Fermitin family member 1

Overview
NameFermitin family member 1
Smed IDSMED30028005
Length (bp)2265
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Fermitin family member 1 (SMED30028005) t-SNE clustered cells

Violin plots show distribution of expression levels for Fermitin family member 1 (SMED30028005) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Fermitin family member 1 (SMED30028005) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Fermitin family member 1 (SMED30028005) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028005

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermisSMED30028005SMESG000005290.1 dd_Smed_v4_30299_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30028005SMESG000005290.1 dd_Smed_v4_30299_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30028005SMESG000005290.1 dd_Smed_v4_30299_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Fermitin family member 1 vs. Ensembl Human
Match: FERMT2 (fermitin family member 2 [Source:HGNC Symbol;Acc:HGNC:15767])

HSP 1 Score: 92.8189 bits (229), Expect = 8.578e-19
Identity = 86/323 (26.63%), Postives = 151/323 (46.75%), Query Frame = 3
Query:  138 GIKMISNYGYIDGSWKLKIVSEDLNGVVLLTVFNNTILGEIYMKIAQYFNMEKNQMKNFGLWCRNKNIWLLKTELTLHQLSLNANSTLFFTKKYKEINIQLTNKLNRKIVVDFSVQFLHVIKDICMEFEIENFHIYSLLRYRRIYDGVTSI----KPKTFSNKLSKSHLTASLRNLTSNFPN--QKRISKNFGS--NCPWTPTSGYGSLSSNVNSLENFHGSCLSINTQANHYTYDHHNNANKLNNDIHLTTFSN-HQPIKSKSNFDRSKLNRDWINLSKSLMEQNINESSSLIFKIKSLTINFDEENISDDL-LDLLYEQFK 1076
            GI+M  +  Y DG+W+L +   DLN  V L V     +G + +K+ +  +++K+   +  LW   K  WLLKT  TL +  + A++ L FT ++K + +QL N    K+ V+FS +    + DIC  F I +    SLL+  R            + +  + +L    +T    ++ S+ P    K ++  + +    P +PTS +            F  S LS              N   L     +T+     +  K ++  D++K+N+ W++ S+SLMEQ++ E+ +L+ + K  +  FD     D + ++ LYEQ K
Sbjct:    5 GIRM-PDGCYADGTWELSVHVTDLNRDVTLRVTGEVHIGGVMLKLVEKLDVKKD-WSDHALWWEKKRTWLLKTHWTLDKYGIQADAKLQFTPQHKLLRLQLPNMKYVKVKVNFSDRVFKAVSDICKTFNIRHPEELSLLKKPRDPTKKKKKKLDDQSEDEALELEGPLITPGSGSIYSS-PGLYSKTMTPTYDAHDGSPLSPTSAW------------FGDSALS------------EGNPGILAVSQPITSPEILAKMFKPQALLDKAKINQGWLDSSRSLMEQDVKENEALLLRFKYYSF-FDLNPKYDAIRINQLYEQAK 299          
BLAST of Fermitin family member 1 vs. Ensembl Human
Match: FERMT2 (fermitin family member 2 [Source:HGNC Symbol;Acc:HGNC:15767])

HSP 1 Score: 92.8189 bits (229), Expect = 8.578e-19
Identity = 86/323 (26.63%), Postives = 151/323 (46.75%), Query Frame = 3
Query:  138 GIKMISNYGYIDGSWKLKIVSEDLNGVVLLTVFNNTILGEIYMKIAQYFNMEKNQMKNFGLWCRNKNIWLLKTELTLHQLSLNANSTLFFTKKYKEINIQLTNKLNRKIVVDFSVQFLHVIKDICMEFEIENFHIYSLLRYRRIYDGVTSI----KPKTFSNKLSKSHLTASLRNLTSNFPN--QKRISKNFGS--NCPWTPTSGYGSLSSNVNSLENFHGSCLSINTQANHYTYDHHNNANKLNNDIHLTTFSN-HQPIKSKSNFDRSKLNRDWINLSKSLMEQNINESSSLIFKIKSLTINFDEENISDDL-LDLLYEQFK 1076
            GI+M  +  Y DG+W+L +   DLN  V L V     +G + +K+ +  +++K+   +  LW   K  WLLKT  TL +  + A++ L FT ++K + +QL N    K+ V+FS +    + DIC  F I +    SLL+  R            + +  + +L    +T    ++ S+ P    K ++  + +    P +PTS +            F  S LS              N   L     +T+     +  K ++  D++K+N+ W++ S+SLMEQ++ E+ +L+ + K  +  FD     D + ++ LYEQ K
Sbjct:    5 GIRM-PDGCYADGTWELSVHVTDLNRDVTLRVTGEVHIGGVMLKLVEKLDVKKD-WSDHALWWEKKRTWLLKTHWTLDKYGIQADAKLQFTPQHKLLRLQLPNMKYVKVKVNFSDRVFKAVSDICKTFNIRHPEELSLLKKPRDPTKKKKKKLDDQSEDEALELEGPLITPGSGSIYSS-PGLYSKTMTPTYDAHDGSPLSPTSAW------------FGDSALS------------EGNPGILAVSQPITSPEILAKMFKPQALLDKAKINQGWLDSSRSLMEQDVKENEALLLRFKYYSF-FDLNPKYDAIRINQLYEQAK 299          
BLAST of Fermitin family member 1 vs. Ensembl Human
Match: FERMT2 (fermitin family member 2 [Source:HGNC Symbol;Acc:HGNC:15767])

HSP 1 Score: 92.4337 bits (228), Expect = 9.563e-19
Identity = 86/323 (26.63%), Postives = 151/323 (46.75%), Query Frame = 3
Query:  138 GIKMISNYGYIDGSWKLKIVSEDLNGVVLLTVFNNTILGEIYMKIAQYFNMEKNQMKNFGLWCRNKNIWLLKTELTLHQLSLNANSTLFFTKKYKEINIQLTNKLNRKIVVDFSVQFLHVIKDICMEFEIENFHIYSLLRYRRIYDGVTSI----KPKTFSNKLSKSHLTASLRNLTSNFPN--QKRISKNFGS--NCPWTPTSGYGSLSSNVNSLENFHGSCLSINTQANHYTYDHHNNANKLNNDIHLTTFSN-HQPIKSKSNFDRSKLNRDWINLSKSLMEQNINESSSLIFKIKSLTINFDEENISDDL-LDLLYEQFK 1076
            GI+M  +  Y DG+W+L +   DLN  V L V     +G + +K+ +  +++K+   +  LW   K  WLLKT  TL +  + A++ L FT ++K + +QL N    K+ V+FS +    + DIC  F I +    SLL+  R            + +  + +L    +T    ++ S+ P    K ++  + +    P +PTS +            F  S LS              N   L     +T+     +  K ++  D++K+N+ W++ S+SLMEQ++ E+ +L+ + K  +  FD     D + ++ LYEQ K
Sbjct:    5 GIRM-PDGCYADGTWELSVHVTDLNRDVTLRVTGEVHIGGVMLKLVEKLDVKKD-WSDHALWWEKKRTWLLKTHWTLDKYGIQADAKLQFTPQHKLLRLQLPNMKYVKVKVNFSDRVFKAVSDICKTFNIRHPEELSLLKKPRDPTKKKKKKLDDQSEDEALELEGPLITPGSGSIYSS-PGLYSKTMTPTYDAHDGSPLSPTSAW------------FGDSALS------------EGNPGILAVSQPITSPEILAKMFKPQALLDKAKINQGWLDSSRSLMEQDVKENEALLLRFKYYSF-FDLNPKYDAIRINQLYEQAK 299          
BLAST of Fermitin family member 1 vs. Ensembl Human
Match: FERMT2 (fermitin family member 2 [Source:HGNC Symbol;Acc:HGNC:15767])

HSP 1 Score: 92.4337 bits (228), Expect = 9.563e-19
Identity = 86/323 (26.63%), Postives = 151/323 (46.75%), Query Frame = 3
Query:  138 GIKMISNYGYIDGSWKLKIVSEDLNGVVLLTVFNNTILGEIYMKIAQYFNMEKNQMKNFGLWCRNKNIWLLKTELTLHQLSLNANSTLFFTKKYKEINIQLTNKLNRKIVVDFSVQFLHVIKDICMEFEIENFHIYSLLRYRRIYDGVTSI----KPKTFSNKLSKSHLTASLRNLTSNFPN--QKRISKNFGS--NCPWTPTSGYGSLSSNVNSLENFHGSCLSINTQANHYTYDHHNNANKLNNDIHLTTFSN-HQPIKSKSNFDRSKLNRDWINLSKSLMEQNINESSSLIFKIKSLTINFDEENISDDL-LDLLYEQFK 1076
            GI+M  +  Y DG+W+L +   DLN  V L V     +G + +K+ +  +++K+   +  LW   K  WLLKT  TL +  + A++ L FT ++K + +QL N    K+ V+FS +    + DIC  F I +    SLL+  R            + +  + +L    +T    ++ S+ P    K ++  + +    P +PTS +            F  S LS              N   L     +T+     +  K ++  D++K+N+ W++ S+SLMEQ++ E+ +L+ + K  +  FD     D + ++ LYEQ K
Sbjct:    5 GIRM-PDGCYADGTWELSVHVTDLNRDVTLRVTGEVHIGGVMLKLVEKLDVKKD-WSDHALWWEKKRTWLLKTHWTLDKYGIQADAKLQFTPQHKLLRLQLPNMKYVKVKVNFSDRVFKAVSDICKTFNIRHPEELSLLKKPRDPTKKKKKKLDDQSEDEALELEGPLITPGSGSIYSS-PGLYSKTMTPTYDAHDGSPLSPTSAW------------FGDSALS------------EGNPGILAVSQPITSPEILAKMFKPQALLDKAKINQGWLDSSRSLMEQDVKENEALLLRFKYYSF-FDLNPKYDAIRINQLYEQAK 299          
BLAST of Fermitin family member 1 vs. Ensembl Human
Match: FERMT2 (fermitin family member 2 [Source:HGNC Symbol;Acc:HGNC:15767])

HSP 1 Score: 83.1889 bits (204), Expect = 5.800e-18
Identity = 48/143 (33.57%), Postives = 77/143 (53.85%), Query Frame = 3
Query:  138 GIKMISNYGYIDGSWKLKIVSEDLNGVVLLTVFNNTILGEIYMKIAQYFNMEKNQMKNFGLWCRNKNIWLLKTELTLHQLSLNANSTLFFTKKYKEINIQLTNKLNRKIVVDFSVQFLHVIKDICMEFEIENFHIYSLLRYRR 566
            GI+M  +  Y DG+W+L +   DLN  V L V     +G + +K+ +  +++K+   +  LW   K  WLLKT  TL +  + A++ L FT ++K + +QL N    K+ V+FS +    + DIC  F I +    SLL+  R
Sbjct:    5 GIRM-PDGCYADGTWELSVHVTDLNRDVTLRVTGEVHIGGVMLKLVEKLDVKKD-WSDHALWWEKKRTWLLKTHWTLDKYGIQADAKLQFTPQHKLLRLQLPNMKYVKVKVNFSDRVFKAVSDICKTFNIRHPEELSLLKKPR 145          
BLAST of Fermitin family member 1 vs. Ensembl Celegans
Match: unc-112 (pep chromosome:WBcel235:V:14691854:14697107:-1 gene:WBGene00006836.1 transcript:C47E8.7.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:unc-112)

HSP 1 Score: 85.8853 bits (211), Expect = 4.712e-17
Identity = 84/341 (24.63%), Postives = 138/341 (40.47%), Query Frame = 3
Query:  147 MISNYGYIDGSWKLKIVSEDLNGVVLLTVFNNTILGEIYMKIAQYFNMEKNQMKNFGLWCRNKNIWLLKTELTLHQLSLNANSTLFFTKKYKEINIQLTNKLNRKIVVDFSVQFLHVIKDICMEFEIENFHIYSLLRYRRIYD------------GVTSIKPKTFSNKLSKSHLTASLRNLTSNFPNQKRISKNFGSNCPWTPTSG-------------YGSLSSNVNSLENFHGSCLSINTQANHYTYDHHNNANKLNND-IHLTTF--SNHQPIKSKSNF-DRSKLNRDWINLSKSLMEQNINESSSLIFKIKSLTINFDEENISDDLLDL--LYEQFK 1076
            ++     IDG W+L I+  DLN    ++V  N  +G + +++    ++E++   +  LW   K  WL  T  TL Q  + A + L FT  +KE  IQL +       VDFSV      K +C +  I      SL RY    D            G  S++P        +S    +LR     F +Q  +        P    SG             +G+L   V+     +   +         ++       + ++  IH      S   P+    N+ +++ +NR W++ S+SLMEQ I E   ++ + K   +NF + N   D + +  LYEQ K
Sbjct:    4 LVEGTSIIDGKWQLPILVTDLNIQRSISVLGNLNVGGLMLELVSECDVERD-WSDHALWWPEKRRWLQHTRSTLDQNGITAETQLEFTPMHKEARIQLPDMQMIDARVDFSVNSFKATKKLCRDLGIRYSEELSLKRYIPPEDLRRGTSDADNMNGPLSMRPG------EESVGPMTLRKAAPIFASQSNLDMRRRGQSPALSQSGHIFNAHEMGTLPRHGTLPRGVSPSPGAYNDTMRRTPIMPSISFSEGLENEQFDDALIHSPRLAPSRDTPVFRPQNYVEKAAINRGWLDSSRSLMEQGIFEGDIILLRFK--FMNFFDLNPKYDPVRINQLYEQAK 335          
BLAST of Fermitin family member 1 vs. Ensembl Celegans
Match: unc-112 (pep chromosome:WBcel235:V:14691857:14696654:-1 gene:WBGene00006836.1 transcript:C47E8.7.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:unc-112)

HSP 1 Score: 85.8853 bits (211), Expect = 4.712e-17
Identity = 84/341 (24.63%), Postives = 138/341 (40.47%), Query Frame = 3
Query:  147 MISNYGYIDGSWKLKIVSEDLNGVVLLTVFNNTILGEIYMKIAQYFNMEKNQMKNFGLWCRNKNIWLLKTELTLHQLSLNANSTLFFTKKYKEINIQLTNKLNRKIVVDFSVQFLHVIKDICMEFEIENFHIYSLLRYRRIYD------------GVTSIKPKTFSNKLSKSHLTASLRNLTSNFPNQKRISKNFGSNCPWTPTSG-------------YGSLSSNVNSLENFHGSCLSINTQANHYTYDHHNNANKLNND-IHLTTF--SNHQPIKSKSNF-DRSKLNRDWINLSKSLMEQNINESSSLIFKIKSLTINFDEENISDDLLDL--LYEQFK 1076
            ++     IDG W+L I+  DLN    ++V  N  +G + +++    ++E++   +  LW   K  WL  T  TL Q  + A + L FT  +KE  IQL +       VDFSV      K +C +  I      SL RY    D            G  S++P        +S    +LR     F +Q  +        P    SG             +G+L   V+     +   +         ++       + ++  IH      S   P+    N+ +++ +NR W++ S+SLMEQ I E   ++ + K   +NF + N   D + +  LYEQ K
Sbjct:    4 LVEGTSIIDGKWQLPILVTDLNIQRSISVLGNLNVGGLMLELVSECDVERD-WSDHALWWPEKRRWLQHTRSTLDQNGITAETQLEFTPMHKEARIQLPDMQMIDARVDFSVNSFKATKKLCRDLGIRYSEELSLKRYIPPEDLRRGTSDADNMNGPLSMRPG------EESVGPMTLRKAAPIFASQSNLDMRRRGQSPALSQSGHIFNAHEMGTLPRHGTLPRGVSPSPGAYNDTMRRTPIMPSISFSEGLENEQFDDALIHSPRLAPSRDTPVFRPQNYVEKAAINRGWLDSSRSLMEQGIFEGDIILLRFK--FMNFFDLNPKYDPVRINQLYEQAK 335          
BLAST of Fermitin family member 1 vs. Ensembl Fly
Match: Fit2 (gene:FBgn0036688 transcript:FBtr0075275)

HSP 1 Score: 76.6406 bits (187), Expect = 4.936e-14
Identity = 81/330 (24.55%), Postives = 143/330 (43.33%), Query Frame = 3
Query:  177 SWKLKIVSEDLNGVVLLTVFNNTILGEIYMKIAQYFNMEKNQMKNFGLWCRNKNIWLLKTELTLHQLSLNANSTLFFTKKYKEINIQLTNKLNRKIVVDFSVQFLHVIKDICMEFEIENFHIYSLLR----------------YRRI----YDGVTSIKPKTFSNKLSKSHLTASLRNLTSNFPNQKRISKNFGSNCPWTPTSGYGSLS-SNVNSLENFHGSCLSINTQANHYTYDHHNNANKLNNDIHLTTFSNHQP--------IKSKSNFDRSKLNRDWINLSKSLMEQNINESSSLIFKIKSLTINFDEENISDDL-LDLLYEQFK 1076
            SW L+I   DL     + V  +  +G I +++    N       +  LW   +N+WL +T+LTL Q  + A+S L FT  +K + +QL +       VD+SV+    + ++C + +I      SL +                 +R+     DG T ++P   +N      ++ S      +  +  + S      C   P S +   + S V ++  F G+     +Q  + TYD  ++++ L +       S   P        ++ KS  ++++LN  W++ S S+MEQ I E  +L  + K  T  FD     D + ++ LYEQ K
Sbjct:    8 SWNLRIFITDLALEKTMRVRGDQHIGGIMLQLVDPEN--PKDWSDHALWWPARNVWLSRTKLTLDQCGVQADSLLHFTPMHKILRVQLPDLRYLDSRVDYSVKTFSAVVNLCKQLDIRYPEELSLCKPLEAEHLKRNFAQVPHQKRVPIAEPDGTTYLQPAADTNSFVP--ISTSFHGEGGSTGSLDKPSAPGSFFC--APLSPHNHRARSPVRTVSPFPGTWK--QSQLGYATYD--SSSSSLGDFQENLASSPPTPCADVRALQLRPKSLVEKARLNVGWLDSSLSIMEQGIREYDTLCLRFKYFTF-FDLNPKCDQVRINQLYEQAK 326          
BLAST of Fermitin family member 1 vs. Ensembl Fly
Match: Fit1 (gene:FBgn0035498 transcript:FBtr0073209)

HSP 1 Score: 72.7886 bits (177), Expect = 7.076e-13
Identity = 72/326 (22.09%), Postives = 141/326 (43.25%), Query Frame = 3
Query:  177 SWKLKIVSEDLNGVVLLTVFNNTILGEIYMKIAQYFNMEKNQMKNFGLWCRNKNIWLLKTELTLHQLSLNANSTLFFTKKYKEINIQLTNKLNRKIVVDFSVQFLHVIKDICMEFEI------------ENFHI---YSLLRYRRI----YDGVTSIKPKTFSNKLSKSHLTASLRNLTSNF-PNQKRISKNFGSNCPWTPTSGYGSLSSNVNSLENFHGSCLSINTQANHYTYDHHNNANKLNNDIHLTTFSNHQPIKS-----KSNFDRSKLNRDWINLSKSLMEQNINESSSLIFKIKSLTINFDEENISDDL-LDLLYEQFK 1076
            +W L+I+  DL     L V  +  +G + + +     + K+   +  LW   KNIWL +T  TL Q  + ++S L FT  +K + +Q+ +       V+FS +    +  +C + +I            E  H+   +S L  R+I     +G+  ++P   +N         S   +T  +  +   + ++   N    P S Y   ++          +    +    + +YD +++   L  ++ ++  S    +++     KS  ++++LN  W++ S S+MEQ + E  +L  + K  T  FD     D + ++ LYEQ K
Sbjct:    8 TWNLRILITDLQVEKTLRVKGDQHIGGVMLNLVDP-ELPKD-WSDHALWWPAKNIWLTRTRSTLDQAGVQSDSFLHFTPMHKTLRVQMPDLRYLDYRVNFSAKTFGAVVSLCKDLDIRYPEELSFCKPLEPEHLKKNFSKLPQRKIPVAEANGIAYVQPALDTN---------SFVPITGAYNGSNGSLDRSHNGNLLCAPASPYTRRAATAPGTPISSPTGTWKHNSTGYASYDSNSSFGDLQENLAMSPRSPSPDVRARLVRPKSRVEKARLNVGWLDSSLSIMEQGVREYDTLCLRFKYFTF-FDLNPKYDQVRINQLYEQAK 321          
BLAST of Fermitin family member 1 vs. Ensembl Fly
Match: Fit1 (gene:FBgn0035498 transcript:FBtr0073210)

HSP 1 Score: 72.7886 bits (177), Expect = 7.076e-13
Identity = 72/326 (22.09%), Postives = 141/326 (43.25%), Query Frame = 3
Query:  177 SWKLKIVSEDLNGVVLLTVFNNTILGEIYMKIAQYFNMEKNQMKNFGLWCRNKNIWLLKTELTLHQLSLNANSTLFFTKKYKEINIQLTNKLNRKIVVDFSVQFLHVIKDICMEFEI------------ENFHI---YSLLRYRRI----YDGVTSIKPKTFSNKLSKSHLTASLRNLTSNF-PNQKRISKNFGSNCPWTPTSGYGSLSSNVNSLENFHGSCLSINTQANHYTYDHHNNANKLNNDIHLTTFSNHQPIKS-----KSNFDRSKLNRDWINLSKSLMEQNINESSSLIFKIKSLTINFDEENISDDL-LDLLYEQFK 1076
            +W L+I+  DL     L V  +  +G + + +     + K+   +  LW   KNIWL +T  TL Q  + ++S L FT  +K + +Q+ +       V+FS +    +  +C + +I            E  H+   +S L  R+I     +G+  ++P   +N         S   +T  +  +   + ++   N    P S Y   ++          +    +    + +YD +++   L  ++ ++  S    +++     KS  ++++LN  W++ S S+MEQ + E  +L  + K  T  FD     D + ++ LYEQ K
Sbjct:    8 TWNLRILITDLQVEKTLRVKGDQHIGGVMLNLVDP-ELPKD-WSDHALWWPAKNIWLTRTRSTLDQAGVQSDSFLHFTPMHKTLRVQMPDLRYLDYRVNFSAKTFGAVVSLCKDLDIRYPEELSFCKPLEPEHLKKNFSKLPQRKIPVAEANGIAYVQPALDTN---------SFVPITGAYNGSNGSLDRSHNGNLLCAPASPYTRRAATAPGTPISSPTGTWKHNSTGYASYDSNSSFGDLQENLAMSPRSPSPDVRARLVRPKSRVEKARLNVGWLDSSLSIMEQGVREYDTLCLRFKYFTF-FDLNPKYDQVRINQLYEQAK 321          
BLAST of Fermitin family member 1 vs. Ensembl Zebrafish
Match: fermt2 (fermitin family member 2 [Source:NCBI gene;Acc:553051])

HSP 1 Score: 103.219 bits (256), Expect = 3.146e-22
Identity = 87/330 (26.36%), Postives = 153/330 (46.36%), Query Frame = 3
Query:  138 GIKMISNYGYIDGSWKLKIVSEDLNGVVLLTVFNNTILGEIYMKIAQYFNMEKNQMKNFGLWCRNKNIWLLKTELTLHQLSLNANSTLFFTKKYKEINIQLTNKLNRKIVVDFSVQFLHVIKDICMEFEIENFHIYSLLRYRR--------IYDGVTS--------IKPKTFSNKLSKSHLTASLRNLTSNFPNQKRISKNFGSNCPWTPTSGYGSLSSNVNSLENFHGSCLSINTQANHYTYDHHNNANKLNNDIHLTTFSNHQPIKSKSNFDRSKLNRDWINLSKSLMEQNINESSSLIFKIKSLTINFDEENISDDL-LDLLYEQFK 1076
            GI+M  +  Y DG+W+LK+   DLN  V L V     +G + +K+ +  +++K+   +  LW   K  WLLKT  TL +  + A++ L FT ++K + +QL N  + ++ V+FS +    + DIC  F I +    SLLR  R        + D            + P + S+ L    +  S+ +    +      + +     P +PTS +   S     L   + S L+++                 + DI +  +      K +S  D++K+N+ W++ S+SLMEQ++ E+  L+ + K  +  FD     D + ++ LYEQ K
Sbjct:    5 GIRM-PDGCYADGTWELKMHVTDLNRDVSLRVTGEIHIGGVMLKLVEKLDVKKD-WSDHALWWEKKKTWLLKTHWTLDKYGIQADARLLFTPQHKLLRLQLPNMKHMRVKVNFSDRVFKAVSDICKTFNIRHPEELSLLRKPRDPKKKKKKLEDAEEETLELEGPLLTPGSASDVLYIGPVKGSIYSSPGLYSKTMTPTYDSRDGSPLSPTSAWFGDS----PLSEGNPSILAVSQPIT-------------SPDILVKMY------KPQSLLDKAKINQGWLDSSRSLMEQDVKENEVLLLRFKYHSF-FDLNPKYDAIRVNQLYEQAK 308          
BLAST of Fermitin family member 1 vs. Ensembl Zebrafish
Match: fermt2 (fermitin family member 2 [Source:NCBI gene;Acc:553051])

HSP 1 Score: 102.834 bits (255), Expect = 3.408e-22
Identity = 87/330 (26.36%), Postives = 153/330 (46.36%), Query Frame = 3
Query:  138 GIKMISNYGYIDGSWKLKIVSEDLNGVVLLTVFNNTILGEIYMKIAQYFNMEKNQMKNFGLWCRNKNIWLLKTELTLHQLSLNANSTLFFTKKYKEINIQLTNKLNRKIVVDFSVQFLHVIKDICMEFEIENFHIYSLLRYRR--------IYDGVTS--------IKPKTFSNKLSKSHLTASLRNLTSNFPNQKRISKNFGSNCPWTPTSGYGSLSSNVNSLENFHGSCLSINTQANHYTYDHHNNANKLNNDIHLTTFSNHQPIKSKSNFDRSKLNRDWINLSKSLMEQNINESSSLIFKIKSLTINFDEENISDDL-LDLLYEQFK 1076
            GI+M  +  Y DG+W+LK+   DLN  V L V     +G + +K+ +  +++K+   +  LW   K  WLLKT  TL +  + A++ L FT ++K + +QL N  + ++ V+FS +    + DIC  F I +    SLLR  R        + D            + P + S+ L    +  S+ +    +      + +     P +PTS +   S     L   + S L+++                 + DI +  +      K +S  D++K+N+ W++ S+SLMEQ++ E+  L+ + K  +  FD     D + ++ LYEQ K
Sbjct:    5 GIRM-PDGCYADGTWELKMHVTDLNRDVSLRVTGEIHIGGVMLKLVEKLDVKKD-WSDHALWWEKKKTWLLKTHWTLDKYGIQADARLLFTPQHKLLRLQLPNMKHMRVKVNFSDRVFKAVSDICKTFNIRHPEELSLLRKPRDPKKKKKKLEDAEEETLELEGPLLTPGSASDVLYIGPVKGSIYSSPGLYSKTMTPTYDSRDGSPLSPTSAWFGDS----PLSEGNPSILAVSQPIT-------------SPDILVKMY------KPQSLLDKAKINQGWLDSSRSLMEQDVKENEVLLLRFKYHSF-FDLNPKYDAIRVNQLYEQAK 308          
BLAST of Fermitin family member 1 vs. Ensembl Zebrafish
Match: fermt2 (fermitin family member 2 [Source:NCBI gene;Acc:553051])

HSP 1 Score: 102.834 bits (255), Expect = 4.090e-22
Identity = 90/322 (27.95%), Postives = 156/322 (48.45%), Query Frame = 3
Query:  138 GIKMISNYGYIDGSWKLKIVSEDLNGVVLLTVFNNTILGEIYMKIAQYFNMEKNQMKNFGLWCRNKNIWLLKTELTLHQLSLNANSTLFFTKKYKEINIQLTNKLNRKIVVDFSVQFLHVIKDICMEFEIENFHIYSLLRYRR----IYDGVTSIKPKTFSNKLSKSHLTASLRNLTSNFPN--QKRISKNFGS--NCPWTPTSGYGSLSSNVNSLENFHGSCLSINTQANHYTYDHHNNANKLNNDIHLTTFSNHQPIKSKSNFDRSKLNRDWINLSKSLMEQNINESSSLIFKIKSLTINFDEENISDDL-LDLLYEQFK 1076
            GI+M  +  Y DG+W+LK+   DLN  V L V     +G + +K+ +  +++K+   +  LW   K  WLLKT  TL +  + A++ L FT ++K + +QL N  + ++ V+FS +    + DIC  F I +    SLLR  R        +   + +T   +L    LT    ++ S+ P    K ++  + S    P +PTS +   S     L   + S L+++                 + DI +  +      K +S  D++K+N+ W++ S+SLMEQ++ E+  L+ + K  +  FD     D + ++ LYEQ K
Sbjct:    5 GIRM-PDGCYADGTWELKMHVTDLNRDVSLRVTGEIHIGGVMLKLVEKLDVKKD-WSDHALWWEKKKTWLLKTHWTLDKYGIQADARLLFTPQHKLLRLQLPNMKHMRVKVNFSDRVFKAVSDICKTFNIRHPEELSLLRKPRDPKKKKKKLEDAEEETL--ELEGPLLTPGSGSIYSS-PGLYSKTMTPTYDSRDGSPLSPTSAWFGDS----PLSEGNPSILAVSQPIT-------------SPDILVKMY------KPQSLLDKAKINQGWLDSSRSLMEQDVKENEVLLLRFKYHSF-FDLNPKYDAIRVNQLYEQAK 297          
BLAST of Fermitin family member 1 vs. Ensembl Zebrafish
Match: fermt3b (fermitin family member 3b [Source:ZFIN;Acc:ZDB-GENE-040426-1366])

HSP 1 Score: 79.337 bits (194), Expect = 7.182e-15
Identity = 142/704 (20.17%), Postives = 274/704 (38.92%), Query Frame = 3
Query:  174 GSWKLKIVSEDLNG---VVLLTVFNNTILGEIYMKIAQYFNMEKNQMKNFGLWCRNKNIWLLKTELTLHQLSLNANSTLFFTKKYKEINIQLTNKLNRKIVVDFSVQFLHVIKDICMEFEIENFHIYSLLRYRRIYDGVTSIKPKTFSNKLSKSHLTASLRNLTSNFPNQKRISKNFGSNCPWTPTSGYGSLSSNVNSLENFHGSCLSINTQANHYTYDHHNNANKLNNDIHLTTFSNHQPI--------KSKSNFDRSKLNRDWINLSKSLMEQNINESSSLIFKIKSLTINFDEENISDDLLDLLYEQFKDFVXXXXXXXXXXXXXXXXXXQYNI-YLVEKQSYGNNNGNIHRNPRTNIPLSFDEEIDKMLFSLEKELLN----ISDEFDKSFSIRTDYFVGVHQIIPIKSSGKFLRMKLKLIKNQIKIFK--ENDFSNPKYEFCLKNCKFFTNFGVDSNENIISWMFECNKRLLKIEMKFFNDEDFFSLYSSAVAHSNFWWPSLKQIFDCERVARKLVEIFRSSDEPEYNIFNMPRVELVN---LLGCRIGKKEQSGKYLKTILQYNQCFKTLSRRKSKIQYIRFCLNFPRFNYHYFFVKIHEPPEEMGLTVVAVNEEMFIVFDPNYYSITRLVLPWAV--LKSWKFNTELNQLDLYF-KNLFISFTTQDCSAICFHEFISTFIWFASTDKTLDKADKISE 2213
             +W L +  EDL      + ++V ++  +G + +KI +   M K    +  LW   K  WLL+T  TL +  ++A++ L FT ++K + + L N    K+   FS      +  IC    I +    SLLR            P     K      +  L +LT               + P T     GS+ +  N +                    H  ++ K      + +FS   P         +  S  D++ ++  W++ S+SLM+Q I E+  L  + K  T +  +       L  LYEQ +  VL  +I+      ++  ALQY+I  L   Q  G++   +             ++++  L SLE +++      +D  D       + ++ + +   +   G + +   K     I  +K  E+ +  P  +  LK C+   +  +   +  I  +    + + +I ++  N++     YS  +A        L  +    +   K ++ F S      +       + +N   L+  R  KK +  +    IL+  Q    LS   + +++++     P F   YF V+     ++    V+ +     I  D     +  +V  W    ++ W  N ++ Q+ + F  N+ I+F+  +      HE+I  +I F ST ++  ++D ++E
Sbjct:    2 AAWDLNVTVEDLGPDAPPLQISVTSDLHIGGVILKIVEK-TMLKKDWSDHALWWEQKQQWLLRTGWTLDKCGVHADARLVFTPQHKPLRLGLPNGATLKMRACFSSPVFRCVMGICRVLNIRHPEELSLLR------------PVEEKKKKKDKDSSEELYDLT---------------DVPLTA----GSVQALYNGMPA------------------HFADSPKTEAVYKMLSFSLPSPAPEAIAKLYRPASVVDKTHIHTRWLDSSRSLMQQGIQENDKLWLRFKYYTFHDMDPKYDAVRLTQLYEQARWAVLLEDIDCTEEEMMLFGALQYHIGKLSTSQEIGSSCQGM-------------DDLESALKSLEVKMVGEGDSTTDMLDNMTPPELNDYLKIFRPKRLTLKG-YKQYWCKFQDTSISYYKSMEDRYGEPIQQLNLKGCEVAPDVNIAGQKFCIKLLIPAPEGMNEIYLRCENEKQ----YSEWMAGCKLASKGLTLLDSSYQNEVKNIQTFLSMQRSNSSTAAAQTDDSINTHSLVSPRYQKKYKPKQLTPRILEAFQNVAQLSLTSAILKFLQIWQALPDFGISYFMVRFKGSRKD---EVLGIANNRLIRID---LGVGDVVKTWRYNNMRQWNVNWDIRQVAIEFDGNINIAFSCVNADCKVVHEYIGGYI-FMST-RSRQQSDTLNE 629          
BLAST of Fermitin family member 1 vs. Ensembl Zebrafish
Match: fermt1 (fermitin family member 1 [Source:ZFIN;Acc:ZDB-GENE-030131-3264])

HSP 1 Score: 64.3142 bits (155), Expect = 4.253e-10
Identity = 77/318 (24.21%), Postives = 131/318 (41.19%), Query Frame = 3
Query:  150 ISNYGYIDGSWKLKIVSEDLNG----VVLLTVFNNTILGEIYMKIAQYFNMEKNQMKNFGLWCRNKNIWLLKTELTLHQLSLNANSTLFFTKKYKEINIQLTNKLNRKIVVDFSVQFLHVIKDICMEFEIENFHIYSLLRYRRIYDGVTSIKPKTFSNKLSKSHLTASLRNLTSNFPNQKRISKNFGSNCPWTPTSGYGSLSSNVNSLENFHGSCLSINTQANHYTYDHHNNANKLNNDIHLTTFSNHQPIKSKSNFDRSKLNRDWINLSKSLMEQNINESSSLIFKIK-----SLTINFDEENISDDLLDLLYEQFK 1076
            +++ G    +W+L I  +   G       L V  +  +G + +K+ +     ++   +  +W   K+ WLLKT  TL +  + AN+ L +T ++K + IQL N  N K+ V FS      + +IC    I      SLL+         + +PK    K   + L A+   LT +         +      + P SG     S V+S   ++G       Q N           KL           ++P+  +   D++ +N  W++ S+SLMEQ I E+  L+ + K      L   +D   I+      LYEQ +
Sbjct:    1 MASAGEHGHTWELSIQVDQREGDEGMRFKLRVKGDLHVGGLMLKLVEKIKAPQD-WSDHAIWWEQKSCWLLKTHWTLDKYGIQANADLRYTPQHKSLCIQLPNMKNIKLPVTFSGVVFRAVAEICKTLNIRRTEELSLLK--------PTDEPKKKKKKDKGTDL-ATDEILTMDITGGALGMYSKTMTPIYDPDSG-----SPVSSTSLWYGGSPLTACQPNL----PPEELAKL-----------YKPLTME---DKAAINAGWLDSSRSLMEQGIQENDRLLLRFKYHCFFDLNPKYDAVRITQ-----LYEQAR 280          
BLAST of Fermitin family member 1 vs. Ensembl Xenopus
Match: sh3bgrl3 (SH3 domain binding glutamate-rich protein like 3 [Source:Xenbase;Acc:XB-GENE-965976])

HSP 1 Score: 93.5893 bits (231), Expect = 3.924e-19
Identity = 91/327 (27.83%), Postives = 148/327 (45.26%), Query Frame = 3
Query:  138 GIKMISNYGYIDGSWKLKIVSEDLNGVVLLTVFNNTILGEIYMKIAQYFNM----EKNQMKNFGLWCRNKNIWLLKTELTLHQLSLNANSTLFFTKKYKEINIQLTNKLNRKIVVDFSVQFLHVIKDICMEFEIENFHIYSLLRYRR--IYDGVTSIKPKTFSN--KLSKSHLTASLRNLTSNFPN--QKRISKNFGS--NCPWTPTSGYGSLSSNVNSLENFHGSCLSINTQANHYTYDHHNNANKLNNDIHLTTFSNHQPI-KSKSNFDRSKLNRDWINLSKSLMEQNINESSSLIFKIKSLTINFDEENISDDL-LDLLYEQFK 1076
            GI+M  +  Y DG+W+L I   DLN  V L V     +G + +K+  +  +     K    +  LW   K  WLLKT  TL +  + A++ L FT ++K + +QL N    K+ V+FS +    + DIC  F I +    SLLR  R         I  +   N  +L    LT    ++ S+ P    K ++  + S    P +PTS +            F  S LS              N   L     +T+      + K ++  D++K+N+ W++ ++SLMEQ++ E+ +L+ + K  +  FD     D + ++ LYEQ K
Sbjct:    5 GIRM-PDGCYADGTWELNIHVTDLNRDVTLRVTGEVHIGGVMLKLLIFVALILLDVKKDWSDHALWWEKKKTWLLKTHWTLDKYGIQADAKLQFTPQHKLLRLQLPNMKYVKVKVNFSDKVFKAVSDICKTFNIRHPEELSLLRKPRDPTKKKKKKIDDQCEDNILELEGPLLTPGSGSIYSS-PGLYSKTMTPTYDSRDGSPLSPTSAW------------FGDSALS------------EGNPGILAVSQPITSPEILAKMYKPQTLLDKAKINQGWLDSARSLMEQDVKENDALLLRFKYYSF-FDLNPKYDAIRINQLYEQAK 304          
BLAST of Fermitin family member 1 vs. Ensembl Xenopus
Match: sh3bgrl3 (SH3 domain binding glutamate-rich protein like 3 [Source:Xenbase;Acc:XB-GENE-965976])

HSP 1 Score: 93.5893 bits (231), Expect = 4.236e-19
Identity = 91/327 (27.83%), Postives = 148/327 (45.26%), Query Frame = 3
Query:  138 GIKMISNYGYIDGSWKLKIVSEDLNGVVLLTVFNNTILGEIYMKIAQYFNM----EKNQMKNFGLWCRNKNIWLLKTELTLHQLSLNANSTLFFTKKYKEINIQLTNKLNRKIVVDFSVQFLHVIKDICMEFEIENFHIYSLLRYRR--IYDGVTSIKPKTFSN--KLSKSHLTASLRNLTSNFPN--QKRISKNFGS--NCPWTPTSGYGSLSSNVNSLENFHGSCLSINTQANHYTYDHHNNANKLNNDIHLTTFSNHQPI-KSKSNFDRSKLNRDWINLSKSLMEQNINESSSLIFKIKSLTINFDEENISDDL-LDLLYEQFK 1076
            GI+M  +  Y DG+W+L I   DLN  V L V     +G + +K+  +  +     K    +  LW   K  WLLKT  TL +  + A++ L FT ++K + +QL N    K+ V+FS +    + DIC  F I +    SLLR  R         I  +   N  +L    LT    ++ S+ P    K ++  + S    P +PTS +            F  S LS              N   L     +T+      + K ++  D++K+N+ W++ ++SLMEQ++ E+ +L+ + K  +  FD     D + ++ LYEQ K
Sbjct:    5 GIRM-PDGCYADGTWELNIHVTDLNRDVTLRVTGEVHIGGVMLKLLIFVALILLDVKKDWSDHALWWEKKKTWLLKTHWTLDKYGIQADAKLQFTPQHKLLRLQLPNMKYVKVKVNFSDKVFKAVSDICKTFNIRHPEELSLLRKPRDPTKKKKKKIDDQCEDNILELEGPLLTPGSGSIYSS-PGLYSKTMTPTYDSRDGSPLSPTSAW------------FGDSALS------------EGNPGILAVSQPITSPEILAKMYKPQTLLDKAKINQGWLDSARSLMEQDVKENDALLLRFKYYSF-FDLNPKYDAIRINQLYEQAK 304          
BLAST of Fermitin family member 1 vs. Ensembl Xenopus
Match: sh3bgrl3 (SH3 domain binding glutamate-rich protein like 3 [Source:Xenbase;Acc:XB-GENE-965976])

HSP 1 Score: 93.2041 bits (230), Expect = 5.732e-19
Identity = 91/327 (27.83%), Postives = 148/327 (45.26%), Query Frame = 3
Query:  138 GIKMISNYGYIDGSWKLKIVSEDLNGVVLLTVFNNTILGEIYMKIAQYFNM----EKNQMKNFGLWCRNKNIWLLKTELTLHQLSLNANSTLFFTKKYKEINIQLTNKLNRKIVVDFSVQFLHVIKDICMEFEIENFHIYSLLRYRR--IYDGVTSIKPKTFSN--KLSKSHLTASLRNLTSNFPN--QKRISKNFGS--NCPWTPTSGYGSLSSNVNSLENFHGSCLSINTQANHYTYDHHNNANKLNNDIHLTTFSNHQPI-KSKSNFDRSKLNRDWINLSKSLMEQNINESSSLIFKIKSLTINFDEENISDDL-LDLLYEQFK 1076
            GI+M  +  Y DG+W+L I   DLN  V L V     +G + +K+  +  +     K    +  LW   K  WLLKT  TL +  + A++ L FT ++K + +QL N    K+ V+FS +    + DIC  F I +    SLLR  R         I  +   N  +L    LT    ++ S+ P    K ++  + S    P +PTS +            F  S LS              N   L     +T+      + K ++  D++K+N+ W++ ++SLMEQ++ E+ +L+ + K  +  FD     D + ++ LYEQ K
Sbjct:    5 GIRM-PDGCYADGTWELNIHVTDLNRDVTLRVTGEVHIGGVMLKLLIFVALILLDVKKDWSDHALWWEKKKTWLLKTHWTLDKYGIQADAKLQFTPQHKLLRLQLPNMKYVKVKVNFSDKVFKAVSDICKTFNIRHPEELSLLRKPRDPTKKKKKKIDDQCEDNILELEGPLLTPGSGSIYSS-PGLYSKTMTPTYDSRDGSPLSPTSAW------------FGDSALS------------EGNPGILAVSQPITSPEILAKMYKPQTLLDKAKINQGWLDSARSLMEQDVKENDALLLRFKYYSF-FDLNPKYDAIRINQLYEQAK 304          
BLAST of Fermitin family member 1 vs. Ensembl Xenopus
Match: sh3bgrl3 (SH3 domain binding glutamate-rich protein like 3 [Source:Xenbase;Acc:XB-GENE-965976])

HSP 1 Score: 92.8189 bits (229), Expect = 7.910e-19
Identity = 86/337 (25.52%), Postives = 147/337 (43.62%), Query Frame = 3
Query:  138 GIKMISNYGYIDGSWKLKIVSEDLNGVVLLTVFNNTILGEIYMKIAQYFNM----EKNQMKNFGLWCRNKNIWLLKTELTLHQLSLNANSTLFFTKKYKEINIQLTNKLNRKIVVDFSVQFLHVIKDICMEFEIENFHIYSLLRYRR-------------IYDGVTSIK-----PKTFSNKLSKSHLTASLRNLTSNFPNQKRISKNFGSNCPWTPTSGYGSLSSNVNSLENFHGSCLSINTQANHYTYDHHNNANKLNNDIHLTTFSNHQPI-KSKSNFDRSKLNRDWINLSKSLMEQNINESSSLIFKIKSLTINFDEENISDDL-LDLLYEQFK 1076
            GI+M  +  Y DG+W+L I   DLN  V L V     +G + +K+  +  +     K    +  LW   K  WLLKT  TL +  + A++ L FT ++K + +QL N    K+ V+FS +    + DIC  F I +    SLLR  R               D +  ++     P + ++ L    +  S+ +    +      + +     P +PTS +            F  S LS              N   L     +T+      + K ++  D++K+N+ W++ ++SLMEQ++ E+ +L+ + K  +  FD     D + ++ LYEQ K
Sbjct:    5 GIRM-PDGCYADGTWELNIHVTDLNRDVTLRVTGEVHIGGVMLKLLIFVALILLDVKKDWSDHALWWEKKKTWLLKTHWTLDKYGIQADAKLQFTPQHKLLRLQLPNMKYVKVKVNFSDKVFKAVSDICKTFNIRHPEELSLLRKPRDPTKKKKKKIDDQCEDNILELEGPLLTPGSGTDVLYIGPVKGSIYSSPGLYSKTMTPTYDSRDGSPLSPTSAW------------FGDSALS------------EGNPGILAVSQPITSPEILAKMYKPQTLLDKAKINQGWLDSARSLMEQDVKENDALLLRFKYYSF-FDLNPKYDAIRINQLYEQAK 315          
BLAST of Fermitin family member 1 vs. Ensembl Xenopus
Match: sh3bgrl3 (SH3 domain binding glutamate-rich protein like 3 [Source:Xenbase;Acc:XB-GENE-965976])

HSP 1 Score: 90.5077 bits (223), Expect = 3.467e-18
Identity = 86/314 (27.39%), Postives = 135/314 (42.99%), Query Frame = 3
Query:  165 YIDGSWKLKIVSEDLNGVVLLTVFNNTILGEIYMKIAQYFNMEKNQMKNFGLWCRNKNIWLLKTELTLHQLSLNANSTLFFTKKYKEINIQLTNKLNRKIVVDFSVQFLHVIKDICMEFEIENFHIYSLLRYRR--IYDGVTSIKPKTFSNKLSKSHLTASLRNLTSNFPNQKRISKNFGS------NCPWTPTSGYGSLSSNVNSLENFHGSCLSINTQANHYTYDHHNNANKLNNDIHLTTFSNHQPI-KSKSNFDRSKLNRDWINLSKSLMEQNINESSSLIFKIKSLTINFDEENISDDL-LDLLYEQFK 1076
            Y DG+W+L I   DLN  V L V     +G + +K+  +         +  LW   K  WLLKT  TL +  + A++ L FT ++K + +QL N    K+ V+FS +    + DIC  F I +    SLLR  R         I  +   N L    L   L    S + +    SK            P +PTS +            F  S LS              N   L     +T+      + K ++  D++K+N+ W++ ++SLMEQ++ E+ +L+ + K  +  FD     D + ++ LYEQ K
Sbjct:   11 YADGTWELNIHVTDLNRDVTLRVTGEVHIGGVMLKLKDW--------SDHALWWEKKKTWLLKTHWTLDKYGIQADAKLQFTPQHKLLRLQLPNMKYVKVKVNFSDKVFKAVSDICKTFNIRHPEELSLLRKPRDPTKKKKKKIDDQCEDNIL---ELEGPLLTPGSIYSSPGLYSKTMTPTYDSRDGSPLSPTSAW------------FGDSALS------------EGNPGILAVSQPITSPEILAKMYKPQTLLDKAKINQGWLDSARSLMEQDVKENDALLLRFKYYSF-FDLNPKYDAIRINQLYEQAK 288          
BLAST of Fermitin family member 1 vs. Ensembl Mouse
Match: Fermt2 (fermitin family member 2 [Source:MGI Symbol;Acc:MGI:2385001])

HSP 1 Score: 82.8037 bits (203), Expect = 4.885e-17
Identity = 47/139 (33.81%), Postives = 75/139 (53.96%), Query Frame = 3
Query:  138 GIKMISNYGYIDGSWKLKIVSEDLNGVVLLTVFNNTILGEIYMKIAQYFNMEKNQMKNFGLWCRNKNIWLLKTELTLHQLSLNANSTLFFTKKYKEINIQLTNKLNRKIVVDFSVQFLHVIKDICMEFEIENFHIYSLL 554
            GI+M  +  Y DG+W+L +   DLN  V L V     +G + +K+ +  +++K+   +  LW   K  WLLKT  TL +  + A++ L FT ++K + +QL N    K+ V+FS +    + DIC  F I +    SLL
Sbjct:    5 GIRM-PDGCYADGTWELSVHVTDLNRDVTLRVTGEVHIGGVMLKLVEKLDVKKD-WSDHALWWEKKRTWLLKTHWTLDKCGIQADAKLQFTPQHKLLRLQLPNMKYVKVKVNFSDRVFKAVSDICKTFNIRHPEELSLL 141          
BLAST of Fermitin family member 1 vs. Ensembl Mouse
Match: Fermt2 (fermitin family member 2 [Source:MGI Symbol;Acc:MGI:2385001])

HSP 1 Score: 82.0333 bits (201), Expect = 1.267e-15
Identity = 47/139 (33.81%), Postives = 75/139 (53.96%), Query Frame = 3
Query:  138 GIKMISNYGYIDGSWKLKIVSEDLNGVVLLTVFNNTILGEIYMKIAQYFNMEKNQMKNFGLWCRNKNIWLLKTELTLHQLSLNANSTLFFTKKYKEINIQLTNKLNRKIVVDFSVQFLHVIKDICMEFEIENFHIYSLL 554
            GI+M  +  Y DG+W+L +   DLN  V L V     +G + +K+ +  +++K+   +  LW   K  WLLKT  TL +  + A++ L FT ++K + +QL N    K+ V+FS +    + DIC  F I +    SLL
Sbjct:    5 GIRM-PDGCYADGTWELSVHVTDLNRDVTLRVTGEVHIGGVMLKLVEKLDVKKD-WSDHALWWEKKRTWLLKTHWTLDKCGIQADAKLQFTPQHKLLRLQLPNMKYVKVKVNFSDRVFKAVSDICKTFNIRHPEELSLL 141          
BLAST of Fermitin family member 1 vs. Ensembl Mouse
Match: Fermt3 (fermitin family member 3 [Source:MGI Symbol;Acc:MGI:2147790])

HSP 1 Score: 68.5514 bits (166), Expect = 3.286e-12
Identity = 42/144 (29.17%), Postives = 70/144 (48.61%), Query Frame = 3
Query:  135 SGIKMISNYGYIDGSWKLKIV--SEDLNG-VVLLTVFNNTILGEIYMKIAQYFNMEKNQMKNFGLWCRNKNIWLLKTELTLHQLSLNANSTLFFTKKYKEINIQLTNKLNRKIVVDFSVQFLHVIKDICMEFEIENFHIYSLLR 557
            +G+K  S   YID SW+L++    ED     V L V   + +G + +KI +  N  K    +  +W   K  WLL+T  TL +  + A++ LFF  +++ + ++L N+   ++   FS      +  IC    I +    SLLR
Sbjct:    2 AGMKTASG-DYIDSSWELRVFVGEEDPEAQSVTLRVTGESHIGGVLLKIVEEIN-RKQDWSDHAIWWEQKRQWLLQTHWTLDKYGILADARLFFGPQHRPVILRLPNRRVLRLRASFSKPLFQTVAAICRLLSIRHPEELSLLR 143          
BLAST of Fermitin family member 1 vs. Ensembl Mouse
Match: Fermt3 (fermitin family member 3 [Source:MGI Symbol;Acc:MGI:2147790])

HSP 1 Score: 69.3218 bits (168), Expect = 9.698e-12
Identity = 42/144 (29.17%), Postives = 70/144 (48.61%), Query Frame = 3
Query:  135 SGIKMISNYGYIDGSWKLKIV--SEDLNG-VVLLTVFNNTILGEIYMKIAQYFNMEKNQMKNFGLWCRNKNIWLLKTELTLHQLSLNANSTLFFTKKYKEINIQLTNKLNRKIVVDFSVQFLHVIKDICMEFEIENFHIYSLLR 557
            +G+K  S   YID SW+L++    ED     V L V   + +G + +KI +  N  K    +  +W   K  WLL+T  TL +  + A++ LFF  +++ + ++L N+   ++   FS      +  IC    I +    SLLR
Sbjct:    2 AGMKTASG-DYIDSSWELRVFVGEEDPEAQSVTLRVTGESHIGGVLLKIVEEIN-RKQDWSDHAIWWEQKRQWLLQTHWTLDKYGILADARLFFGPQHRPVILRLPNRRVLRLRASFSKPLFQTVAAICRLLSIRHPEELSLLR 143          
BLAST of Fermitin family member 1 vs. Ensembl Mouse
Match: Fermt1 (fermitin family member 1 [Source:MGI Symbol;Acc:MGI:2443583])

HSP 1 Score: 68.9366 bits (167), Expect = 1.772e-11
Identity = 39/141 (27.66%), Postives = 69/141 (48.94%), Query Frame = 3
Query:  147 MISNYGYIDGSWKLKIVSEDLNGV----VLLTVFNNTILGEIYMKIAQYFNMEKNQMKNFGLWCRNKNIWLLKTELTLHQLSLNANSTLFFTKKYKEINIQLTNKLNRKIVVDFSVQFLHVIKDICMEFEIENFHIYSLLR 557
            M+S+      SW+L +  +  NG     + L V  +  +G + +K+ +  N+ ++   ++ LW   K  WLLKT  TL +  + A++ L FT ++K + ++L N    ++ V FS      + DIC    I      SLL+
Sbjct:    1 MLSSGDLTSASWELVVRVDHANGEQQTEITLRVSGDLHIGGVMLKLVEQMNIAQD-WSDYALWWEQKRCWLLKTHWTLDKCGVQADANLLFTPQHKMLRLRLPNAKTVRLRVSFSAVVFKAVADICKVLNIRRPEELSLLK 140          
BLAST of Fermitin family member 1 vs. UniProt/SwissProt
Match: sp|F1Q8X5|FERM2_DANRE (Fermitin family homolog 2 OS=Danio rerio OX=7955 GN=fermt2 PE=2 SV=1)

HSP 1 Score: 102.834 bits (255), Expect = 3.088e-21
Identity = 90/322 (27.95%), Postives = 156/322 (48.45%), Query Frame = 3
Query:  138 GIKMISNYGYIDGSWKLKIVSEDLNGVVLLTVFNNTILGEIYMKIAQYFNMEKNQMKNFGLWCRNKNIWLLKTELTLHQLSLNANSTLFFTKKYKEINIQLTNKLNRKIVVDFSVQFLHVIKDICMEFEIENFHIYSLLRYRR----IYDGVTSIKPKTFSNKLSKSHLTASLRNLTSNFPN--QKRISKNFGS--NCPWTPTSGYGSLSSNVNSLENFHGSCLSINTQANHYTYDHHNNANKLNNDIHLTTFSNHQPIKSKSNFDRSKLNRDWINLSKSLMEQNINESSSLIFKIKSLTINFDEENISDDL-LDLLYEQFK 1076
            GI+M  +  Y DG+W+LK+   DLN  V L V     +G + +K+ +  +++K+   +  LW   K  WLLKT  TL +  + A++ L FT ++K + +QL N  + ++ V+FS +    + DIC  F I +    SLLR  R        +   + +T   +L    LT    ++ S+ P    K ++  + S    P +PTS +   S     L   + S L+++                 + DI +  +      K +S  D++K+N+ W++ S+SLMEQ++ E+  L+ + K  +  FD     D + ++ LYEQ K
Sbjct:    5 GIRM-PDGCYADGTWELKMHVTDLNRDVSLRVTGEIHIGGVMLKLVEKLDVKKD-WSDHALWWEKKKTWLLKTHWTLDKYGIQADARLLFTPQHKLLRLQLPNMKHMRVKVNFSDRVFKAVSDICKTFNIRHPEELSLLRKPRDPKKKKKKLEDAEEETL--ELEGPLLTPGSGSIYSS-PGLYSKTMTPTYDSRDGSPLSPTSAWFGDS----PLSEGNPSILAVSQPIT-------------SPDILVKMY------KPQSLLDKAKINQGWLDSSRSLMEQDVKENEVLLLRFKYHSF-FDLNPKYDAIRVNQLYEQAK 297          
BLAST of Fermitin family member 1 vs. UniProt/SwissProt
Match: sp|Q96AC1|FERM2_HUMAN (Fermitin family homolog 2 OS=Homo sapiens OX=9606 GN=FERMT2 PE=1 SV=1)

HSP 1 Score: 92.4337 bits (228), Expect = 4.592e-18
Identity = 86/323 (26.63%), Postives = 151/323 (46.75%), Query Frame = 3
Query:  138 GIKMISNYGYIDGSWKLKIVSEDLNGVVLLTVFNNTILGEIYMKIAQYFNMEKNQMKNFGLWCRNKNIWLLKTELTLHQLSLNANSTLFFTKKYKEINIQLTNKLNRKIVVDFSVQFLHVIKDICMEFEIENFHIYSLLRYRRIYDGVTSI----KPKTFSNKLSKSHLTASLRNLTSNFPN--QKRISKNFGS--NCPWTPTSGYGSLSSNVNSLENFHGSCLSINTQANHYTYDHHNNANKLNNDIHLTTFSN-HQPIKSKSNFDRSKLNRDWINLSKSLMEQNINESSSLIFKIKSLTINFDEENISDDL-LDLLYEQFK 1076
            GI+M  +  Y DG+W+L +   DLN  V L V     +G + +K+ +  +++K+   +  LW   K  WLLKT  TL +  + A++ L FT ++K + +QL N    K+ V+FS +    + DIC  F I +    SLL+  R            + +  + +L    +T    ++ S+ P    K ++  + +    P +PTS +            F  S LS              N   L     +T+     +  K ++  D++K+N+ W++ S+SLMEQ++ E+ +L+ + K  +  FD     D + ++ LYEQ K
Sbjct:    5 GIRM-PDGCYADGTWELSVHVTDLNRDVTLRVTGEVHIGGVMLKLVEKLDVKKD-WSDHALWWEKKRTWLLKTHWTLDKYGIQADAKLQFTPQHKLLRLQLPNMKYVKVKVNFSDRVFKAVSDICKTFNIRHPEELSLLKKPRDPTKKKKKKLDDQSEDEALELEGPLITPGSGSIYSS-PGLYSKTMTPTYDAHDGSPLSPTSAW------------FGDSALS------------EGNPGILAVSQPITSPEILAKMFKPQALLDKAKINQGWLDSSRSLMEQDVKENEALLLRFKYYSF-FDLNPKYDAIRINQLYEQAK 299          
BLAST of Fermitin family member 1 vs. UniProt/SwissProt
Match: sp|Q18685|UN112_CAEEL (Protein unc-112 OS=Caenorhabditis elegans OX=6239 GN=unc-112 PE=1 SV=1)

HSP 1 Score: 85.8853 bits (211), Expect = 5.993e-16
Identity = 84/341 (24.63%), Postives = 138/341 (40.47%), Query Frame = 3
Query:  147 MISNYGYIDGSWKLKIVSEDLNGVVLLTVFNNTILGEIYMKIAQYFNMEKNQMKNFGLWCRNKNIWLLKTELTLHQLSLNANSTLFFTKKYKEINIQLTNKLNRKIVVDFSVQFLHVIKDICMEFEIENFHIYSLLRYRRIYD------------GVTSIKPKTFSNKLSKSHLTASLRNLTSNFPNQKRISKNFGSNCPWTPTSG-------------YGSLSSNVNSLENFHGSCLSINTQANHYTYDHHNNANKLNND-IHLTTF--SNHQPIKSKSNF-DRSKLNRDWINLSKSLMEQNINESSSLIFKIKSLTINFDEENISDDLLDL--LYEQFK 1076
            ++     IDG W+L I+  DLN    ++V  N  +G + +++    ++E++   +  LW   K  WL  T  TL Q  + A + L FT  +KE  IQL +       VDFSV      K +C +  I      SL RY    D            G  S++P        +S    +LR     F +Q  +        P    SG             +G+L   V+     +   +         ++       + ++  IH      S   P+    N+ +++ +NR W++ S+SLMEQ I E   ++ + K   +NF + N   D + +  LYEQ K
Sbjct:    4 LVEGTSIIDGKWQLPILVTDLNIQRSISVLGNLNVGGLMLELVSECDVERD-WSDHALWWPEKRRWLQHTRSTLDQNGITAETQLEFTPMHKEARIQLPDMQMIDARVDFSVNSFKATKKLCRDLGIRYSEELSLKRYIPPEDLRRGTSDADNMNGPLSMRPG------EESVGPMTLRKAAPIFASQSNLDMRRRGQSPALSQSGHIFNAHEMGTLPRHGTLPRGVSPSPGAYNDTMRRTPIMPSISFSEGLENEQFDDALIHSPRLAPSRDTPVFRPQNYVEKAAINRGWLDSSRSLMEQGIFEGDIILLRFK--FMNFFDLNPKYDPVRINQLYEQAK 335          
BLAST of Fermitin family member 1 vs. UniProt/SwissProt
Match: sp|Q5R8M5|FERM1_PONAB (Fermitin family homolog 1 OS=Pongo abelii OX=9601 GN=FERMT1 PE=2 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 8.450e-15
Identity = 77/300 (25.67%), Postives = 132/300 (44.00%), Query Frame = 3
Query:  147 MISNYGYIDGSWKLKI----VSEDLNGVVLLTVFNNTILGEIYMKIAQYFNMEKNQMKNFGLWCRNKNIWLLKTELTLHQLSLNANSTLFFTKKYKEINIQLTNKLNRKIVVDFSVQFLHVIKDICMEFEIENFHIYSLLRYRRIYDGVTSIKPKTFSNKLSKSHLTASLRNLTSNFPNQKRISKNFGSNCPWTPTSGYGSLSSNVNSLENFHGSCLSINTQANHYTYDHHNNANKLNNDIHLTTFSNHQPIKS----------KSNFDRSKLNRDWINLSKSLMEQNINESSSLIFKIK 1004
            M+S+  +   SW+L +     +E+    V L V  +  +G + +++ +  N+ ++   +F LW   K+ WLLKT  TL +  + A++ L FT ++K + ++L N    ++ V FS      + DIC    I      SLL+    Y      K K   +K +K  +T  + NL S                  +PT+   S+S  + S +        IN      T    +++     +  +  FS  QP +S          +S  D++KLN  W++ S+SLMEQ I E   L+ + K
Sbjct:    1 MLSSTDFTSASWELVVRVDHPNEEQQKDVTLRVSGDLHVGGVMLQLVEQINISQD-WSDFALWWEQKHCWLLKTHWTLDKYGVQADAKLLFTPQHKMLRLRLPNLKMVRLRVSFSAVVFKAVSDICKTLNIRRSEELSLLKPCGDY-----FKKKKKKDKNNKEPITEDILNLES------------------SPTASVSSVSPGLYS-KTMTPIYDPINGTPASSTMTWFSDSPLTEQNCSILAFS--QPPQSSEALADMYQPRSLVDKAKLNAGWLDSSRSLMEQGIQEDGQLLLRFK 273          
BLAST of Fermitin family member 1 vs. UniProt/SwissProt
Match: sp|Q8CIB5|FERM2_MOUSE (Fermitin family homolog 2 OS=Mus musculus OX=10090 GN=Fermt2 PE=1 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 8.861e-15
Identity = 47/139 (33.81%), Postives = 75/139 (53.96%), Query Frame = 3
Query:  138 GIKMISNYGYIDGSWKLKIVSEDLNGVVLLTVFNNTILGEIYMKIAQYFNMEKNQMKNFGLWCRNKNIWLLKTELTLHQLSLNANSTLFFTKKYKEINIQLTNKLNRKIVVDFSVQFLHVIKDICMEFEIENFHIYSLL 554
            GI+M  +  Y DG+W+L +   DLN  V L V     +G + +K+ +  +++K+   +  LW   K  WLLKT  TL +  + A++ L FT ++K + +QL N    K+ V+FS +    + DIC  F I +    SLL
Sbjct:    5 GIRM-PDGCYADGTWELSVHVTDLNRDVTLRVTGEVHIGGVMLKLVEKLDVKKD-WSDHALWWEKKRTWLLKTHWTLDKCGIQADAKLQFTPQHKLLRLQLPNMKYVKVKVNFSDRVFKAVSDICKTFNIRHPEELSLL 141          
BLAST of Fermitin family member 1 vs. TrEMBL
Match: V3ZRW4 (B41 domain-containing protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_215642 PE=4 SV=1)

HSP 1 Score: 121.324 bits (303), Expect = 1.099e-24
Identity = 167/715 (23.36%), Postives = 310/715 (43.36%), Query Frame = 3
Query:  141 IKMISNYGYIDGSWKLKIVSEDLNGVVLLTVFNNTILGEIYMKIAQYFNMEKNQMKNFGLWCRNKNIWLLKTELTLHQLSLNANSTLFFTKKYKEINIQLTNKLNRKIVVDFSVQFLHVIKDICMEFEIENFHIYSLLR------YRRIYDGVT---SIKPKTFSNKLSKSHLTASLRNLTSNFPNQKRISKNFGSNCPWTPTSGYGSLSSNVNSLENFHGSCLSINTQANHYTYDHHNNANKLNNDIHLTTFSNHQPIKSKSNF----------DRSKLNRDWINLSKSLMEQNINESSSLIFKIKSLTINFDEENISDDLLDL--LYEQFKDFVXXXXXXXXXXXXXXXXXXQYNIYLVEKQSYGNNNGNIHRNPRTNIPLSFDEEIDKMLFSLEKELLN--ISDEFDKSFSIRTDYFVGVHQIIPIKSSGK-FLRMKLKLIKNQIKIF--KENDFSNPKYEFCLKNCKFFTNFGVDSNENIISWMFECNKRLLKIEMKFFNDEDFFSLYSSAVAHSNFWWPSLKQIFDCERVA-----RKLVEIFRSSDEPEYNIFNMPRVELVNLLGCRIGKKEQSGKYLKTILQYNQCFKTLSRRKSKIQYIRFCLNFPRFNYHYFFVK-IHEPPEEMGLTVVAVNEEMFIVFDPNYYSITRLVLPWAVLKSWKFNTELNQLDLYFKNLFISFTTQDCSAICFHEFISTFIWFA--STDK 2183
            +  I++ G +DGSW L I   DL    LL V  +  +G + +++ +  ++  +   +  LW   +N+WL +T  TL Q S+ A++ L FT  +K + IQL +     + VDFS +    +  +C E  I +    S LR       +R+    T      P+      S     +S  +L    P   RI  + GS  P+   SG G++S       +F+G+    +  +  +              +  +T +   P+ SK  F          +++++N  W++ S+SLMEQ I E+  +IFK K    NF + N   D + +  +YEQ K  +++ EI+      ++ AALQ+ + L   QS G    ++  +   N+  + D++ID  L  L++ L    IS+  D +       +V   +  P K + K + R       N I ++  +E+  S P   FC++ C+   +  +   +  I         + +I +KF ++E +    +++   S       K + D    A     +  + +  ++  P     N+  ++  + +  R  KK +S   ++ I++ +   + +S   +K+ +I+   + P +   YF VK I+   EE+    + V     I  D N    +     +  L+SW  N E+  + L F+   ++F          HEFI  +I+ +  S DK
Sbjct:    1 MAFIADSGRVDGSWTLNITVTDLQVEKLLRVKGDDHVGGVMLRLVEALDIALD-WSDHALWWPERNMWLSRTRSTLDQYSVQADAKLQFTPMHKNLRIQLPDLQVLDMRVDFSAKVFASVVHLCKELGIRHPEEMSFLRKIDKDDLKRVVKEATKKKKKDPEAAGALSSNGQHHSSTGSLDGLSPFPSRIRSSTGS--PYN-LSGTGTMS----QFNSFNGTISPGSMHSLSF------------EGMMESTLAISPPVPSKEAFQYIYRPKNFIEKARINCVWLDSSRSLMEQGIRENDFIIFKYK--FYNFYDLNPKYDAIRINQIYEQAKWSLMAEEIDCTEEEMMMFAALQFQVQL---QS-GLPQPDLDMS--NNLNHTEDDDIDAALKDLQESLEGNSISNSGDITHIPELGDYVRFFK--PKKLTLKSYKRYWATFKDNHIALYRNREDTHSQPLMRFCVRGCETTPDVNLTHRKYGIKMFIPDADGMTEIIIKFDSEEQYCRWMAASKLSSKG-----KTMADSSYSAEVQALQTFLSMQHTAPAPAITTSNV-DIQAEDFVAPRFYKKIKSKAIVQKIMEAHNNVREMSLMDAKLAFIKAWQSLPEYGITYFVVKFINSKKEEL----LGVASNRIIRMDLNTGD-SHKTWRYNTLQSWHVNWEVENMILEFEEGRVTFACLGAPCKVVHEFIGGYIFLSMRSQDK 674          
BLAST of Fermitin family member 1 vs. TrEMBL
Match: A0A3Q2HLX7 (Fermitin family member 2 OS=Equus caballus OX=9796 GN=FERMT2 PE=4 SV=2)

HSP 1 Score: 109.768 bits (273), Expect = 6.058e-21
Identity = 163/735 (22.18%), Postives = 307/735 (41.77%), Query Frame = 3
Query:  138 GIKMISNYGYIDGSWKLKIVSEDLNGVVLLTVFNNTILGEIYMKIAQYFNMEKNQMKNFGLWCRNKNIWLLKTELTLHQLSLNANSTLFFTKKYKEINIQLTNKLNRKIVVDFSVQFLHVIKDICMEFEIENFHIYSLLRYRRIYDGVTS------------------IKPKTFSNKLSKSHLTASLRNLTSNFPNQKRISKNFGSNCPWTPTSGYGSLSSNVNSLENFHGSCLSINTQANHYTYDHHNNANKLNNDIHLTTFSNHQPI-KSKSNFDRSKLNRDWINLSKSLMEQNINESSSLIFKIKSLTINFDEENISDDL-LDLLYEQFKDFVXXXXXXXXXXXXXXXXXXQYNI---YLVEKQSYGNNNGNIHRNPRTNIPLSFDEEIDKMLFSLEKELLNISDEFDKSFSIRTDYFVGVHQIIPIKSSGKFLRMKLKLIKNQIKIFKENDFS----------NPKYEFCLKNCKFFTNFGVDSNENIISWMFECNKRLLKIEMKFFNDEDFFSLYSSAVAHSNFWWPSLKQIFDCERVARKLVEIFRSSDEPEY-NIFNMPRVELVN------------------LLGCRIGKKEQSGKYLKTILQYNQCFKTLSRRKSKIQYIRFCLNFPRFNYHYFFVKIHEPPEEMGLTVVAVNEEMFIVFDPNYYSITRLVLPWAVLKSWKFNTELNQLDLYFKN-LFISFTTQDCSAICFHEFISTFIWFASTDK 2183
            GI+M  +  Y DG+W+L +   DL+  V L V     +G + +K+ +  +++K+   +  LW   K  WLLKT  TL +  + A++ L FT ++K + +QL N    K+ V+FS +    + DIC  F I +    SLL+  R                         I P + ++ L    L  S+ +    +      + +     P +PTS +            F  S LS              N   L     +T+      + K ++  D++K+N+ W++ S+SLMEQ++ E+ +L+ + K  +  FD     D + ++ LYEQ K  +L  EIE      ++ AALQY+I    ++  +++ NN+               D+E+D++  +L    L I+ E  K+ +I  D    + ++       K  ++ LK  K     FK+   S           P ++  L+ C+   +  +   +  I  +      + +I ++  N++ +        AH   W      +  C R+A K   +  SS  PE  NI +  +++ +N                  L+  R  KK ++ +    IL+ +Q    +S  ++K+++I+   + P F   +F  +     +E    ++ +     I  D       +    ++ +K W  N E+  + + F + + +SF   +      HEFI  +I+ ++  K
Sbjct:    5 GIRM-PDGCYADGTWELSVHVTDLSRDVTLRVTGEVHIGGVMLKLVEKLDVKKD-WSDHALWWEKKRTWLLKTHWTLDKYGIQADAKLQFTPQHKLLRLQLPNMKYVKVKVNFSDRVFKAVSDICKTFNIRHPEELSLLKKPRDPTKKKKKKLDDQSEDEALELEGPLITPGSGTDVLYIGPLKGSIYSSPGLYSKTMTPTYDAHDGSPLSPTSAW------------FGDSALS------------EGNPGILAVSQPITSPEILAKMFKPQALLDKAKINQGWLDSSRSLMEQDVKENEALLLRFKYYSF-FDLNPKYDAIRINQLYEQAKWAILLEEIECTEEEMMMFAALQYHINKLSIMTSENHLNNS---------------DKEVDEVDAALSD--LEITLEGGKTSTILGD-ITSIPELADYIKVFKPKKLTLKGYKQYWCTFKDTSISCYKSKEESSGTPAHQMNLRGCEVTPDVNISGQKFNIKLLIPVADGMNEIWLRCDNEKQY--------AH---W------MAAC-RLASKGKTMADSSYNPEVQNILSFLKMQHLNPDPQFIPEQITADINPECLVSPRYLKKYKNKQITARILEAHQNVAQMSLIEAKMRFIQAWQSLPEFGITHFIARFQGGKKE---ELIGIAYNRLIRMDAGTGDAIK-TWRFSNMKQWNVNWEIKMVTVEFADEVRLSFICTEVDCKVVHEFIGGYIFLSTRAK 672          
BLAST of Fermitin family member 1 vs. TrEMBL
Match: G1N477 (Fermitin family member 1 OS=Meleagris gallopavo OX=9103 GN=FERMT1 PE=4 SV=2)

HSP 1 Score: 108.612 bits (270), Expect = 1.133e-20
Identity = 165/708 (23.31%), Postives = 307/708 (43.36%), Query Frame = 3
Query:  144 KMISNYGYIDGSWKLKIV----SEDLNGVVLLTVFNNTILGEIYMKIAQYFNMEKNQMKNFGLWCRNKNIWLLKTELTLHQLSLNANSTLFFTKKYKEINIQLTNKLNRKIVVDFSVQFLHVIKDICMEFEIENFHIYSLLRYRRIYDGVTSIKPKTFSNKLSKSHLTASLRNLTSNFPNQKRISKNFG-SNCPWTPTSGYGSLSSNVNSLENFHGSCLSINTQANHYTYDHHNNANKLNNDIHLTTFSNHQPIKSKSNFDRSKLNRDWINLSKSLMEQNINESSSLIFKIKSLTINFDEENISDDL-LDLLYEQFKDFVXXXXXXXXXXXXXXXXXXQYNIYLVEKQSYGNNNGNIHRNPRTNIPLSFDEEIDKMLFSLEKELLNISDEFDKSFSIRTDYFVGVHQIIPIKSSGKFLRMKLKLIKNQIKIFKENDFS----------NPKYEFCLKNCKFFTNFGVDSNENIISWMFECNKRLLKIEMKFFNDEDFFSLYSSAVAHS-------NFWWPSLKQIFDCERVARKLVEIFRSSDEPEYNIFNMPRVELVNLLGCRIGKKEQSGKYLKTILQYNQCFKTLSRRKSKIQYIRFCLNFPRFNYHYFFVKIHEPPEEMGLTVVAVNEEMFIVFDPNYYSITRLVLPW--AVLKSWKFNTELNQLDLYF-KNLFISFT--TQDCSAICFHEFISTFIWFASTDK 2183
            KMIS+  Y   +W+L +      E       L V  +  +G + +K+ +   + ++   ++ LW   K  WLLKT  TL +  + A++ L FT ++K + ++L N    ++ V FS      + DIC    I      SLL+         +++ K   +K SK  +T  + NL  N P    +S + G  +   TPT    S +   +++  F  S L+     +   + H N + +       T    +QP   ++  D++KLN  W++ S+SLMEQ I E   L+ + K  T  FD     D + ++ +YEQ +  +L  EI+      LI AALQY++  +   S   +  N             + E+D++  +L    L ++ E  KS +I  D    + ++       +  R+ +K +K    +FK+   S           P  +  LK C+   +  V + +  I  +      + ++ ++  N+  +    +++V  S       + + P + +I    ++    +    +SD PE +I   P       +  R  KK +S +    IL+ +Q    +   ++K+++I+   + P F   Y+ V+     +E    V+ V+    I  D    +    +  W  + +K W  N E+ Q+ + F +N+ I+FT  + DC  I  HE I  +I+ ++  K
Sbjct:    6 KMISSSAYGSNTWELLVTVDHQCEGEQNEFTLRVTGDLHIGGVMLKLVEQIKVSQD-WSDYALWWEQKKCWLLKTHWTLDKCGVQADAKLLFTTQHKMLRLRLPNMKTVRLKVSFSSVVFKAVSDICKILNIRRSEELSLLKQSE-----DTLRKKKKKDKNSKEVVTEDILNLC-NSPTSSGLSASPGLYSKTMTPTYDPISGTPASSTITWFSDSPLT-EQNCSILAFSHPNCSPE-------TLAEMYQP---RTLADKAKLNAGWLDSSRSLMEQGILEDDQLLLRFKYYTF-FDLNPKYDAVRINQIYEQARWAILLEEIDCTEEEMLIFAALQYHVSKLSSSSETQDFTN-------------ESEVDEVEAALSN--LEVTLEGGKSSNILED-ITDIPKLADYLRLVRPRRLSIKTVKPYWFVFKDTSISYFKNKESGQGEPIEKLNLKGCEVVPDVNVAAKKFGIKLLIPVAAGMNEVYLRCDNENQYARWMAASVLASKGKTMADSSYHPEVHKILSFLKMKNWTMSPQAASD-PE-SIDMKPEC----FVSLRYTKKYKSKQLAARILEAHQNVSQMPLVEAKLRFIQAWQSLPEFGLSYYIVRFKGSKKE---DVLGVSYNRLIRID---ITTGDPITTWRFSTMKQWNVNWEIRQVGIEFDQNVSIAFTCLSADCKII--HEHIGGYIFLSTRSK 664          
BLAST of Fermitin family member 1 vs. TrEMBL
Match: U3I1G5 (Fermitin family member 1 OS=Anas platyrhynchos platyrhynchos OX=8840 GN=FERMT1 PE=4 SV=2)

HSP 1 Score: 104.375 bits (259), Expect = 2.743e-19
Identity = 170/721 (23.58%), Postives = 309/721 (42.86%), Query Frame = 3
Query:  147 MISNYGYIDGSWKLKIV----SEDLNGVVLLTVFNNTILGEIYMKIAQYFNMEKNQMKNFGLWCRNKNIWLLKTELTLHQLSLNANSTLFFTKKYKEINIQLTNKLNRKIVVDFSVQFLHVIKDICMEFEIENFHIYSLLRYRRIYDGVTSIKPKTFSNKLSKSHLTASLRNLTSNFPNQKRISKNFG-SNCPWTPTSGYGSLSSNVNSLENFHGSCLSINTQANHYTYDHHNNANKLNNDIHLTTFSNHQPIKSKSNFDRSKLNRDWINLSKSLMEQNINESSSLIFKIKSLTINFDEENISDDL-LDLLYEQFKDFVXXXXXXXXXXXXXXXXXXQYNIYLVEKQSYGNNNGNIHRNPRTNIPLSFDEEIDKMLFSLEKELLNISDEFDKSFSIRTDYFVGVHQIIPIKSSGKFLR------MKLKLIKNQIKIFKENDFS----------NPKYEFCLKNCKFFTNFGVDSNENIISWMFECNKRLLKIEMKFFNDEDFFSLYSSAVAHS-------NFWWPSLKQIFDCERVARKLVEIFRSSDEPEYNIFNMPRVELVNLLGCRIGKKEQSGKYLKTILQYNQCFKTLSRRKSKIQYIRFCLNFPRFNYHYFFVKIHEPPEEMGLTVVAVNEEMFIVFDPNYYSITRLVLPW--AVLKSWKFNTELNQLDLYF-KNLFISFT--TQDCSAICFHEFISTFIWFASTDK----TLDK 2195
            M S   Y   SW+L +     +E+      L V  +  +G + +K+ +   M ++   ++ LW   K  WLLKT  TL +  + A++ L FT ++K + ++L N    ++ V FS      + DIC    I      SLL+         +I+ K   +K +K  +T  + NL  N P    +S + G  +   TPT    S +   +++  F  S L+     N   + H   + +       T    +QP   ++  D+++LN  W++ S+SLMEQ I E   L+ + K  T  FD     D + ++ +YEQ +  +L  E++      LI AALQY+I  +   S   N                + E+D++  +L    L ++ E  K+ +I  D       I  I     +LR      + +K IK    +FK+   S           P  +  LK C+   +  V + +  I  +      + ++ ++  N+  +    ++ V  S       + + P + +I    ++    +     SD PE N+   P       +  R  KK +S +    IL+ +Q    +S  ++K+++I+   + P F   Y+ V+     ++    V+ V+    I  D    +    +  W  + +K W  N E+ Q+ + F +N+ I+FT  + DC +I  HE+I  +I+ ++  K    TLD+
Sbjct:    1 MTSLGAYGSNSWELLVSVDHQNEEKQKEFTLQVTGDLHIGGVMLKLVEQIEMTQD-WSDYALWWEQKKCWLLKTHWTLDKCGVQADAKLLFTTQHKMLRLRLPNMKTVRLKVSFSSVVFKAVSDICKILNIRRSEELSLLKQSE-----DAIRKKKKKDKNNKEPVTEDILNLC-NSPVSSGLSASPGLYSKTMTPTYDPISGTPASSTITWFSDSPLT-EQNCNILAFSHPICSPE-------TLAEMYQP---RTLADKARLNAGWLDSSRSLMEQGILEDDQLLLRFKYYTF-FDLNPKYDAVRINQIYEQARWAILLEEVDCTEEEMLIFAALQYHISKLSSSSETQN-------------FPGESEVDEIEAALSN--LEVALEGGKTSNILED-------ITDIPKLADYLRLVRPRKLSIKSIKPYWFVFKDTSVSYFKNTESSHGEPIEKLNLKGCEVVPDVNVAAKKFGIKLLIPVADGMNELYLRCENENQYARWMAACVLASKGKTMADSSYRPEVHKILSFLKMKNWTMSPQAVSD-PE-NVDMKPEC----FVSLRYTKKYKSKQLAARILEAHQNVSQMSLVEAKMRFIQAWQSLPEFGLSYYIVRFKGSKKD---DVLGVSYNRLIRID---IATGDPITTWRFSNMKQWNVNWEIRQVAIEFDQNVSIAFTCLSADCKSI--HEYIGGYIFLSTRSKDHNETLDE 666          
BLAST of Fermitin family member 1 vs. TrEMBL
Match: A0A2I4BBP1 (fermitin family homolog 2 isoform X1 OS=Austrofundulus limnaeus OX=52670 GN=fermt2 PE=4 SV=1)

HSP 1 Score: 104.375 bits (259), Expect = 3.107e-19
Identity = 90/331 (27.19%), Postives = 153/331 (46.22%), Query Frame = 3
Query:  138 GIKMISNYGYIDGSWKLKIVSEDLNGVVLLTVFNNTILGEIYMKIAQYFNMEKNQMKNFGLWCRNKNIWLLKTELTLHQLSLNANSTLFFTKKYKEINIQLTNKLNRKIVVDFSVQFLHVIKDICMEFEIENFHIYSLLRYRRIY-------------DGVTSIKPKTFSNKLSKSHLTASLRNLTSNFPN--QKRISKNFGS--NCPWTPTSGYGSLSSNVNSLENFHGSCLSINTQANHYTYDHHNNANKLNNDIHLTTFSNHQPIKSKSNFDRSKLNRDWINLSKSLMEQNINESSSLIFKIKSLTINFDEENISDDL-LDLLYEQFK 1076
            GI+M  +  Y DG+W+LK+   DLN  V L V     +G + +K+ +  +++K+   +  LW   K  WLLKT  TL +  + A++ L FT ++K + +QL N  + K+ V+FS +    + DIC  F I +    SLLR  R               DG+    P       S+      ++    + P    K ++  + S    P +PTS +   S     L   +   L+++   +             + DI +  +      K +S  D++K+N+ W++ S+SLMEQ++ E+  L+ K K  +  FD     D + ++ LYEQ K
Sbjct:    5 GIRM-PDGCYADGTWELKMHVTDLNRDVSLRVTGEIHIGGVMLKLVEKLDVKKD-WSDHALWWEKKKTWLLKTHWTLDKYGIQADARLLFTPQHKLLRLQLPNMKHMKVKVNFSDRVFKAVSDICKTFNIRHPEELSLLRKPRDPKKKKKKLDEVDQDDGLELEGPLLTPGSASEIIYIGPVKGSIYSSPGLYSKTMTPTYDSRDGSPLSPTSAWFGDS----PLSEGNPGILAVSQPIS-------------SPDILVKLY------KPQSLLDKAKINQGWMDSSRSLMEQDVKENEVLLLKFKYHSF-FDLNPKYDAIRVNQLYEQAK 309          
BLAST of Fermitin family member 1 vs. Ensembl Cavefish
Match: fermt2 (fermitin family member 2 [Source:NCBI gene;Acc:553051])

HSP 1 Score: 95.1301 bits (235), Expect = 8.176e-20
Identity = 82/314 (26.11%), Postives = 142/314 (45.22%), Query Frame = 3
Query:  138 GIKMISNYGYIDGSWKLKIVSEDLNGVVLLTVFNNTILGEIYMKIAQYFNMEKNQMKNFGLWCRNKNIWLLKTELTLHQLSLNANSTLFFTKKYKEINIQLTNKLNRKIVVDFSVQFLHVIKDICMEFEIENFHIYSLLRYRRIYDGVTSIKPKTFSNKLSKSHLTASLRNLTSNFPNQKRISKNFGSNCPWTPTSGYGSLSSNVNSLENFHGSCLSINTQANHYTYDHHNNANKLNNDIHLTTFSNHQPIKSKSNFDRSKLNRDWINLSKSLMEQNINESSSLIFKIKSLTINFDEENISDDL-LDLLYEQFK 1076
            GI+M  +  Y DG+W+LK+   DLN  V L V     +G + +K+ +  +++K+   +  LW   K  WLLKT  TL +  + A++ L FT ++K + +QL N  + K+ V+FS +    + DIC  F             R IY       P  +S  ++ ++                    +     P +PTS +   S     L   + S L+++   +             + DI +  +      K  S  D++K+N+ W++ S+SLMEQ++ E+  L+ + K  +  FD     D + ++ LYEQ K
Sbjct:    5 GIRM-PDGCYADGTWELKMHVTDLNKDVSLRVTGEIHIGGVMLKLVEKLDVKKD-WSDHALWWEKKKTWLLKTHWTLDKYGIQADARLLFTPQHKLLRLQLPNMKHMKVKVNFSDRVFKAVSDICKTF-------------RSIYSS-----PGLYSKTMTPTY--------------------DSRDGSPLSPTSAWFGDS----PLSEGNPSILAVSQPIS-------------SPDILVKLY------KPPSLLDKAKINQGWLDSSRSLMEQDVKENEVLLLRFKYHSF-FDLNPKYDAIRVNQLYEQAK 254          
BLAST of Fermitin family member 1 vs. Ensembl Cavefish
Match: fermt2 (fermitin family member 2 [Source:NCBI gene;Acc:553051])

HSP 1 Score: 95.1301 bits (235), Expect = 8.392e-20
Identity = 82/314 (26.11%), Postives = 142/314 (45.22%), Query Frame = 3
Query:  138 GIKMISNYGYIDGSWKLKIVSEDLNGVVLLTVFNNTILGEIYMKIAQYFNMEKNQMKNFGLWCRNKNIWLLKTELTLHQLSLNANSTLFFTKKYKEINIQLTNKLNRKIVVDFSVQFLHVIKDICMEFEIENFHIYSLLRYRRIYDGVTSIKPKTFSNKLSKSHLTASLRNLTSNFPNQKRISKNFGSNCPWTPTSGYGSLSSNVNSLENFHGSCLSINTQANHYTYDHHNNANKLNNDIHLTTFSNHQPIKSKSNFDRSKLNRDWINLSKSLMEQNINESSSLIFKIKSLTINFDEENISDDL-LDLLYEQFK 1076
            GI+M  +  Y DG+W+LK+   DLN  V L V     +G + +K+ +  +++K+   +  LW   K  WLLKT  TL +  + A++ L FT ++K + +QL N  + K+ V+FS +    + DIC  F             R IY       P  +S  ++ ++                    +     P +PTS +   S     L   + S L+++   +             + DI +  +      K  S  D++K+N+ W++ S+SLMEQ++ E+  L+ + K  +  FD     D + ++ LYEQ K
Sbjct:    5 GIRM-PDGCYADGTWELKMHVTDLNKDVSLRVTGEIHIGGVMLKLVEKLDVKKD-WSDHALWWEKKKTWLLKTHWTLDKYGIQADARLLFTPQHKLLRLQLPNMKHMKVKVNFSDRVFKAVSDICKTF-------------RSIYSS-----PGLYSKTMTPTY--------------------DSRDGSPLSPTSAWFGDS----PLSEGNPSILAVSQPIS-------------SPDILVKLY------KPPSLLDKAKINQGWLDSSRSLMEQDVKENEVLLLRFKYHSF-FDLNPKYDAIRVNQLYEQAK 254          
BLAST of Fermitin family member 1 vs. Ensembl Cavefish
Match: fermt3b (fermitin family homolog 3-like [Source:NCBI gene;Acc:103041350])

HSP 1 Score: 64.3142 bits (155), Expect = 3.295e-10
Identity = 32/131 (24.43%), Postives = 68/131 (51.91%), Query Frame = 3
Query:  174 GSWKLKIVSEDLNG---VVLLTVFNNTILGEIYMKIAQYFNMEKNQMKNFGLWCRNKNIWLLKTELTLHQLSLNANSTLFFTKKYKEINIQLTNKLNRKIVVDFSVQFLHVIKDICMEFEIENFHIYSLLR 557
             +W L ++ ED+      + ++V ++  +G +  ++ +  N++++   + GLW   K  WLL+T  TL +  ++A++ L F+ ++K + + L N +  ++   FS      ++ IC    I +    SLLR
Sbjct:    2 AAWDLSVIVEDMGPEAPPLKISVTSDLHIGGVIFQVVEKINLQRD-WSDHGLWWEQKQQWLLRTSWTLEKYGIHADARLIFSPQHKPLRLGLPNGVTLRLRACFSSSVFRTVQGICRVLNIRHPEELSLLR 131          

HSP 2 Score: 51.6026 bits (122), Expect = 2.662e-6
Identity = 92/454 (20.26%), Postives = 189/454 (41.63%), Query Frame = 3
Query:  891 KSKSNFDRSKLNRDWINLSKSLMEQNINESSSLIFKIKSLTINFDEENISDDLLDLLYEQFKDFVXXXXXXXXXXXXXXXXXXQYNI-YLVEKQSYGNNNGNIHRNPRTNIPLSFDEEIDKMLFSLEKELLNISDEFDKSFSIRTDYFVGVHQIIPIK--SSGKFLRMKLKLIKNQIKIFK--ENDFSNPKYEFCLKNCKFFTNFGVDSNENIISWMFECNKRLLKIEMKFFNDEDFFSLYSSAVAHSNFWWPSLKQIFDCERVARKLVEIFRSSDEPEYNIFNMPRVELVN---LLGCRIGKKEQSGKYLKTILQYNQCFKTLSRRKSKIQYIRFCLNFPRFNYHYFFVKIHEPPEEMGLTVVAVNEEMFIVFDPNYYSITRLVLPWAV--LKSWKFNTELNQLDLYF-KNLFISF--TTQDCSAICFHEFISTFIWFASTDKTLDKADKISE 2213
            +  S  D++ ++  W++ S+SLM+Q I E+  L  + K  T +  E       +  LYEQ +  +L  + +      ++  ALQY+I  L + Q  G+  G               E++D  L SLE +++  ++  D   ++      G  ++   K  +   + +   K     I  +K  E+ +  P  +  LK C+   +  +   +  I  +    + + ++ ++  N++     Y+  +A        L  +    +   K +++F S      +       + +N   L+  R  KK +  +    IL+  Q    LS   + +++++   + P F   YF V+     ++    V+ +     I  D     +  +V  W    ++ W  N ++ Q+ + F  N+ I+F   T DC  +  HE+I  +I F ST ++   +D ++E
Sbjct:  202 RPASKVDKTHIHSRWLDSSRSLMQQGIQENDKLWLRFKYYTFHDVEPKYDAVRMTQLYEQARWAILLEDNDCTEEEMMLFGALQYHIGKLSQTQEVGSCQGM--------------EDLDSALKSLEVKMVGDNNNSDLLSNMTAPELNGYLKMFRPKRLTLRDYKQYWFKFQDTSIFYYKSFEDRYGEPIQQLNLKGCEVAPDVNLAGQKFCIRLLIPVPEGMNEVYLRCENEKQ----YAEWMAACKLASKGLTLLDSSYQSEVKNIQMFLSMQRSNSSSSTPQTDDSINTQSLVSPRYTKKYKVKQLTPRILEAYQNVAQLSMTAAILKFLQMWQSLPDFGISYFMVRFKGSRKD---EVLGIANNRLIRID---LGVGDVVKTWRYNHMRQWNVNWDIRQVAIEFDGNINIAFGCVTADCKVV--HEYIGGYI-FMST-RSRQPSDTLNE 627          
BLAST of Fermitin family member 1 vs. Ensembl Cavefish
Match: fermt3b (fermitin family homolog 3-like [Source:NCBI gene;Acc:103041350])

HSP 1 Score: 63.929 bits (154), Expect = 4.581e-10
Identity = 32/131 (24.43%), Postives = 68/131 (51.91%), Query Frame = 3
Query:  174 GSWKLKIVSEDLNG---VVLLTVFNNTILGEIYMKIAQYFNMEKNQMKNFGLWCRNKNIWLLKTELTLHQLSLNANSTLFFTKKYKEINIQLTNKLNRKIVVDFSVQFLHVIKDICMEFEIENFHIYSLLR 557
             +W L ++ ED+      + ++V ++  +G +  ++ +  N++++   + GLW   K  WLL+T  TL +  ++A++ L F+ ++K + + L N +  ++   FS      ++ IC    I +    SLLR
Sbjct:    2 AAWDLSVIVEDMGPEAPPLKISVTSDLHIGGVIFQVVEKINLQRD-WSDHGLWWEQKQQWLLRTSWTLEKYGIHADARLIFSPQHKPLRLGLPNGVTLRLRACFSSSVFRTVQGICRVLNIRHPEELSLLR 131          
BLAST of Fermitin family member 1 vs. Ensembl Cavefish
Match: fermt3a (fermitin family homolog 3 [Source:NCBI gene;Acc:103039629])

HSP 1 Score: 63.5438 bits (153), Expect = 6.183e-10
Identity = 67/307 (21.82%), Postives = 121/307 (39.41%), Query Frame = 3
Query:  180 WKLKIVSEDLN---GVVLLTVFNNTILGEIYMKIAQYFNMEKNQMKNFGLWCRNKNIWLLKTELTLHQLSLNANSTLFFTKKYKEINIQLTNKLNRKIVVDFSVQFLHVIKDICMEFEIENFHIYSLLRYRRIYDGVTSIKPKTFSNKLSKSHLTASLRNLTSNFPNQKRISKNFGSNCPWTPTSGYGSLSSNVNSLENFHGSCLSINTQANHYTYDHHNNANKLNNDIHLTTFSNHQPIKSKSNFDRSKLNRDWINLSKSLMEQNINESSSLIFKIK-----SLTINFDEENISDDLLDLLYEQFK 1076
            W L +  E+L      + ++V ++  +G + +KI +   ++K+   +  LW   K  WLLK   TL +  ++A++ L+ T ++K + + L N L  ++ V FS      +  IC    I +    SLLR            P     K  +      + ++TS                P  PT   GS+    N +  F      + +     +        +    ++  T          S  D++++N  W++ S+SL++Q + E   LI + K      L   FD   ++      LYEQ K
Sbjct:    4 WDLSVNVEELGEEAPPLKISVTSDLHIGGVILKIVEKTEIKKD-WSDHALWWEQKQQWLLKPAWTLDKCGIHADARLYLTPQHKPLRLVLPNLLTLRLRVCFSSPVFRTVIGICKLLNIRHPEELSLLR------------PVEEKKKKKQKGDEEEVYDITS---------------AP-LPT---GSIIKLANGMPAFFAESPEMESVYKMLSVSQPAPPPETITKMYRPT----------SKVDKAQVNGRWLDSSRSLLQQGVKEGDKLILRFKYYSFHDLAPQFDAVRLTQ-----LYEQAK 263          
BLAST of Fermitin family member 1 vs. Ensembl Sea Lamprey
Match: fermt2 (fermitin family member 2 [Source:NCBI gene;Acc:553051])

HSP 1 Score: 98.2117 bits (243), Expect = 1.647e-21
Identity = 84/321 (26.17%), Postives = 144/321 (44.86%), Query Frame = 3
Query:  138 GIKMISNYGYIDGSWKLKIVSEDLNGVVLLTVFNNTILGEIYMKIAQYFNMEKNQMKNFGLWCRNKNIWLLKTELTLHQLSLNANSTLFFTKKYKEINIQLTNKLNRKIVVDFSVQFLHVIKDICMEFEIENFHIYSLLRYRRIYDGVTSIKPKTFSNKLSKSHLTASLRNLTSNFPNQKRISKNFGSNCPWTPTSGYGSLSSNVN-SLENFHGSCLSINTQANHYTYDHHNNANKLNNDIHLTTFSNHQP------IKSKSNFDRSKLNRDWINLSKSLMEQNINESSSLIFKIKSLTINFDEENISDDL-LDLLYEQFK 1076
            GI+M   + Y DG+W+L+I+  DL   V++ V     +G + +++ +   M+K+   +  LW   K  WLLKT  TL +  + A++TL FT ++K + +QL +    ++ V+FS      + DIC  F I +    SL+R  +        K    +N    + L   L   T++               P  P S  G  S  +  + +   GS LS  T     +     N + L          N  P       + ++  D++++N  W++ S+SLMEQ I ++  L+ + K  +  FD     D + ++ LYEQ K
Sbjct:    4 GIRMPDGH-YADGTWELRILVTDLQQEVMMRVTGELHIGGVMLRLVERLEMKKD-WSDHALWWERKTTWLLKTHWTLDKYGIQADATLHFTPQHKLMRLQLPSMKYVRVKVNFSDLVFKAVVDICKTFNIRHPEELSLIRKPQDSSKKKKKKGGEENNHEEVTELEGPLITPTAS---------------PGGPFSSPGWYSKTMTPTYDARDGSPLSPTTAWFGDSPLAEGNPSALA-----AALPNTSPEVLARMYRPQTLLDKARINGGWLDSSRSLMEQGIKDNDILMLRFKYYSF-FDLNPKYDAIRINQLYEQAK 301          
BLAST of Fermitin family member 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002438.1 (pep scaffold:Pmarinus_7.0:GL480979:127958:159017:1 gene:ENSPMAG00000002171.1 transcript:ENSPMAT00000002438.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 72.4034 bits (176), Expect = 2.149e-13
Identity = 41/141 (29.08%), Postives = 69/141 (48.94%), Query Frame = 3
Query:  138 GIKMISNYGYIDGSWKLKIVSEDLNGVVLLTVFNNTILGEIYMKIAQYFNM-EKNQMKNFGLWCRNKNIWLLKTELTLHQLSLNANSTLFFTKKYKEINIQLTNKLNRKIVVDFSVQFLHVIKDICMEFEIENFHIYSLLR 557
            GI+    +   DGSW+L +   DL   V + +  +  +G + ++I Q     E+    +  LW  ++ +WLLK   TL +  + AN+ L FT ++K + +QL +    ++ V FS      + DIC    I +    SLLR
Sbjct:    8 GIRTADGH-LADGSWELSVNITDLERPVTVRLKGDLHIGGLILRIVQAAGADEQRDWSDHALWWEHRKLWLLKHPWTLDKYGVQANAVLVFTPQHKLLRLQLPSSKRVRVTVSFSDPVFRAVADICRTCNIRHPEELSLLR 147          
BLAST of Fermitin family member 1 vs. Ensembl Nematostella
Match: EDO36565 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIB3])

HSP 1 Score: 71.633 bits (174), Expect = 7.109e-13
Identity = 86/368 (23.37%), Postives = 161/368 (43.75%), Query Frame = 3
Query:  174 GSWKLKIVSEDLNGVVLLTVFNNTILGEIYMKIAQYFNMEKNQMKNFGLWCRNKNIWLLKTELTLHQLSLNANSTLFFTKKYKEINIQLTNKLNRKIVVDFSVQFLHVIKDICMEFEIENFHIYSLLRYRRIYDGVTSIKPKTFSNKLSKSHLTASLRNLTSNFPNQKRISKNFGSNCPWTPTSGYGSLSSNVNSLE--NFHGSCLSINTQANHYTYDHHNNANKLNNDIHLTTFSNHQPIKSKSNFDRSKLNRDWINLSKSLMEQNINESSSLIFKIKSLTINFDEENISDDL-LDLLYEQFKDFVXXXXXXXXXXXXXXXXXXQYNIYLVEKQSYGNNNGNIHRNPRTNIPLSFDEEIDKMLFSLE 1268
             +W L +    L+    + V   T +G++ + + +  ++  +   + GLW   +  WLLK  +TL    +  ++ L FT  +K++ +QL +    ++ +DFS +    ++++C E  I +    SL+            KP   +NKL K     + R++            + GS  P +P           ++LE  N + S L+ + +A                   L T       K KS  +++ LN  W++ S+SLMEQ + E  ++  + K  T  FD     D++ ++ LYEQ K  +L+ E+E      +  AA+Q+ + +            +  +P++NIP   D++ID  L  L+
Sbjct:    8 ANWNLSVFITSLSTEKPVEVTGQTHIGKLMLDLVEGLDISAD-WSDHGLWWPQRRQWLLKPRITLDTCGVQGDAKLHFTPIHKKVRVQLPDLQFVELSMDFSKKVFVAVQELCAELGIRHPEELSLM------------KP---NNKLKKD----ARRSMKGKKKRHSGSGISPGSASPGSPAYSNFGPEGPFSTLENTNLNQSPLTPSQEA-------------------LNTL-----CKPKSIQEKAYLNSGWLDSSRSLMEQEVQEFDTIYLRYKYYTF-FDLNPKVDEIRINQLYEQAKWSILTEEVECTEEEMMSFAAIQFQVKI------------LSASPQSNIPED-DDDIDAALSDLQ 317          
BLAST of Fermitin family member 1 vs. Ensembl Medaka
Match: fermt2 (fermitin family member 2 [Source:NCBI gene;Acc:101155069])

HSP 1 Score: 99.7525 bits (247), Expect = 3.067e-21
Identity = 85/330 (25.76%), Postives = 151/330 (45.76%), Query Frame = 3
Query:  138 GIKMISNYGYIDGSWKLKIVSEDLNGVVLLTVFNNTILGEIYMKIAQYFNMEKNQMKNFGLWCRNKNIWLLKTELTLHQLSLNANSTLFFTKKYKEINIQLTNKLNRKIVVDFSVQFLHVIKDICMEFEIENFHIYSLLRYRRIYDGVTS----------------IKPKTFSNKLSKSHLTASLRNLTSNFPNQKRISKNFGSNCPWTPTSGYGSLSSNVNSLENFHGSCLSINTQANHYTYDHHNNANKLNNDIHLTTFSNHQPIKSKSNFDRSKLNRDWINLSKSLMEQNINESSSLIFKIKSLTINFDEENISDDL-LDLLYEQFK 1076
            GI+M  +  Y DG+W+LK+   DL+  V L V     +G + +K+ +  +++K+   +  LW   K  WLLKT  TL +  + A++ L FT ++K + +QL N  + K+ V+FS +    + DIC  F I +    SLLR  R                       + P + S  +    +  S+ +    +      + +     P +PTS +   S     L   + S L+++   +             + DI +  +      K +S  D++K+N+ W++ S+SLMEQ++ E+  L+ + K  +  FD     D + ++ LYEQ K
Sbjct:    5 GIRM-PDGCYADGTWELKMHVTDLHRDVSLRVTGEIHIGGVMLKLVEKLDVKKD-WSDHALWWEKKKTWLLKTHWTLDKYGIQADARLLFTPQHKVLRLQLPNMKHMKVKVNFSDRVFKAVSDICKTFNIRHPEELSLLRKPRDPKKKKKKLEEAEEDDLELEGPLLTPGSASEIIYIGPVKGSIYSSPGLYSKTMTPTYDSRDGSPLSPTSAWFGDS----PLSEGNPSILAVSQPIS-------------SPDILVKLY------KPQSLLDKAKINQGWMDSSRSLMEQDVKENEVLLLRFKYHSF-FDLNPKYDAIRVNQLYEQAK 308          
BLAST of Fermitin family member 1 vs. Ensembl Medaka
Match: fermt2 (fermitin family member 2 [Source:NCBI gene;Acc:101155069])

HSP 1 Score: 99.7525 bits (247), Expect = 3.102e-21
Identity = 89/320 (27.81%), Postives = 155/320 (48.44%), Query Frame = 3
Query:  138 GIKMISNYGYIDGSWKLKIVSEDLNGVVLLTVFNNTILGEIYMKIAQYFNMEKNQMKNFGLWCRNKNIWLLKTELTLHQLSLNANSTLFFTKKYKEINIQLTNKLNRKIVVDFSVQFLHVIKDICMEFEIENFHIYSLLRYRR--IYDGVTSIKPKTFSNKLSKSHLTASLRNLTSNFPN--QKRISKNFGS--NCPWTPTSGYGSLSSNVNSLENFHGSCLSINTQANHYTYDHHNNANKLNNDIHLTTFSNHQPIKSKSNFDRSKLNRDWINLSKSLMEQNINESSSLIFKIKSLTINFDEENISDDL-LDLLYEQFK 1076
            GI+M  +  Y DG+W+LK+   DL+  V L V     +G + +K+ +  +++K+   +  LW   K  WLLKT  TL +  + A++ L FT ++K + +QL N  + K+ V+FS +    + DIC  F I +    SLLR  R          + +    +L    LT    ++ S+ P    K ++  + S    P +PTS +   S     L   + S L+++   +             + DI +  +      K +S  D++K+N+ W++ S+SLMEQ++ E+  L+ + K  +  FD     D + ++ LYEQ K
Sbjct:    5 GIRM-PDGCYADGTWELKMHVTDLHRDVSLRVTGEIHIGGVMLKLVEKLDVKKD-WSDHALWWEKKKTWLLKTHWTLDKYGIQADARLLFTPQHKVLRLQLPNMKHMKVKVNFSDRVFKAVSDICKTFNIRHPEELSLLRKPRDPKKKKKKLEEAEEDDLELEGPLLTPGSGSIYSS-PGLYSKTMTPTYDSRDGSPLSPTSAWFGDS----PLSEGNPSILAVSQPIS-------------SPDILVKLY------KPQSLLDKAKINQGWMDSSRSLMEQDVKENEVLLLRFKYHSF-FDLNPKYDAIRVNQLYEQAK 297          
BLAST of Fermitin family member 1 vs. Ensembl Medaka
Match: fermt2 (fermitin family member 2 [Source:NCBI gene;Acc:101155069])

HSP 1 Score: 99.7525 bits (247), Expect = 3.354e-21
Identity = 85/330 (25.76%), Postives = 151/330 (45.76%), Query Frame = 3
Query:  138 GIKMISNYGYIDGSWKLKIVSEDLNGVVLLTVFNNTILGEIYMKIAQYFNMEKNQMKNFGLWCRNKNIWLLKTELTLHQLSLNANSTLFFTKKYKEINIQLTNKLNRKIVVDFSVQFLHVIKDICMEFEIENFHIYSLLRYRRIYDGVTS----------------IKPKTFSNKLSKSHLTASLRNLTSNFPNQKRISKNFGSNCPWTPTSGYGSLSSNVNSLENFHGSCLSINTQANHYTYDHHNNANKLNNDIHLTTFSNHQPIKSKSNFDRSKLNRDWINLSKSLMEQNINESSSLIFKIKSLTINFDEENISDDL-LDLLYEQFK 1076
            GI+M  +  Y DG+W+LK+   DL+  V L V     +G + +K+ +  +++K+   +  LW   K  WLLKT  TL +  + A++ L FT ++K + +QL N  + K+ V+FS +    + DIC  F I +    SLLR  R                       + P + S  +    +  S+ +    +      + +     P +PTS +   S     L   + S L+++   +             + DI +  +      K +S  D++K+N+ W++ S+SLMEQ++ E+  L+ + K  +  FD     D + ++ LYEQ K
Sbjct:    5 GIRM-PDGCYADGTWELKMHVTDLHRDVSLRVTGEIHIGGVMLKLVEKLDVKKD-WSDHALWWEKKKTWLLKTHWTLDKYGIQADARLLFTPQHKVLRLQLPNMKHMKVKVNFSDRVFKAVSDICKTFNIRHPEELSLLRKPRDPKKKKKKLEEAEEDDLELEGPLLTPGSASEIIYIGPVKGSIYSSPGLYSKTMTPTYDSRDGSPLSPTSAWFGDS----PLSEGNPSILAVSQPIS-------------SPDILVKLY------KPQSLLDKAKINQGWMDSSRSLMEQDVKENEVLLLRFKYHSF-FDLNPKYDAIRVNQLYEQAK 308          
BLAST of Fermitin family member 1 vs. Ensembl Medaka
Match: fermt1 (fermitin family member 1 [Source:NCBI gene;Acc:101160280])

HSP 1 Score: 89.7373 bits (221), Expect = 4.367e-18
Identity = 151/721 (20.94%), Postives = 290/721 (40.22%), Query Frame = 3
Query:  147 MISNYGYIDGSWKLKIVSEDLNGV----VLLTVFNNTILGEIYMKIAQYFNMEKNQMKNFGLWCRNKNIWLLKTELTLHQLSLNANSTLFFTKKYKEINIQLTNKLNRKIVVDFSVQFLHVIKDICMEFEIENFHIYSLLRYRRIYDGVTSIKPKTFSNKLSKSHLTASLRNLTSNFPNQKRI----SKNFGSNCPWTPTSGYGSL-SSNVNSLENFHGSCLSINTQANHYTYDHHNNANKLNNDIHLTTFSNH-QPIKSKSNFDRSKLNRDWINLSKSLMEQNINESSSLIFKIK-----SLTINFDEENISDDLLDLLYEQFKDFVXXXXXXXXXXXXXXXXXXQYNIYLVEKQSYGNNNGNIHRNPRTNIPLSFDEEIDKMLFSLEKELLNISDEFDKSFSIRTDYFV-GVHQIIPIKSSGKFLRMK---LKLIKNQIKIFKENDFS----------NPKYEFCLKNCKFFTNFGVDSNENIISWMFECNKRLLKIEMKFFNDEDFFSLYSSAVAHSNFWWPSLKQIFDCERVARKLVEIFRSSDEPEYNIFNMPRVEL--VNLLGCRIGKKEQSGKYLKTILQYNQCFKTLSRRKSKIQYIRFCLNFPRFNYHYFFVKIHEPPEEMGLTVVAVNEEMFIVFDPNYYSITRLVLPW--AVLKSWKFNTELNQLDLYF-KNLFISFTTQDCSAICFHEFISTFIWFASTDK----TLDK 2195
            MI+   Y + SW+L +  ++  GV      L V  +  +G + +K+ +     ++   +  LW   +  WLLKT  TL +  + A++ L +T ++K + +QL N    KI V FS      + DIC +           L  RR         P+  S        +   +    N P         S N G         G G + S  + +  + +G  +S  +      +   N   K   ++     +   +P+   S  D++  N  W++ S+SLMEQ++  S  L+ + K      L   +D   I+      LYEQ +  +L  EI+      L+ A+LQY+I  +   S   +N N             + E+D+    +E  L N+    + S    TD F+  +  I  +  + +  R K   L+  K    +FK+ + S           P  +F L+ C+   +  V   +  I  +      + ++ ++  N+  +    ++ +  S     +        +     +++   +  P +   ++  +E+   + +  R  KK+++ +    IL+ +Q    LS   +K+++I+   + P F   Y+ V+     ++    ++ ++    I  D    S    V  W  A +K W  N E+ Q+ + F +++ I+F    C     HEFI  +I+ ++  K    TLD+
Sbjct:    1 MITPAQYGETSWELGVQVDEKEGVESMKFKLRVAGDLHVGGLMLKLVEKIKAPQD-WSDHALWWEQRKCWLLKTHWTLDKYGIQADADLRYTPQHKPLLLQLPNMKTIKINVCFSSMVFKTVSDICRQ-----------LNIRR---------PEELSLLKPPDDPSKKKKKKDKNSPQDDIFDIWDSANGGPG-------GTGPMYSKTMTATYDENGMPMSATS-----LWFGENPLAKCQPNLPPAELAKMFEPL---SLVDKATNNAGWLDSSRSLMEQDVQSSDRLLLRFKYNVFFDLNPKYDAVRITQ-----LYEQARWAILLEEIDCTEEEMLMFASLQYHICKLTMSSEPRDNAN-------------EPEVDE----VEAALSNLEVTLEGS---HTDKFLEDITDIPQLADTLRLFRPKWLTLRPYKEYWFVFKDTNISYYKNKEASSGEPIEQFHLRGCEVVPDVNVTDKKFGIKLLIPVADGMNEVYIRCDNEMQYAKWKAACILASKGKTMAYSSYKSEVKNIHSFLQMKSLAPPPGHATPDVDAMEMNAESFVSPRYAKKQKTKQLTTRILEAHQNIAHLSLMDAKMRFIKAWQSLPEFGIKYYIVRFKGSKKD---EILGISYNRLIRID---MSTGLPVTTWRFANMKQWNVNWEVRQVMIEFDQSVSIAFCCLSCDCKVVHEFIGGYIFLSTRSKDQNETLDE 654          
BLAST of Fermitin family member 1 vs. Ensembl Medaka
Match: fermt1 (fermitin family member 1 [Source:NCBI gene;Acc:101160280])

HSP 1 Score: 89.7373 bits (221), Expect = 4.367e-18
Identity = 151/721 (20.94%), Postives = 290/721 (40.22%), Query Frame = 3
Query:  147 MISNYGYIDGSWKLKIVSEDLNGV----VLLTVFNNTILGEIYMKIAQYFNMEKNQMKNFGLWCRNKNIWLLKTELTLHQLSLNANSTLFFTKKYKEINIQLTNKLNRKIVVDFSVQFLHVIKDICMEFEIENFHIYSLLRYRRIYDGVTSIKPKTFSNKLSKSHLTASLRNLTSNFPNQKRI----SKNFGSNCPWTPTSGYGSL-SSNVNSLENFHGSCLSINTQANHYTYDHHNNANKLNNDIHLTTFSNH-QPIKSKSNFDRSKLNRDWINLSKSLMEQNINESSSLIFKIK-----SLTINFDEENISDDLLDLLYEQFKDFVXXXXXXXXXXXXXXXXXXQYNIYLVEKQSYGNNNGNIHRNPRTNIPLSFDEEIDKMLFSLEKELLNISDEFDKSFSIRTDYFV-GVHQIIPIKSSGKFLRMK---LKLIKNQIKIFKENDFS----------NPKYEFCLKNCKFFTNFGVDSNENIISWMFECNKRLLKIEMKFFNDEDFFSLYSSAVAHSNFWWPSLKQIFDCERVARKLVEIFRSSDEPEYNIFNMPRVEL--VNLLGCRIGKKEQSGKYLKTILQYNQCFKTLSRRKSKIQYIRFCLNFPRFNYHYFFVKIHEPPEEMGLTVVAVNEEMFIVFDPNYYSITRLVLPW--AVLKSWKFNTELNQLDLYF-KNLFISFTTQDCSAICFHEFISTFIWFASTDK----TLDK 2195
            MI+   Y + SW+L +  ++  GV      L V  +  +G + +K+ +     ++   +  LW   +  WLLKT  TL +  + A++ L +T ++K + +QL N    KI V FS      + DIC +           L  RR         P+  S        +   +    N P         S N G         G G + S  + +  + +G  +S  +      +   N   K   ++     +   +P+   S  D++  N  W++ S+SLMEQ++  S  L+ + K      L   +D   I+      LYEQ +  +L  EI+      L+ A+LQY+I  +   S   +N N             + E+D+    +E  L N+    + S    TD F+  +  I  +  + +  R K   L+  K    +FK+ + S           P  +F L+ C+   +  V   +  I  +      + ++ ++  N+  +    ++ +  S     +        +     +++   +  P +   ++  +E+   + +  R  KK+++ +    IL+ +Q    LS   +K+++I+   + P F   Y+ V+     ++    ++ ++    I  D    S    V  W  A +K W  N E+ Q+ + F +++ I+F    C     HEFI  +I+ ++  K    TLD+
Sbjct:    1 MITPAQYGETSWELGVQVDEKEGVESMKFKLRVAGDLHVGGLMLKLVEKIKAPQD-WSDHALWWEQRKCWLLKTHWTLDKYGIQADADLRYTPQHKPLLLQLPNMKTIKINVCFSSMVFKTVSDICRQ-----------LNIRR---------PEELSLLKPPDDPSKKKKKKDKNSPQDDIFDIWDSANGGPG-------GTGPMYSKTMTATYDENGMPMSATS-----LWFGENPLAKCQPNLPPAELAKMFEPL---SLVDKATNNAGWLDSSRSLMEQDVQSSDRLLLRFKYNVFFDLNPKYDAVRITQ-----LYEQARWAILLEEIDCTEEEMLMFASLQYHICKLTMSSEPRDNAN-------------EPEVDE----VEAALSNLEVTLEGS---HTDKFLEDITDIPQLADTLRLFRPKWLTLRPYKEYWFVFKDTNISYYKNKEASSGEPIEQFHLRGCEVVPDVNVTDKKFGIKLLIPVADGMNEVYIRCDNEMQYAKWKAACILASKGKTMAYSSYKSEVKNIHSFLQMKSLAPPPGHATPDVDAMEMNAESFVSPRYAKKQKTKQLTTRILEAHQNIAHLSLMDAKMRFIKAWQSLPEFGIKYYIVRFKGSKKD---EILGISYNRLIRID---MSTGLPVTTWRFANMKQWNVNWEVRQVMIEFDQSVSIAFCCLSCDCKVVHEFIGGYIFLSTRSKDQNETLDE 654          
BLAST of Fermitin family member 1 vs. Planmine SMEST
Match: SMESG000005290.1 (SMESG000005290.1)

HSP 1 Score: 1364.75 bits (3531), Expect = 0.000e+0
Identity = 689/689 (100.00%), Postives = 689/689 (100.00%), Query Frame = 3
Query:  147 MISNYGYIDGSWKLKIVSEDLNGVVLLTVFNNTILGEIYMKIAQYFNMEKNQMKNFGLWCRNKNIWLLKTELTLHQLSLNANSTLFFTKKYKEINIQLTNKLNRKIVVDFSVQFLHVIKDICMEFEIENFHIYSLLRYRRIYDGVTSIKPKTFSNKLSKSHLTASLRNLTSNFPNQKRISKNFGSNCPWTPTSGYGSLSSNVNSLENFHGSCLSINTQANHYTYDHHNNANKLNNDIHLTTFSNHQPIKSKSNFDRSKLNRDWINLSKSLMEQNINESSSLIFKIKSLTINFDEENISDDLLDLLYEQFKDFVXXXXXXXXXXXXXXXXXXQYNIYLVEKQSYGNNNGNIHRNPRTNIPLSFDEEIDKMLFSLEKELLNISDEFDKSFSIRTDYFVGVHQIIPIKSSGKFLRMKLKLIKNQIKIFKENDFSNPKYEFCLKNCKFFTNFGVDSNENIISWMFECNKRLLKIEMKFFNDEDFFSLYSSAVAHSNFWWPSLKQIFDCERVARKLVEIFRSSDEPEYNIFNMPRVELVNLLGCRIGKKEQSGKYLKTILQYNQCFKTLSRRKSKIQYIRFCLNFPRFNYHYFFVKIHEPPEEMGLTVVAVNEEMFIVFDPNYYSITRLVLPWAVLKSWKFNTELNQLDLYFKNLFISFTTQDCSAICFHEFISTFIWFASTDKTLDKADKISE 2213
            MISNYGYIDGSWKLKIVSEDLNGVVLLTVFNNTILGEIYMKIAQYFNMEKNQMKNFGLWCRNKNIWLLKTELTLHQLSLNANSTLFFTKKYKEINIQLTNKLNRKIVVDFSVQFLHVIKDICMEFEIENFHIYSLLRYRRIYDGVTSIKPKTFSNKLSKSHLTASLRNLTSNFPNQKRISKNFGSNCPWTPTSGYGSLSSNVNSLENFHGSCLSINTQANHYTYDHHNNANKLNNDIHLTTFSNHQPIKSKSNFDRSKLNRDWINLSKSLMEQNINESSSLIFKIKSLTINFDEENISDDLLDLLYEQFKDFVLSGEIELELNLGLILAALQYNIYLVEKQSYGNNNGNIHRNPRTNIPLSFDEEIDKMLFSLEKELLNISDEFDKSFSIRTDYFVGVHQIIPIKSSGKFLRMKLKLIKNQIKIFKENDFSNPKYEFCLKNCKFFTNFGVDSNENIISWMFECNKRLLKIEMKFFNDEDFFSLYSSAVAHSNFWWPSLKQIFDCERVARKLVEIFRSSDEPEYNIFNMPRVELVNLLGCRIGKKEQSGKYLKTILQYNQCFKTLSRRKSKIQYIRFCLNFPRFNYHYFFVKIHEPPEEMGLTVVAVNEEMFIVFDPNYYSITRLVLPWAVLKSWKFNTELNQLDLYFKNLFISFTTQDCSAICFHEFISTFIWFASTDKTLDKADKISE
Sbjct:    1 MISNYGYIDGSWKLKIVSEDLNGVVLLTVFNNTILGEIYMKIAQYFNMEKNQMKNFGLWCRNKNIWLLKTELTLHQLSLNANSTLFFTKKYKEINIQLTNKLNRKIVVDFSVQFLHVIKDICMEFEIENFHIYSLLRYRRIYDGVTSIKPKTFSNKLSKSHLTASLRNLTSNFPNQKRISKNFGSNCPWTPTSGYGSLSSNVNSLENFHGSCLSINTQANHYTYDHHNNANKLNNDIHLTTFSNHQPIKSKSNFDRSKLNRDWINLSKSLMEQNINESSSLIFKIKSLTINFDEENISDDLLDLLYEQFKDFVLSGEIELELNLGLILAALQYNIYLVEKQSYGNNNGNIHRNPRTNIPLSFDEEIDKMLFSLEKELLNISDEFDKSFSIRTDYFVGVHQIIPIKSSGKFLRMKLKLIKNQIKIFKENDFSNPKYEFCLKNCKFFTNFGVDSNENIISWMFECNKRLLKIEMKFFNDEDFFSLYSSAVAHSNFWWPSLKQIFDCERVARKLVEIFRSSDEPEYNIFNMPRVELVNLLGCRIGKKEQSGKYLKTILQYNQCFKTLSRRKSKIQYIRFCLNFPRFNYHYFFVKIHEPPEEMGLTVVAVNEEMFIVFDPNYYSITRLVLPWAVLKSWKFNTELNQLDLYFKNLFISFTTQDCSAICFHEFISTFIWFASTDKTLDKADKISE 689          
BLAST of Fermitin family member 1 vs. Planmine SMEST
Match: SMESG000020711.1 (SMESG000020711.1)

HSP 1 Score: 88.5817 bits (218), Expect = 6.940e-18
Identity = 153/711 (21.52%), Postives = 295/711 (41.49%), Query Frame = 3
Query:  147 MISNYGYIDGSWKLKIVSEDLNGVVLLTVFNNTILGEIYMKIAQYFNMEKNQ-MKNFGLWCRNKNIWLLKTELTLHQLSLNANSTLFFTKKYKEINIQLTNKLNRKIVVDFSVQFLHVIKDICMEFEIE-----NFHIYSLLRYRRIYDGVTSIKPKTFSNKLSKSHLTASLRNLTSNFPNQKRISKNFGSNCPWTPTSGYGSLSSNVNSLENFHGSCLSINTQANHYTYDHHNNANKLNNDIHLTTFSNHQPIKSKSNFD------------RSKLNRDWINLSKSLMEQNINES--SSLIFKIK-----SLTINFDEENISDDLLDLLYEQFKDFVXXXXXXXXXXXXXXXXXXQYNIYLVEKQSYGNNNGNIHRNPRTNIPLSFDEEIDKMLFSLEKELLNISDEFDKSFSIRTDYFVGVHQIIPIKSSGKFLRMKLKLIKNQIKI---FKENDFSNPKYEFCLKNCKFFTNFGVDSNENIISWMFECNKRLLKIEMKFFNDEDFFSLYSSA---VAHSNFWWPSLKQIFDCERVARKLVEIFR-SSDEPEYNI----FNMPRVELVNLLGCRIGKKEQSGKYLKT-ILQYNQCFKTLSRRKSKIQYIRFCLNFPRFNYHYFFVKIHEPPEEMGLTVVAVNEEMFIVFDPNYYSITRLVLPWAVLKSWKFNTELNQLDLYFKNLFISFTTQDCSAICFHEFISTFIWF 2168
            M+S    IDGSW+L I   D+   V + V  +  +G +  K  +  N+++ Q   +  LW  +KNIWL  T  TL Q  + +NS L   K + ++ + L +     + V+FS     V+  IC EF I      +  I  +    +    +T +K K F+ + S++                K   K   +  P +PTS Y +L     +L +  G+   ++T     +     + N L   I    FS    + +KS F+            +++LN  W++ S+SLMEQ IN      L F+ K      L   +D   I       L+EQ K  ++S  +++  +  ++  ALQ    L  + S  + N  +      +     ++E+D M+  LE+  L    + D    ++     G  ++      G   + +L  +  + K+     +++ + P  E  + +C+      V +N+  I  +   N+   K +   F+++D +S + +A   VA       +L      ++    ++E+ R  +  P+  +     N    +L + +  ++ KK +S  YL++ I + +   + LS   +K +YI+       F   Y  VK     +E    ++ +     ++ +PN   +      ++ ++SW  N +  ++ L FK   + F     +     EFI  +++ 
Sbjct:    1 MLSENERIDGSWELTISITDIQNEVKVRVRGDVHIGGVMHKAVE--NLQRKQDWSDHMLWWPDKNIWLSHTRTTLDQYGVQSNSKLELIKVHNDLIVMLPSMHQVTVPVNFSADIFSVVIRICKEFGIRFPEELSLQIPLVKEDLKSNHTLTMMKSKIFAIQSSEN----------------KSSPKELPTPEPLSPTSNYNTLKYPFGTLNHNTGTLSPMSTFNKSLSSQIPQSCNSLV--IEGPEFSECMKMPAKSVFENNMLFQPKNLIQKARLNSTWLDSSRSLMEQGINADFKKPLYFRFKFHLFYDLNTKYDAVRIHQ-----LFEQAKWDLISSSLDVTEDEMVVFVALQLQAELQTEISTEDQNMTVKPTDNVDANNVTEDEVDLMISELEEMCLGDQSKVDGQL-VQEPRLEGSLRVYRTNKLGMKSQKRLWCVLQKQKLNFYVSKDELNQPINEILVSSCQMKAEVNVSANKFFIK-ITTSNREEFKFQ---FDNKDDYSNWMAALRLVARRK----TLTNKVLFQKEIENIMEVLRLQTPAPQAVLTKEDLNNRLKDLNDYMPEKLIKKAKSKDYLRSRIGESHANVRLLSVLDAKHKYIQAWQRLENFGITYVIVKFDTCNKE---EIIGIAFNRIMIINPNSGDVNGTHY-FSDMRSWNINWDAEKVILDFKATKLVFKPLSTNCKTVIEFIGGYVFL 673          
BLAST of Fermitin family member 1 vs. Planmine SMEST
Match: SMESG000025860.1 (SMESG000025860.1)

HSP 1 Score: 53.9138 bits (128), Expect = 3.825e-7
Identity = 55/220 (25.00%), Postives = 105/220 (47.73%), Query Frame = 3
Query: 1533 CNKRLLKIEMKFFNDEDFFSLYSSAVAHSNFWWPSLKQIFDCE-RVARKLVEIFRSSDEPEYNIF------NMPRVELVNLLGCRIGKKEQSGKYLKTILQYNQCFKTLSRRKSKIQYIRFCLNFPRFNYHYFFVKIHEPPEEMGLTVVAVNEEMFIVFDPNYYSITRLVLPWAVLKSWKFNTELNQLDLYFKNLF--ISF-TTQDCSAICFHEFISTFI 2162
             +K   +++++F+N ++F    ++    S     +L   F  E ++   +VE+      P++N+        +  V LV+++G    K  +S + L+ +L + + F  LS+ ++KI YI+  L      +HY  V +++  E   L ++ +  +  I+ D     +T LV     L SWK N ELN   L F   F  I+F  + +C    FHE++  ++
Sbjct:  481 TSKSFERVKIRFYNQQEFIKWATALRLLSKSIDFTLLSNFKYEYQMVTNIVEM----KSPQFNLKMLKTNKEVDSVNLVDIIGSIHNKPFKSKEILQKVLYFAKSFSHLSKIEAKIAYIKCWLTLNNSGFHYMTVHVNQNSE---LQIIGIGYDRLILADIETGMVTNLV-EMNKLISWKTNWELNNTLLMFSETFWKINFKNSWECQ--IFHEYLGGYL 690          
The following BLAST results are available for this feature:
BLAST of Fermitin family member 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FERMT28.578e-1926.63fermitin family member 2 [Source:HGNC Symbol;Acc:H... [more]
FERMT28.578e-1926.63fermitin family member 2 [Source:HGNC Symbol;Acc:H... [more]
FERMT29.563e-1926.63fermitin family member 2 [Source:HGNC Symbol;Acc:H... [more]
FERMT29.563e-1926.63fermitin family member 2 [Source:HGNC Symbol;Acc:H... [more]
FERMT25.800e-1833.57fermitin family member 2 [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of Fermitin family member 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
unc-1124.712e-1724.63pep chromosome:WBcel235:V:14691854:14697107:-1 gen... [more]
unc-1124.712e-1724.63pep chromosome:WBcel235:V:14691857:14696654:-1 gen... [more]
back to top
BLAST of Fermitin family member 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Fit24.936e-1424.55gene:FBgn0036688 transcript:FBtr0075275[more]
Fit17.076e-1322.09gene:FBgn0035498 transcript:FBtr0073209[more]
Fit17.076e-1322.09gene:FBgn0035498 transcript:FBtr0073210[more]
back to top
BLAST of Fermitin family member 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fermt23.146e-2226.36fermitin family member 2 [Source:NCBI gene;Acc:553... [more]
fermt23.408e-2226.36fermitin family member 2 [Source:NCBI gene;Acc:553... [more]
fermt24.090e-2227.95fermitin family member 2 [Source:NCBI gene;Acc:553... [more]
fermt3b7.182e-1520.17fermitin family member 3b [Source:ZFIN;Acc:ZDB-GEN... [more]
fermt14.253e-1024.21fermitin family member 1 [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of Fermitin family member 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sh3bgrl33.924e-1927.83SH3 domain binding glutamate-rich protein like 3 [... [more]
sh3bgrl34.236e-1927.83SH3 domain binding glutamate-rich protein like 3 [... [more]
sh3bgrl35.732e-1927.83SH3 domain binding glutamate-rich protein like 3 [... [more]
sh3bgrl37.910e-1925.52SH3 domain binding glutamate-rich protein like 3 [... [more]
sh3bgrl33.467e-1827.39SH3 domain binding glutamate-rich protein like 3 [... [more]
back to top
BLAST of Fermitin family member 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Fermt24.885e-1733.81fermitin family member 2 [Source:MGI Symbol;Acc:MG... [more]
Fermt21.267e-1533.81fermitin family member 2 [Source:MGI Symbol;Acc:MG... [more]
Fermt33.286e-1229.17fermitin family member 3 [Source:MGI Symbol;Acc:MG... [more]
Fermt39.698e-1229.17fermitin family member 3 [Source:MGI Symbol;Acc:MG... [more]
Fermt11.772e-1127.66fermitin family member 1 [Source:MGI Symbol;Acc:MG... [more]
back to top
BLAST of Fermitin family member 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|F1Q8X5|FERM2_DANRE3.088e-2127.95Fermitin family homolog 2 OS=Danio rerio OX=7955 G... [more]
sp|Q96AC1|FERM2_HUMAN4.592e-1826.63Fermitin family homolog 2 OS=Homo sapiens OX=9606 ... [more]
sp|Q18685|UN112_CAEEL5.993e-1624.63Protein unc-112 OS=Caenorhabditis elegans OX=6239 ... [more]
sp|Q5R8M5|FERM1_PONAB8.450e-1525.67Fermitin family homolog 1 OS=Pongo abelii OX=9601 ... [more]
sp|Q8CIB5|FERM2_MOUSE8.861e-1533.81Fermitin family homolog 2 OS=Mus musculus OX=10090... [more]
back to top
BLAST of Fermitin family member 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
V3ZRW41.099e-2423.36B41 domain-containing protein OS=Lottia gigantea O... [more]
A0A3Q2HLX76.058e-2122.18Fermitin family member 2 OS=Equus caballus OX=9796... [more]
G1N4771.133e-2023.31Fermitin family member 1 OS=Meleagris gallopavo OX... [more]
U3I1G52.743e-1923.58Fermitin family member 1 OS=Anas platyrhynchos pla... [more]
A0A2I4BBP13.107e-1927.19fermitin family homolog 2 isoform X1 OS=Austrofund... [more]
back to top
BLAST of Fermitin family member 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fermt28.176e-2026.11fermitin family member 2 [Source:NCBI gene;Acc:553... [more]
fermt28.392e-2026.11fermitin family member 2 [Source:NCBI gene;Acc:553... [more]
fermt3b3.295e-1024.43fermitin family homolog 3-like [Source:NCBI gene;A... [more]
fermt3b4.581e-1024.43fermitin family homolog 3-like [Source:NCBI gene;A... [more]
fermt3a6.183e-1021.82fermitin family homolog 3 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Fermitin family member 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
fermt21.647e-2126.17fermitin family member 2 [Source:NCBI gene;Acc:553... [more]
ENSPMAT00000002438.12.149e-1329.08pep scaffold:Pmarinus_7.0:GL480979:127958:159017:1... [more]
back to top
BLAST of Fermitin family member 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Fermitin family member 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO365657.109e-1323.37Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Fermitin family member 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fermt23.067e-2125.76fermitin family member 2 [Source:NCBI gene;Acc:101... [more]
fermt23.102e-2127.81fermitin family member 2 [Source:NCBI gene;Acc:101... [more]
fermt23.354e-2125.76fermitin family member 2 [Source:NCBI gene;Acc:101... [more]
fermt14.367e-1820.94fermitin family member 1 [Source:NCBI gene;Acc:101... [more]
fermt14.367e-1820.94fermitin family member 1 [Source:NCBI gene;Acc:101... [more]
back to top
BLAST of Fermitin family member 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000005290.10.000e+0100.00SMESG000005290.1[more]
SMESG000020711.16.940e-1821.52SMESG000020711.1[more]
SMESG000025860.13.825e-725.00SMESG000025860.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028005 ID=SMED30028005|Name=Fermitin family member 1|organism=Schmidtea mediterranea sexual|type=transcript|length=2265bp
AAATCGATCACGACATCCAATGCAATCAGAAATAAATGAAAACATATTTC
TTTATTTATCAGAGATTTCATTTTTTGATGTCAAAAATCCAATTTACCAA
AACAACATAATTTTTTTCAATTTTCAGTTGTGCTTCTGGAATTAAAATGA
TTTCAAACTATGGATATATTGATGGATCATGGAAATTAAAAATAGTATCT
GAAGATTTAAATGGAGTCGTCCTGCTAACGGTATTCAATAATACAATTTT
GGGTGAAATCTATATGAAAATTGCCCAATATTTTAATATGGAAAAGAATC
AAATGAAAAATTTTGGCTTGTGGTGTCGGAATAAAAATATATGGCTACTG
AAAACAGAATTAACTCTTCATCAATTATCATTGAACGCAAATTCAACTTT
GTTTTTCACAAAAAAATACAAAGAAATAAATATTCAATTAACAAATAAAC
TGAATCGAAAAATTGTTGTAGACTTTTCTGTTCAATTTTTACATGTCATC
AAGGATATTTGTATGGAATTTGAAATTGAAAATTTTCACATTTATTCCTT
ATTGAGATACCGTAGGATTTATGATGGAGTTACTTCAATAAAGCCGAAAA
CATTTAGTAATAAATTATCCAAATCTCATTTAACAGCAAGTTTGAGGAAT
TTAACTTCAAATTTTCCAAATCAAAAAAGAATTTCAAAAAATTTTGGATC
AAATTGTCCATGGACACCAACTAGTGGTTATGGATCACTAAGTAGCAATG
TTAATTCCCTTGAAAACTTTCATGGATCTTGTTTATCGATAAATACTCAA
GCAAATCATTATACCTATGACCATCATAATAACGCTAATAAATTAAACAA
TGACATTCATTTGACCACATTCTCAAATCATCAACCAATTAAATCCAAGA
GCAACTTTGACCGATCAAAACTCAATAGGGATTGGATAAATCTTTCTAAA
TCTTTGATGGAACAAAATATCAATGAAAGCAGTTCATTAATTTTCAAAAT
CAAATCATTAACAATAAATTTTGACGAGGAAAATATTTCTGATGATTTAT
TGGATTTACTTTATGAACAATTTAAAGATTTTGTTCTATCTGGAGAAATT
GAATTGGAATTAAATCTAGGCTTGATTCTGGCGGCGTTGCAATATAATAT
TTATTTAGTTGAAAAACAGTCTTATGGAAATAACAACGGCAACATTCATC
GGAATCCAAGAACCAATATTCCATTGTCATTTGATGAGGAAATAGATAAA
ATGTTATTTTCTCTGGAAAAAGAACTATTAAATATATCCGACGAATTCGA
TAAAAGTTTTTCAATAAGAACCGACTATTTCGTTGGAGTTCATCAAATTA
TTCCTATCAAATCTAGCGGTAAATTTTTGAGAATGAAATTAAAACTGATA
AAAAACCAAATAAAGATTTTTAAAGAAAATGATTTTTCAAATCCGAAATA
CGAATTTTGTCTCAAGAACTGTAAATTTTTTACAAATTTCGGTGTTGATT
CCAATGAAAATATTATTTCATGGATGTTTGAATGCAATAAAAGACTATTG
AAAATTGAAATGAAATTTTTTAACGATGAAGACTTTTTTTCGCTATATTC
AAGCGCAGTTGCTCATTCGAATTTTTGGTGGCCATCTCTTAAACAAATTT
TTGATTGTGAAAGAGTTGCCAGAAAGCTCGTGGAAATATTTCGCTCATCA
GACGAGCCGGAATACAATATATTCAACATGCCAAGAGTTGAATTGGTTAA
TTTGTTGGGATGTCGAATAGGCAAAAAAGAACAGTCTGGAAAATATCTCA
AAACTATATTGCAATACAATCAATGCTTTAAAACACTTTCTCGTCGAAAA
TCTAAAATACAATACATAAGATTTTGTTTGAATTTCCCAAGATTCAATTA
TCATTATTTTTTTGTAAAAATTCACGAACCTCCAGAAGAGATGGGTTTGA
CAGTTGTCGCCGTTAACGAAGAGATGTTCATCGTTTTCGATCCAAATTAT
TATTCTATCACACGATTGGTATTGCCGTGGGCAGTCTTGAAATCCTGGAA
GTTTAATACTGAACTTAATCAATTAGATTTATACTTTAAAAATTTATTTA
TTTCGTTTACCACTCAGGATTGTTCTGCCATTTGTTTCCATGAATTCATA
TCTACATTTATTTGGTTTGCATCAACTGATAAAACTCTTGATAAAGCTGA
CAAAATAAGTGAACTGATAAATTTAATAAATATCAAAACGTAATTAAATT
AATAACATTAACATG
back to top

protein sequence of SMED30028005-orf-1

>SMED30028005-orf-1 ID=SMED30028005-orf-1|Name=SMED30028005-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=699bp
MISNYGYIDGSWKLKIVSEDLNGVVLLTVFNNTILGEIYMKIAQYFNMEK
NQMKNFGLWCRNKNIWLLKTELTLHQLSLNANSTLFFTKKYKEINIQLTN
KLNRKIVVDFSVQFLHVIKDICMEFEIENFHIYSLLRYRRIYDGVTSIKP
KTFSNKLSKSHLTASLRNLTSNFPNQKRISKNFGSNCPWTPTSGYGSLSS
NVNSLENFHGSCLSINTQANHYTYDHHNNANKLNNDIHLTTFSNHQPIKS
KSNFDRSKLNRDWINLSKSLMEQNINESSSLIFKIKSLTINFDEENISDD
LLDLLYEQFKDFVLSGEIELELNLGLILAALQYNIYLVEKQSYGNNNGNI
HRNPRTNIPLSFDEEIDKMLFSLEKELLNISDEFDKSFSIRTDYFVGVHQ
IIPIKSSGKFLRMKLKLIKNQIKIFKENDFSNPKYEFCLKNCKFFTNFGV
DSNENIISWMFECNKRLLKIEMKFFNDEDFFSLYSSAVAHSNFWWPSLKQ
IFDCERVARKLVEIFRSSDEPEYNIFNMPRVELVNLLGCRIGKKEQSGKY
LKTILQYNQCFKTLSRRKSKIQYIRFCLNFPRFNYHYFFVKIHEPPEEMG
LTVVAVNEEMFIVFDPNYYSITRLVLPWAVLKSWKFNTELNQLDLYFKNL
FISFTTQDCSAICFHEFISTFIWFASTDKTLDKADKISELINLINIKT*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0007229integrin-mediated signaling pathway
GO:0043616keratinocyte proliferation
GO:0051546keratinocyte migration
GO:0090162establishment of epithelial cell polarity
GO:0007155cell adhesion
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR040790Kindlin_2_N
IPR037843Kindlin/fermitin
IPR019748FERM_central
IPR019749Band_41_domain
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005829cytosol
GO:0005856cytoskeleton
GO:0005886plasma membrane
GO:0005925focal adhesion
GO:0016020membrane
GO:0030054cell junction
GO:0032587ruffle membrane
GO:0042995cell projection
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR019749Band 4.1 domainSMARTSM00295B41_5coord: 88..588
e-value: 0.0076
score: 6.1
IPR019748FERM central domainPFAMPF00373FERM_Mcoord: 302..588
e-value: 2.3E-9
score: 37.7
NoneNo IPR availableGENE3DG3DSA:3.10.20.90coord: 1..96
e-value: 7.5E-17
score: 63.4
NoneNo IPR availableCDDcd17096FERM_F1_kindlinscoord: 248..286
e-value: 3.73591E-5
score: 40.7268
NoneNo IPR availableCDDcd17095FERM_F0_kindlinscoord: 11..90
e-value: 9.13822E-10
score: 53.4607
IPR040790Kindlin-2, N-terminalPFAMPF18124Kindlin_2_Ncoord: 7..92
e-value: 5.4E-11
score: 42.5
IPR037843Kindlin/fermitinPANTHERPTHR16160FAMILY NOT NAMEDcoord: 4..677