein associated factor... [more]
btaf16.850e-1930.00B-TFIID TATA-box binding protein associated factor... [more]
back to top
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SMARCAL13.993e-11941.07SWI/SNF related, matrix associated, actin dependen... [more]
zranb35.256e-7735.73zinc finger, RAN-binding domain containing 3 [Sour... [more]
SMARCA51.317e-1626.97SWI/SNF related, matrix associated, actin dependen... [more]
SMARCA51.769e-1626.97SWI/SNF related, matrix associated, actin dependen... [more]
ENSPMAT00000001164.13.625e-1628.38pep scaffold:Pmarinus_7.0:GL482256:352:18794:-1 ge... [more]
back to top
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
ISW21.716e-1831.22ATP-dependent DNA translocase involved in chromati... [more]
ISW12.810e-1726.55ATPase subunit of imitation-switch (ISWI) class ch... [more]
MOT11.019e-1626.82Essential protein involved in regulation of transc... [more]
IRC51.284e-1627.76Putative ATPase containing the DEAD/H helicase-rel... [more]
STH12.659e-1626.29ATPase component of the RSC chromatin remodeling c... [more]
back to top
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO495811.852e-12240.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO319434.684e-3228.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO284762.861e-2534.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO410592.980e-1727.01Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO393243.381e-1627.20Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
smarcal11.332e-12140.69SWI/SNF related, matrix associated, actin dependen... [more]
zranb35.331e-7535.26zinc finger RANBP2-type containing 3 [Source:NCBI ... [more]
zranb36.557e-7535.26zinc finger RANBP2-type containing 3 [Source:NCBI ... [more]
zranb36.557e-7535.26zinc finger RANBP2-type containing 3 [Source:NCBI ... [more]
zranb39.293e-7535.26zinc finger RANBP2-type containing 3 [Source:NCBI ... [more]
back to top
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000045797.11.348e-1299.53SMESG000045797.1[more]
SMESG000045797.12.597e-13599.53SMESG000045797.1[more]
SMESG000074988.14.533e-1828.91SMESG000074988.1[more]
SMESG000058195.11.423e-1529.08SMESG000058195.1[more]
SMESG000050888.16.454e-1524.82SMESG000050888.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028010 ID=SMED30028010|Name=SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=2112bp
ATTAGTTTTAATTTCTGTTTTTTTAAATGTTTAGCTCAAACAGCACATCT
TTAAAGAAAGATACATCTAAAATTCCTACTTCATTAGTTTTATACTCACA
CGAACGCTTTGAAATTATTATTGGTTATAATGAAAGAGTTATAAATGTCA
TAAAGTCCATCAAGTCTAGTGAATATGATCAAAATACTCGAAAATGGAAT
ATTTTATTAACTAAATATAAAGAAACGGTCACAGCTTTAAATAAACTTGG
TATACTTGATATTACATTGTTACCGAATTATGTCATAAAAATTTTTAATC
ATAAAATAAATAATCTGACACTGCCACCTGATCCGATAAGCAGAGTTTCA
GATGAAAATTATTTAAAAGTTGATGCAAAGATTAGAGAATCTTTATTTCC
ATTTCAGGTTCAAGGTGTAAAATATATGATAGGCCGACATGGTCGATGTC
TTTTGGCAGATGACATGGGATTAGGAAAATCAGTCCAGTCTCTAGGTGCT
GCATCTTACTATCGAGATGAATGGCCATTATTGATAATTAGCCCTAGCTC
CGTCAAAATGGCCTGGCGAGATCAAGTAAAAAAATGGATAACTGAGCCAG
TTGATATACTCGTTATTGACACTAGTAAAGACATTAAACATGAAAACTTT
GAACATTTAAATAAAAATTCCATTATACTCGTCAGTTATGATCTTGTATC
AAGATTGTCAAGTCATTTATTGAAATTTAATTTCAAAGTTATTATTATGG
ACGAATCACATTTTATAAAATCTGGATTGACAGCACGAGCTAAAGGCTGT
ATACCATTAGCAAAGAAAGCAAATCGCCTATTTCTTCTAAGTGGAACGCC
GGCTCTAAGTCGACCATCAGAAATGTTCACTCAGATCGACGTTATAGCTC
CTTCACTTTATAATGGATATTTTAAAGAATTTGGTAACAGATATTGTGAT
CCGCAATTTACAAACTGGGGAATCAATTACAATGGTTCATCGAATACATC
AGAATTACAAATACTTCTCAATGAAGGAATTATGTTAAGACGACTAAAAT
CAGAAGTTCTAGGACAATTACCTGAAAAACGACGAGAAGTTATTCTTTTA
GCTTCCAAGTTTTTAGAGAAAGCTTCCTTAAAACGACACGCTGATATTAT
GATGAAAGATAATTTGAAAAGCTTACAGAGAAGAGGCGCCCTATTAGAGT
ATTTCCACGCAACCGGGAAAGCTAAAATAGATGCGATTAAGAATTATATT
GATGATTTATTAGAATCACCAAGAAAATTTCTATTCTTTGCACATCACAG
TGAAGTGTTGAATGCCGTTGAAGATCAAATTATCAAAAAATTGGCTATGT
TCGAATCGACGGTAACGTAACTTCAGAAAATAAACGAGTCCGTACTGAGA
AGTTTCAAACAGATGAATCAATTCAAATAGCTATCTTATCGATTGTTGCG
GCTGGCACCGGAATTACACTTACTGCTGCAACTTTAGTGGTTTTTGGTGA
GTTGTTTTGGAATCCCGGAATCTTATTGCAAGCTGAAAATAGATGTCACA
GAATAGGGCAAAAGGATTACGTAAATATTCATTATTTAGTGGCTGAACAA
ACTGCTGATGATTATATCTGGCCTCTCGTGCAAAGTAAAATGGAGTTATT
GACAAAAGTAGGCTTAAATAAAGAAAATTTCAAAAATTCTGATACAAAAA
GACTTGAAGAGTCTTTTAGTGAAAAAGACACTAATACAAAAATATTAGAT
TATTTTCAGTCAGATTTTATTGAAGATATTCAATTTGAAGAATTTATTGA
TTTAAACATAGAGTTTCCACAAACTGAGTCTAAAAATGAATATGGAAATG
AGAACCTAAAAAAAATTGACAGAAATGAAACGCCAAAGGAGAAAATTGAT
TCATTTGATGACAGCTTTGATTTCGAATTTATGAATGAATTTGATAGTTA
TGAAACAGAACCAAAGAAACATTGTGATATGTTGCAATCTGTTATTAAAG
ATGTAAATAAATGTAAATCAGCCGAAGAACACCAAACAGATTTTGTTGAT
AACGATCTAGATTTGCTGCTCAATGATGATGATGATGGTTGGGTGTCGAC
GAAACGCTAGAT
back to top

protein sequence of SMED30028010-orf-1

>SMED30028010-orf-1 ID=SMED30028010-orf-1|Name=SMED30028010-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=448bp
MFSSNSTSLKKDTSKIPTSLVLYSHERFEIIIGYNERVINVIKSIKSSEY
DQNTRKWNILLTKYKETVTALNKLGILDITLLPNYVIKIFNHKINNLTLP
PDPISRVSDENYLKVDAKIRESLFPFQVQGVKYMIGRHGRCLLADDMGLG
KSVQSLGAASYYRDEWPLLIISPSSVKMAWRDQVKKWITEPVDILVIDTS
KDIKHENFEHLNKNSIILVSYDLVSRLSSHLLKFNFKVIIMDESHFIKSG
LTARAKGCIPLAKKANRLFLLSGTPALSRPSEMFTQIDVIAPSLYNGYFK
EFGNRYCDPQFTNWGINYNGSSNTSELQILLNEGIMLRRLKSEVLGQLPE
KRREVILLASKFLEKASLKRHADIMMKDNLKSLQRRGALLEYFHATGKAK
IDAIKNYIDDLLESPRKFLFFAHHSEVLNAVEDQIIKKLAMFESTVT*
back to top

protein sequence of SMED30028010-orf-2

>SMED30028010-orf-2 ID=SMED30028010-orf-2|Name=SMED30028010-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=157bp
MELLTKVGLNKENFKNSDTKRLEESFSEKDTNTKILDYFQSDFIEDIQFE
EFIDLNIEFPQTESKNEYGNENLKKIDRNETPKEKIDSFDDSFDFEFMNE
FDSYETEPKKHCDMLQSVIKDVNKCKSAEEHQTDFVDNDLDLLLNDDDDG
WVSTKR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0006281DNA repair
GO:0031297replication fork processing
GO:0000278mitotic cell cycle
GO:0000733DNA strand renaturation
GO:0001525angiogenesis
GO:0006259DNA metabolic process
GO:0006357regulation of transcription from RNA polymerase II promoter
GO:0010172embryonic body morphogenesis
GO:0030097hemopoiesis
GO:0048589developmental growth
GO:0051216cartilage development
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR014001Helicase_ATP-bd
IPR000330SNF2_N
IPR027417P-loop_NTPase
IPR010003HARP_dom
IPR001024PLAT/LH2_dom
IPR001650Helicase_C
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0005515protein binding
GO:0000166nucleotide binding
GO:0004386helicase activity
GO:0008094DNA-dependent ATPase activity
GO:0016787hydrolase activity
GO:0036310annealing helicase activity
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus