Carnitine O-palmitoyltransferase 1, liver isoform

Overview
NameCarnitine O-palmitoyltransferase 1, liver isoform
Smed IDSMED30027997
Length (bp)2652
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Carnitine O-palmitoyltransferase 1, liver isoform (SMED30027997) t-SNE clustered cells

Violin plots show distribution of expression levels for Carnitine O-palmitoyltransferase 1, liver isoform (SMED30027997) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Carnitine O-palmitoyltransferase 1, liver isoform (SMED30027997) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Carnitine O-palmitoyltransferase 1, liver isoform (SMED30027997) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027997

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermisSMED30027997h1SMcG0019926 dd_Smed_v4_4901_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior sideSMED30027997h1SMcG0019926 dd_Smed_v4_4901_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30027997h1SMcG0019926 dd_Smed_v4_4901_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Carnitine O-palmitoyltransferase 1, liver isoform vs. Ensembl Human
Match: CPT1A (carnitine palmitoyltransferase 1A [Source:HGNC Symbol;Acc:HGNC:2328])

HSP 1 Score: 739.184 bits (1907), Expect = 0.000e+0
Identity = 369/773 (47.74%), Postives = 509/773 (65.85%), Query Frame = 3
Query:  165 MAEAHQAVAFSIKVSDDGIDWSLNFKAFKEIAKSGVKSWKKGLYRIQNRFYNGLYPSQPGNWLGIVCGVFASSMVGFDLSFGLIEKIEVQLQRVLELESPRDHLIASLMYSCGLWTAGVIVRKYTLSNLLYYMDWMYESQTGPSMKTKAWMVLVTILGGGNPKLYSYQGXXXXXXXXXXXXTINKFLTSMEPLLSXXXXXXXXXXXXXXXXQHGFKIQFYLHLKYLWSSNYVSDWWEEFVYLSSRSSLMINSNYYGMDALMLRHEWIQAARAANLICASVQFMRELNTEELEPLVIQGK-VPLCSRQYERMFCTVRVPRNISRKNRSDQLVHYRESRYIVVICRGNYYKVNFMKGDQYLDPVDMEKQFQNILDTAVQPNDPSQYIGVLTAGERNQWAINRESFFKDGCNKESLEIIEKAAFMLVLEDEFQDYNPND-ESKLDAFGHSLLHGKGHDRWYDKSFNMVVFKNGRVGFNAEHSWADAPIMAHYWEYILLEDILSPKFGYTPDGHCRGVGKSNNISPQKLQWKLSKMIELEIEKCLLTTSKLIEDIDLHIVPFSEFGRGFMKTCKVSPDGFIQMALQLAYYRDSESFCLTYEACMTRLFREGRTETVRSCSNASCEFVRSMENKDLSNSDKINYLQLASNKHQKLYRDAMTGKGVDRHIFCMYVISKYLNIESEFLQKALSVPWKLSTSQTPHTQLTKFDMRRYPNFLSAGGGFGPVTSDGYGVSYMMAGEDIIFFHISSNISCQKTDSKRFANNLCQALLDIKKLFN 2477
            MAEAHQAVAF   V+ DGID  L+ +A ++I  SG+ SWKK   R +N    G+YP+ P +WL +V GV  +     D S G+I KI   L+    + S   ++++ +++  GLW A ++  +Y+L  LL Y  WM+      S  TK WM +V I  G  P LYS+Q SLP+LP+P +  T+N++L S+ PL+ EE++  +  LA +F    G ++Q+YL LK  W++NYVSDWWEE++YL  R  LM+NSNYY MD L +    IQAARA N I A + + R+L+ EE++P+ + G  +PLCS Q+ERMF T R+P        +D + H R+S++IVV  RG Y+KV      + L P +ME+Q Q ILD   +P      +  LTAG+R  WA  R+++F  G NK+SL+ +EKAAF + L++  + Y   D ++ +D++  SLLHG+ +DRW+DKSF  VVFKNG++G NAEHSWADAPI+AH WEY++  D L  + GY  DGHC+G    N   P +LQW +    +  IE  L T + L  D+D H  PF  FG+G +K C+ SPD F+Q+ALQLA+Y+D   FCLTYEA MTRLFREGRTETVRSC+  SC+FVR+M +   +   ++   +LAS KHQ +YR AMTG G+DRH+FC+YV+SKYL +ES FL++ LS PW+LSTSQTP  Q+  FD+   P ++S+GGGFGPV  DGYGVSY++ GE++I FHISS  SC +TDS RF  +L +A+ DI  LF 
Sbjct:    1 MAEAHQAVAFQFTVTPDGIDLRLSHEALRQIYLSGLHSWKKKFIRFKNGIITGVYPASPSSWLIVVVGVMTTMYAKIDPSLGIIAKINRTLETANCMSSQTKNVVSGVLFGTGLWVALIVTMRYSLKVLLSYHGWMFTEHGKMSRATKIWMGMVKIFSGRKPMLYSFQTSLPRLPVPAVKDTVNRYLQSVRPLMKEEDFKRMTALAQDFAVGLGPRLQWYLKLKSWWATNYVSDWWEEYIYLRGRGPLMVNSNYYAMDLLYILPTHIQAARAGNAIHAILLYRRKLDREEIKPIRLLGSTIPLCSAQWERMFNTSRIP-----GEETDTIQHMRDSKHIVVYHRGRYFKVWLYHDGRLLKPREMEQQMQRILDNTSEPQPGEARLAALTAGDRVPWARCRQAYFGRGKNKQSLDAVEKAAFFVTLDETEEGYRSEDPDTSMDSYAKSLLHGRCYDRWFDKSFTFVVFKNGKMGLNAEHSWADAPIVAHLWEYVMSIDSL--QLGYAEDGHCKGDINPNIPYPTRLQWDIPGECQEVIETSLNTANLLANDVDFHSFPFVAFGKGIIKKCRTSPDAFVQLALQLAHYKDMGKFCLTYEASMTRLFREGRTETVRSCTTESCDFVRAMVDPAQTVEQRLKLFKLASEKHQHMYRLAMTGSGIDRHLFCLYVVSKYLAVESPFLKEVLSEPWRLSTSQTPQQQVELFDLENNPEYVSSGGGFGPVADDGYGVSYILVGENLINFHISSKFSCPETDSHRFGRHLKEAMTDIITLFG 766          
BLAST of Carnitine O-palmitoyltransferase 1, liver isoform vs. Ensembl Human
Match: CPT1A (carnitine palmitoyltransferase 1A [Source:HGNC Symbol;Acc:HGNC:2328])

HSP 1 Score: 739.184 bits (1907), Expect = 0.000e+0
Identity = 369/773 (47.74%), Postives = 509/773 (65.85%), Query Frame = 3
Query:  165 MAEAHQAVAFSIKVSDDGIDWSLNFKAFKEIAKSGVKSWKKGLYRIQNRFYNGLYPSQPGNWLGIVCGVFASSMVGFDLSFGLIEKIEVQLQRVLELESPRDHLIASLMYSCGLWTAGVIVRKYTLSNLLYYMDWMYESQTGPSMKTKAWMVLVTILGGGNPKLYSYQGXXXXXXXXXXXXTINKFLTSMEPLLSXXXXXXXXXXXXXXXXQHGFKIQFYLHLKYLWSSNYVSDWWEEFVYLSSRSSLMINSNYYGMDALMLRHEWIQAARAANLICASVQFMRELNTEELEPLVIQGK-VPLCSRQYERMFCTVRVPRNISRKNRSDQLVHYRESRYIVVICRGNYYKVNFMKGDQYLDPVDMEKQFQNILDTAVQPNDPSQYIGVLTAGERNQWAINRESFFKDGCNKESLEIIEKAAFMLVLEDEFQDYNPND-ESKLDAFGHSLLHGKGHDRWYDKSFNMVVFKNGRVGFNAEHSWADAPIMAHYWEYILLEDILSPKFGYTPDGHCRGVGKSNNISPQKLQWKLSKMIELEIEKCLLTTSKLIEDIDLHIVPFSEFGRGFMKTCKVSPDGFIQMALQLAYYRDSESFCLTYEACMTRLFREGRTETVRSCSNASCEFVRSMENKDLSNSDKINYLQLASNKHQKLYRDAMTGKGVDRHIFCMYVISKYLNIESEFLQKALSVPWKLSTSQTPHTQLTKFDMRRYPNFLSAGGGFGPVTSDGYGVSYMMAGEDIIFFHISSNISCQKTDSKRFANNLCQALLDIKKLFN 2477
            MAEAHQAVAF   V+ DGID  L+ +A ++I  SG+ SWKK   R +N    G+YP+ P +WL +V GV  +     D S G+I KI   L+    + S   ++++ +++  GLW A ++  +Y+L  LL Y  WM+      S  TK WM +V I  G  P LYS+Q SLP+LP+P +  T+N++L S+ PL+ EE++  +  LA +F    G ++Q+YL LK  W++NYVSDWWEE++YL  R  LM+NSNYY MD L +    IQAARA N I A + + R+L+ EE++P+ + G  +PLCS Q+ERMF T R+P        +D + H R+S++IVV  RG Y+KV      + L P +ME+Q Q ILD   +P      +  LTAG+R  WA  R+++F  G NK+SL+ +EKAAF + L++  + Y   D ++ +D++  SLLHG+ +DRW+DKSF  VVFKNG++G NAEHSWADAPI+AH WEY++  D L  + GY  DGHC+G    N   P +LQW +    +  IE  L T + L  D+D H  PF  FG+G +K C+ SPD F+Q+ALQLA+Y+D   FCLTYEA MTRLFREGRTETVRSC+  SC+FVR+M +   +   ++   +LAS KHQ +YR AMTG G+DRH+FC+YV+SKYL +ES FL++ LS PW+LSTSQTP  Q+  FD+   P ++S+GGGFGPV  DGYGVSY++ GE++I FHISS  SC +TDS RF  +L +A+ DI  LF 
Sbjct:    1 MAEAHQAVAFQFTVTPDGIDLRLSHEALRQIYLSGLHSWKKKFIRFKNGIITGVYPASPSSWLIVVVGVMTTMYAKIDPSLGIIAKINRTLETANCMSSQTKNVVSGVLFGTGLWVALIVTMRYSLKVLLSYHGWMFTEHGKMSRATKIWMGMVKIFSGRKPMLYSFQTSLPRLPVPAVKDTVNRYLQSVRPLMKEEDFKRMTALAQDFAVGLGPRLQWYLKLKSWWATNYVSDWWEEYIYLRGRGPLMVNSNYYAMDLLYILPTHIQAARAGNAIHAILLYRRKLDREEIKPIRLLGSTIPLCSAQWERMFNTSRIP-----GEETDTIQHMRDSKHIVVYHRGRYFKVWLYHDGRLLKPREMEQQMQRILDNTSEPQPGEARLAALTAGDRVPWARCRQAYFGRGKNKQSLDAVEKAAFFVTLDETEEGYRSEDPDTSMDSYAKSLLHGRCYDRWFDKSFTFVVFKNGKMGLNAEHSWADAPIVAHLWEYVMSIDSL--QLGYAEDGHCKGDINPNIPYPTRLQWDIPGECQEVIETSLNTANLLANDVDFHSFPFVAFGKGIIKKCRTSPDAFVQLALQLAHYKDMGKFCLTYEASMTRLFREGRTETVRSCTTESCDFVRAMVDPAQTVEQRLKLFKLASEKHQHMYRLAMTGSGIDRHLFCLYVVSKYLAVESPFLKEVLSEPWRLSTSQTPQQQVELFDLENNPEYVSSGGGFGPVADDGYGVSYILVGENLINFHISSKFSCPETDSHRFGRHLKEAMTDIITLFG 766          
BLAST of Carnitine O-palmitoyltransferase 1, liver isoform vs. Ensembl Human
Match: CPT1A (carnitine palmitoyltransferase 1A [Source:HGNC Symbol;Acc:HGNC:2328])

HSP 1 Score: 719.924 bits (1857), Expect = 0.000e+0
Identity = 359/752 (47.74%), Postives = 496/752 (65.96%), Query Frame = 3
Query:  165 MAEAHQAVAFSIKVSDDGIDWSLNFKAFKEIAKSGVKSWKKGLYRIQNRFYNGLYPSQPGNWLGIVCGVFASSMVGFDLSFGLIEKIEVQLQRVLELESPRDHLIASLMYSCGLWTAGVIVRKYTLSNLLYYMDWMYESQTGPSMKTKAWMVLVTILGGGNPKLYSYQGXXXXXXXXXXXXTINKFLTSMEPLLSXXXXXXXXXXXXXXXXQHGFKIQFYLHLKYLWSSNYVSDWWEEFVYLSSRSSLMINSNYYGMDALMLRHEWIQAARAANLICASVQFMRELNTEELEPLVIQGK-VPLCSRQYERMFCTVRVPRNISRKNRSDQLVHYRESRYIVVICRGNYYKVNFMKGDQYLDPVDMEKQFQNILDTAVQPNDPSQYIGVLTAGERNQWAINRESFFKDGCNKESLEIIEKAAFMLVLEDEFQDYNPND-ESKLDAFGHSLLHGKGHDRWYDKSFNMVVFKNGRVGFNAEHSWADAPIMAHYWEYILLEDILSPKFGYTPDGHCRGVGKSNNISPQKLQWKLSKMIELEIEKCLLTTSKLIEDIDLHIVPFSEFGRGFMKTCKVSPDGFIQMALQLAYYRDSESFCLTYEACMTRLFREGRTETVRSCSNASCEFVRSMENKDLSNSDKINYLQLASNKHQKLYRDAMTGKGVDRHIFCMYVISKYLNIESEFLQKALSVPWKLSTSQTPHTQLTKFDMRRYPNFLSAGGGFGPVTSDGYGVSYMMAGEDIIFFHISSNISCQKT 2414
            MAEAHQAVAF   V+ DGID  L+ +A ++I  SG+ SWKK   R +N    G+YP+ P +WL +V GV  +     D S G+I KI   L+    + S   ++++ +++  GLW A ++  +Y+L  LL Y  WM+      S  TK WM +V I  G  P LYS+Q SLP+LP+P +  T+N++L S+ PL+ EE++  +  LA +F    G ++Q+YL LK  W++NYVSDWWEE++YL  R  LM+NSNYY MD L +    IQAARA N I A + + R+L+ EE++P+ + G  +PLCS Q+ERMF T R+P        +D + H R+S++IVV  RG Y+KV      + L P +ME+Q Q ILD   +P      +  LTAG+R  WA  R+++F  G NK+SL+ +EKAAF + L++  + Y   D ++ +D++  SLLHG+ +DRW+DKSF  VVFKNG++G NAEHSWADAPI+AH WEY++  D L  + GY  DGHC+G    N   P +LQW +    +  IE  L T + L  D+D H  PF  FG+G +K C+ SPD F+Q+ALQLA+Y+D   FCLTYEA MTRLFREGRTETVRSC+  SC+FVR+M +   +   ++   +LAS KHQ +YR AMTG G+DRH+FC+YV+SKYL +ES FL++ LS PW+LSTSQTP  Q+  FD+   P ++S+GGGFGPV  DGYGVSY++ GE++I FHISS  SC +T
Sbjct:    1 MAEAHQAVAFQFTVTPDGIDLRLSHEALRQIYLSGLHSWKKKFIRFKNGIITGVYPASPSSWLIVVVGVMTTMYAKIDPSLGIIAKINRTLETANCMSSQTKNVVSGVLFGTGLWVALIVTMRYSLKVLLSYHGWMFTEHGKMSRATKIWMGMVKIFSGRKPMLYSFQTSLPRLPVPAVKDTVNRYLQSVRPLMKEEDFKRMTALAQDFAVGLGPRLQWYLKLKSWWATNYVSDWWEEYIYLRGRGPLMVNSNYYAMDLLYILPTHIQAARAGNAIHAILLYRRKLDREEIKPIRLLGSTIPLCSAQWERMFNTSRIP-----GEETDTIQHMRDSKHIVVYHRGRYFKVWLYHDGRLLKPREMEQQMQRILDNTSEPQPGEARLAALTAGDRVPWARCRQAYFGRGKNKQSLDAVEKAAFFVTLDETEEGYRSEDPDTSMDSYAKSLLHGRCYDRWFDKSFTFVVFKNGKMGLNAEHSWADAPIVAHLWEYVMSIDSL--QLGYAEDGHCKGDINPNIPYPTRLQWDIPGECQEVIETSLNTANLLANDVDFHSFPFVAFGKGIIKKCRTSPDAFVQLALQLAHYKDMGKFCLTYEASMTRLFREGRTETVRSCTTESCDFVRAMVDPAQTVEQRLKLFKLASEKHQHMYRLAMTGSGIDRHLFCLYVVSKYLAVESPFLKEVLSEPWRLSTSQTPQQQVELFDLENNPEYVSSGGGFGPVADDGYGVSYILVGENLINFHISSKFSCPET 745          
BLAST of Carnitine O-palmitoyltransferase 1, liver isoform vs. Ensembl Human
Match: CPT1A (carnitine palmitoyltransferase 1A [Source:HGNC Symbol;Acc:HGNC:2328])

HSP 1 Score: 719.924 bits (1857), Expect = 0.000e+0
Identity = 359/752 (47.74%), Postives = 496/752 (65.96%), Query Frame = 3
Query:  165 MAEAHQAVAFSIKVSDDGIDWSLNFKAFKEIAKSGVKSWKKGLYRIQNRFYNGLYPSQPGNWLGIVCGVFASSMVGFDLSFGLIEKIEVQLQRVLELESPRDHLIASLMYSCGLWTAGVIVRKYTLSNLLYYMDWMYESQTGPSMKTKAWMVLVTILGGGNPKLYSYQGXXXXXXXXXXXXTINKFLTSMEPLLSXXXXXXXXXXXXXXXXQHGFKIQFYLHLKYLWSSNYVSDWWEEFVYLSSRSSLMINSNYYGMDALMLRHEWIQAARAANLICASVQFMRELNTEELEPLVIQGK-VPLCSRQYERMFCTVRVPRNISRKNRSDQLVHYRESRYIVVICRGNYYKVNFMKGDQYLDPVDMEKQFQNILDTAVQPNDPSQYIGVLTAGERNQWAINRESFFKDGCNKESLEIIEKAAFMLVLEDEFQDYNPND-ESKLDAFGHSLLHGKGHDRWYDKSFNMVVFKNGRVGFNAEHSWADAPIMAHYWEYILLEDILSPKFGYTPDGHCRGVGKSNNISPQKLQWKLSKMIELEIEKCLLTTSKLIEDIDLHIVPFSEFGRGFMKTCKVSPDGFIQMALQLAYYRDSESFCLTYEACMTRLFREGRTETVRSCSNASCEFVRSMENKDLSNSDKINYLQLASNKHQKLYRDAMTGKGVDRHIFCMYVISKYLNIESEFLQKALSVPWKLSTSQTPHTQLTKFDMRRYPNFLSAGGGFGPVTSDGYGVSYMMAGEDIIFFHISSNISCQKT 2414
            MAEAHQAVAF   V+ DGID  L+ +A ++I  SG+ SWKK   R +N    G+YP+ P +WL +V GV  +     D S G+I KI   L+    + S   ++++ +++  GLW A ++  +Y+L  LL Y  WM+      S  TK WM +V I  G  P LYS+Q SLP+LP+P +  T+N++L S+ PL+ EE++  +  LA +F    G ++Q+YL LK  W++NYVSDWWEE++YL  R  LM+NSNYY MD L +    IQAARA N I A + + R+L+ EE++P+ + G  +PLCS Q+ERMF T R+P        +D + H R+S++IVV  RG Y+KV      + L P +ME+Q Q ILD   +P      +  LTAG+R  WA  R+++F  G NK+SL+ +EKAAF + L++  + Y   D ++ +D++  SLLHG+ +DRW+DKSF  VVFKNG++G NAEHSWADAPI+AH WEY++  D L  + GY  DGHC+G    N   P +LQW +    +  IE  L T + L  D+D H  PF  FG+G +K C+ SPD F+Q+ALQLA+Y+D   FCLTYEA MTRLFREGRTETVRSC+  SC+FVR+M +   +   ++   +LAS KHQ +YR AMTG G+DRH+FC+YV+SKYL +ES FL++ LS PW+LSTSQTP  Q+  FD+   P ++S+GGGFGPV  DGYGVSY++ GE++I FHISS  SC +T
Sbjct:    1 MAEAHQAVAFQFTVTPDGIDLRLSHEALRQIYLSGLHSWKKKFIRFKNGIITGVYPASPSSWLIVVVGVMTTMYAKIDPSLGIIAKINRTLETANCMSSQTKNVVSGVLFGTGLWVALIVTMRYSLKVLLSYHGWMFTEHGKMSRATKIWMGMVKIFSGRKPMLYSFQTSLPRLPVPAVKDTVNRYLQSVRPLMKEEDFKRMTALAQDFAVGLGPRLQWYLKLKSWWATNYVSDWWEEYIYLRGRGPLMVNSNYYAMDLLYILPTHIQAARAGNAIHAILLYRRKLDREEIKPIRLLGSTIPLCSAQWERMFNTSRIP-----GEETDTIQHMRDSKHIVVYHRGRYFKVWLYHDGRLLKPREMEQQMQRILDNTSEPQPGEARLAALTAGDRVPWARCRQAYFGRGKNKQSLDAVEKAAFFVTLDETEEGYRSEDPDTSMDSYAKSLLHGRCYDRWFDKSFTFVVFKNGKMGLNAEHSWADAPIVAHLWEYVMSIDSL--QLGYAEDGHCKGDINPNIPYPTRLQWDIPGECQEVIETSLNTANLLANDVDFHSFPFVAFGKGIIKKCRTSPDAFVQLALQLAHYKDMGKFCLTYEASMTRLFREGRTETVRSCTTESCDFVRAMVDPAQTVEQRLKLFKLASEKHQHMYRLAMTGSGIDRHLFCLYVVSKYLAVESPFLKEVLSEPWRLSTSQTPQQQVELFDLENNPEYVSSGGGFGPVADDGYGVSYILVGENLINFHISSKFSCPET 745          
BLAST of Carnitine O-palmitoyltransferase 1, liver isoform vs. Ensembl Human
Match: CPT1B (carnitine palmitoyltransferase 1B [Source:HGNC Symbol;Acc:HGNC:2329])

HSP 1 Score: 714.146 bits (1842), Expect = 0.000e+0
Identity = 362/773 (46.83%), Postives = 510/773 (65.98%), Query Frame = 3
Query:  165 MAEAHQAVAFSIKVSDDGIDWSLNFKAFKEIAKSGVKSWKKGLYRIQNRFYNGLYPSQPGNWLGIVCGVFASSMVGFDLSFGLIEKIEVQL-QRVLELESPRDHLIASL-MYSCGLWTAGVIVRKYTLSNLLYYMDWMYESQTGPSMKTKAWMVLVTILGGGNPKLYSYQGXXXXXXXXXXXXTINKFLTSMEPLLSXXXXXXXXXXXXXXXXQHGFKIQFYLHLKYLWSSNYVSDWWEEFVYLSSRSSLMINSNYYGMDALMLRHEWIQAARAANLICASVQFMRELNTEELEPLVIQGKVPLCSRQYERMFCTVRVPRNISRKNRSDQLVHYRESRYIVVICRGNYYKVNFMKGDQYLDPVDMEKQFQNILDTAVQPNDPSQYIGVLTAGERNQWAINRESFFKDGCNKESLEIIEKAAFMLVLEDEFQDYNPNDESKLDAFGHSLLHGKGHDRWYDKSFNMVVFKNGRVGFNAEHSWADAPIMAHYWEYILLEDILSPKFGYTPDGHCRGVGKSNNISPQKLQWKLSKMIELEIEKCLLTTSKLIEDIDLHIVPFSEFGRGFMKTCKVSPDGFIQMALQLAYYRDSESFCLTYEACMTRLFREGRTETVRSCSNASCEFVRSMENKDLSNSDKINYLQLASNKHQKLYRDAMTGKGVDRHIFCMYVISKYLNIESEFLQKALSVPWKLSTSQTPHTQLTKFDMRRYPNFLSAGGGFGPVTSDGYGVSYMMAGEDIIFFHISSNISCQKTDSKRFANNLCQALLDIKKLFN 2477
            MAEAHQAVAF   V+ DG+D+ L+ +A K +  SG+ SWKK L RI+N    G+YP  P +WL ++     SS    D+S GL+  I+  L Q     ++P+   + S+ ++S G+W  G+   + TL  LL Y  WM+E     S  T+ W + + +L   +P LYS+Q SLPKLP+PR+S+TI ++L S+ PLL +EEY+ ++ LA EF+ +   ++Q YL LK  W+SNYVSDWWEE++YL  RS LM+NSNYY MD +++++  +QAAR  N+I A + + R+L+ EE++P++  G VP+CS Q ERMF T R+P        +D L H  +SR++ V  +G ++K+   +G + L P D+E QFQ ILD    P    + +  LTAG R +WA  R++FF  G NK +LE IE+AAF + L++E   Y+P DE+ L  +G +LLHG  ++RW+DKSF ++ FKNG++G NAEH+WADAPI+ H WE++L  D  S   GYT  GHC G        P +LQW + K  +  IE        L +D++L+   F  FG+G +K C+ SPD F+Q+ALQLA++RD   FCLTYEA MTR+FREGRTETVRSC++ S  FV++M     + +D  +  Q A+ KHQ +YR AMTG G+DRH+FC+Y++SKYL + S FL + LS PW+LSTSQ P +Q+  FD  ++PN L AGGGFGPV  DGYGVSYM+AGE+ IFFHISS  S  +T+++RF N++ +ALLDI  LF 
Sbjct:    1 MAEAHQAVAFQFTVTPDGVDFRLSREALKHVYLSGINSWKKRLIRIKNGILRGVYPGSPTSWLVVIMATVGSSFCNVDISLGLVSCIQRCLPQGCGPYQTPQTRALLSMAIFSTGVWVTGIFFFRQTLKLLLCYHGWMFEMHGKTSNLTRIWAMCIRLLSSRHPMLYSFQTSLPKLPVPRVSATIQRYLESVRPLLDDEEYYRMELLAKEFQDKTAPRLQKYLVLKSWWASNYVSDWWEEYIYLRGRSPLMVNSNYYVMDLVLIKNTDVQAARLGNIIHAMIMYRRKLDREEIKPVMALGIVPMCSYQMERMFNTTRIP-----GKDTDVLQHLSDSRHVAVYHKGRFFKLWLYEGARLLKPQDLEMQFQRILDDPSPPQPGEEKLAALTAGGRVEWAQARQAFFSSGKNKAALEAIERAAFFVALDEESYSYDPEDEASLSLYGKALLHGNCYNRWFDKSFTLISFKNGQLGLNAEHAWADAPIIGHLWEFVLGTD--SFHLGYTETGHCLGKPNPALAPPTRLQWDIPKQCQAVIESSYQVAKALADDVELYCFQFLPFGKGLIKKCRTSPDAFVQIALQLAHFRDRGKFCLTYEASMTRMFREGRTETVRSCTSESTAFVQAMMEGSHTKADLRDLFQKAAKKHQNMYRLAMTGAGIDRHLFCLYLVSKYLGVSSPFLAEVLSEPWRLSTSQIPQSQIRMFDPEQHPNHLGAGGGFGPVADDGYGVSYMIAGENTIFFHISSKFSSSETNAQRFGNHIRKALLDIADLFQ 766          
BLAST of Carnitine O-palmitoyltransferase 1, liver isoform vs. Ensembl Celegans
Match: cpt-1 (Carnitine Palmitoyl Transferase [Source:UniProtKB/TrEMBL;Acc:Q9U2F2])

HSP 1 Score: 618.616 bits (1594), Expect = 0.000e+0
Identity = 344/789 (43.60%), Postives = 497/789 (62.99%), Query Frame = 3
Query:  165 MAEAHQAVAFSIKVSDDGIDWSLNFKAFKEIAKSGVKSWKKGLYRIQNRFYNGLYPSQPGNW-LGIVCGVFAS-SMVGFDLSFGLIEKIEVQLQRVLELESPRDHLIASLMYSCGLWTAGVIVRKYTLSNLLYYMDWMYESQTGP-SMKTKAWMVLVTILGGGNPKLYSYQGXXXXXXXXXXXXTINKFLTSMEPLLSXXXXXXXXXXXXXXXXQHGFKIQFYLHLKYLWSSNYVSDWWEEFVYLSSRSSLMINSNYYGMDALMLRHEWIQAARAANLICASVQFMRELNTEELEPLVI--QGKVPLCSRQYERMFCTVRVPRNISRKNRSDQLVHYRESRYIVVICRGNYYKVNFMKGDQYLDPVDMEKQFQNILDTAVQPNDPSQYIGVLTAGERNQWAINRESFFKDGCNKESLEIIEKAAFMLVLEDEFQDYNPNDESKLDAFGHSLLHGKGHDRWYDKSFNMVVFKNGRVGFNAEHSWADAPIMAHYWEYILLEDILSPKFGYTPDGHCRGVGKSNNISPQKLQWKLSKMIELEIEKCLLTTSKLIEDIDLHIVPFSEFGRGFMKTCKVSPDGFIQMALQLAYYRDSESFCLTYEACMTRLFREGRTETVRSCSNASCEFVRSMENKDLSNSDKINYLQLASNKHQKLYRDAMTGKGVDRHIFCMYVISKYLNIESEFLQKALSVPWKLSTSQTPHTQLTKFDMRRYPN-----FLSAGGGFGPVTSDGYGVSYMMAGEDIIFFHISSNISCQKTDSKRFANNLCQALLDIKKLFNPLDSSGDK 2501
            MAEA  A A S  V+ DG+  S + +  ++I     +S+K+   R +N F NG++P+   +W LG+V G  A  S++  DLSFG+   I+  +   +  +      I+  +    LW   V + + ++  LL Y  WMYES   P S  TK W+ ++ I+    P L+S+QG+LP+LPLP L  T+ K L SM+P+LS+EE+ EL+ L+  F+K  G ++Q YL LK  +SSNYV+DWWEEFVY+  RS +MINSNYYG D L       QA+RAANL   S+QF R ++ +E+ P  I  + KVP C+ QYER+F T RVP         D+L+H+ ++++I V CRG ++K+    G + L+  +++ Q+  IL    +P++   ++  LTAGER  WA  R + F+ G NK SL  IE+AAF+++L+DE   Y+P D SKLD + H+LLHGK HDRW+DKSFN+++ KNG VG N EHSW DA +MAH+ E+ LL+DI+    GY  +G C+G  K   ++P++L+W++      +I K +   + LI D+++ ++ ++++G+GF K  KVSPD F+QM LQ  Y+++   F LTYEA MTRLFREGRTETVRSC+  S +FVRSM +   +  D++  L+ A +KHQ+LYRDAM G+GVDRH+F +YVI +YL  ES F        + LSTSQTP  Q  + D +   N      ++AGGGFGPV   GYGVSY++AGED + FHISS  S   T S+ F   L ++L D+KKL   +++   K
Sbjct:    1 MAEARSAAALSFAVTHDGVSVSYDQELLRDIWHGISRSYKRRTGRFRNDFMNGMFPAN--SWTLGLVVGAVAVFSVIKHDLSFGIFPFIQNYIVHYIFGDGYLGQSISIAVAGALLWLIFVQLLRLSIKTLLEYKGWMYESPGKPVSKATKLWLGVLHIISKAGPMLHSFQGALPRLPLPNLDDTVRKHLLSMKPILSDEEFQELEFLSERFRKGVGRRLQRYLTLKSWFSSNYVTDWWEEFVYMRQRSPIMINSNYYGFDTLNEHPTQNQASRAANLTYTSLQFRRMVDRQEVSPFSISPRTKVPFCTMQYERLFNTCRVP-----GEEVDRLLHWDDAKHIAVYCRGVWFKLIVHNGKRLLEACELQVQYDAILAHTHEPSEGEMHLASLTAGERADWAKTRRAHFRSGVNKTSLNDIERAAFVVILDDEETHYDPQDPSKLDHWAHNLLHGKAHDRWFDKSFNLIISKNGHVGINTEHSWGDAAVMAHFTEWSLLQDIVF--IGYDENGRCKGEPK-EKLTPERLKWEIPAPALDQIRKSMEVANALIADVEMSLLVWTDYGKGFAKKLKVSPDAFLQMTLQYTYFKNQNKFSLTYEASMTRLFREGRTETVRSCTVQSSDFVRSMLDASKTPQDRLQLLRKACDKHQELYRDAMCGQGVDRHLFALYVIKRYLEEESPFFDNIFPPTYLLSTSQTPMNQ-CEADAKGLSNEVRLRLITAGGGFGPVADRGYGVSYIVAGEDTLSFHISSKRSADNTSSREFREELKRSLNDMKKLAEAIEAPKKK 778          
BLAST of Carnitine O-palmitoyltransferase 1, liver isoform vs. Ensembl Celegans
Match: W03F9.4 (pep chromosome:WBcel235:V:147538:151388:-1 gene:WBGene00021002.1 transcript:W03F9.4b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:W03F9.4)

HSP 1 Score: 392.504 bits (1007), Expect = 3.130e-125
Identity = 242/649 (37.29%), Postives = 371/649 (57.16%), Query Frame = 3
Query:  549 LLYYMDWMYES-QTGPSMKTKAWMVLVTILGGGNPKLYSYQGXXXXXXXXXXXXTINKFLTSMEPLLSXXXXXXXXXXXXXXXXQHGFKIQFYLHLKYLWSSNYVSDWWEEFVYLSSRSSLMINSNYYGMDALMLRHEWIQAARAANLICASVQFMREL-NTEELEPLVIQGKVPLCSRQYERMFCTVRVPRNISRKNRSDQLVHYRESRYIVVICRGNYYKVNFMKGDQYLDPVDMEKQFQNILDTAVQPNDPSQ-YIGVLTAGERNQWA-INRESFFKDGCNKESLEIIEKAAFMLVLEDEFQDYNPNDESKLDAFGHSLLHGKGHDRWYDKSFNMVVFKNGRVGFNAEHSWADAPIMAHYWEYILLEDILSPKFGYTPDGHCRGVGKSNNI-SPQKLQWKLSKMIELEIEKCLLTTSKLIEDIDLHIVPFSEFGRGFMKTCKVSPDGFIQMALQLAYYRDSESFCLTYEACMTRLFREGRTETVRSCSNASCEFVRSMENKDLSNSDKINYLQLASNKHQKLYRDAMTGKGVDRHIFCMYVISKYLNIESEFLQKALSVPWKLSTSQTPHTQLTKF--DMRRYPNFLSAGGGFGPVTSDGYGVSYMMAGE-DIIFFHISSNISCQKTDSKRFANNLCQALLDIKKL 2471
            +LYY  W++E     PS  T A+ V++  +       +SYQG LP L  P++  T+ K+L +M+P+L E+E+ EL + A EFK      +Q  L +K+  S NY+SDWW+E VY+  R SL I +N    D +  +    QAARAA +      F  ++  +E+++P+ + G +PLC++QY   + T+R+P   S     D+++   ++++I V  +G +YK++   G + + P ++EK FQ ILD+    +   + Y+  LT G R+ WA I  E F K G N+ESL  IE +  ++ L++E + ++ +D +K        LHG G+  W DK    +  KNGR   NAEHS  DA I     EYI   +     +G  PDGHC  VG   ++   ++L W + K     I++  + +  + +D     V F+E+G+ FMK  KVSPD +IQMALQ+AY++D   F  TYE  + RLF+EGRTETVRSCS  SC+FVR+M  KD+    K+  L+ A + HQ  YR AM GKGVDRH+F +YV+++YL I++ FL+      W LSTSQTP  Q+ ++   + + P+     GGF       YGV Y +    D + FH+++  S + TDS RF  ++ ++L +IK +
Sbjct:    2 MLYYNGWLFEEIGKKPSYATTAFFVILGFISK-RATFFSYQGILPWLLPPKVEDTVAKYLQTMKPILGEKEFLELSEQAEEFKSTIAGGLQNKLWMKWAVSKNYLSDWWKEVVYMRYRDSL-IRTNVGCADVIYQKTTSNQAARAAYVTLNRQHFCNDIFKSEKMKPVSL-GGIPLCAQQYAEYYRTLRIPHETS-----DKMIRLPDAKHIAVYHKGCWYKIDIFHGKRMVKPSELEKSFQEILDSNDHISQQGEKYLSALTIGPRDLWARIRTEKFSKGGVNQESLSFIENSLEIVFLDEEERFFDEDDSTKYGREYARALHGDGYMLWCDKPSVYIFSKNGRFSSNAEHSPCDAMIYVQVREYIKYHEQFESPYG--PDGHC--VGSIEHVPKAERLCWDMDKETLDAIDEAFIISKGVADDFSNANVVFTEYGKDFMKKAKVSPDAYIQMALQMAYFKDQGKFEQTYEPAVMRLFKEGRTETVRSCSIWSCDFVRTMLKKDVGAGKKLEKLKEACDHHQDYYRTAMAGKGVDRHLFALYVVARYLEIKTPFLENVFGRNWSLSTSQTPQHQMVEYAKALNKEPSLFWPAGGFACPDGSNYGVCYTIGTTGDRMSFHVTTWNSLENTDSARFLKHILESLREIKDV 638          
BLAST of Carnitine O-palmitoyltransferase 1, liver isoform vs. Ensembl Celegans
Match: W03F9.4 (pep chromosome:WBcel235:V:147538:152104:-1 gene:WBGene00021002.1 transcript:W03F9.4a.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:W03F9.4)

HSP 1 Score: 394.045 bits (1011), Expect = 1.227e-124
Identity = 247/674 (36.65%), Postives = 383/674 (56.82%), Query Frame = 3
Query:  474 LIASLMYSCGLWTAGVIVRKYTLSNLLYYMDWMYES-QTGPSMKTKAWMVLVTILGGGNPKLYSYQGXXXXXXXXXXXXTINKFLTSMEPLLSXXXXXXXXXXXXXXXXQHGFKIQFYLHLKYLWSSNYVSDWWEEFVYLSSRSSLMINSNYYGMDALMLRHEWIQAARAANLICASVQFMREL-NTEELEPLVIQGKVPLCSRQYERMFCTVRVPRNISRKNRSDQLVHYRESRYIVVICRGNYYKVNFMKGDQYLDPVDMEKQFQNILDTAVQPNDPSQ-YIGVLTAGERNQWA-INRESFFKDGCNKESLEIIEKAAFMLVLEDEFQDYNPNDESKLDAFGHSLLHGKGHDRWYDKSFNMVVFKNGRVGFNAEHSWADAPIMAHYWEYILLEDILSPKFGYTPDGHCRGVGKSNNI-SPQKLQWKLSKMIELEIEKCLLTTSKLIEDIDLHIVPFSEFGRGFMKTCKVSPDGFIQMALQLAYYRDSESFCLTYEACMTRLFREGRTETVRSCSNASCEFVRSMENKDLSNSDKINYLQLASNKHQKLYRDAMTGKGVDRHIFCMYVISKYLNIESEFLQKALSVPWKLSTSQTPHTQLTKF--DMRRYPNFLSAGGGFGPVTSDGYGVSYMMAGE-DIIFFHISSNISCQKTDSKRFANNLCQALLDIKKL 2471
            L++ L+ +    T   ++R  +L  +LYY  W++E     PS  T A+ V++  +       +SYQG LP L  P++  T+ K+L +M+P+L E+E+ EL + A EFK      +Q  L +K+  S NY+SDWW+E VY+  R SL I +N    D +  +    QAARAA +      F  ++  +E+++P+ + G +PLC++QY   + T+R+P   S     D+++   ++++I V  +G +YK++   G + + P ++EK FQ ILD+    +   + Y+  LT G R+ WA I  E F K G N+ESL  IE +  ++ L++E + ++ +D +K        LHG G+  W DK    +  KNGR   NAEHS  DA I     EYI   +     +G  PDGHC  VG   ++   ++L W + K     I++  + +  + +D     V F+E+G+ FMK  KVSPD +IQMALQ+AY++D   F  TYE  + RLF+EGRTETVRSCS  SC+FVR+M  KD+    K+  L+ A + HQ  YR AM GKGVDRH+F +YV+++YL I++ FL+      W LSTSQTP  Q+ ++   + + P+     GGF       YGV Y +    D + FH+++  S + TDS RF  ++ ++L +IK +
Sbjct:   79 LVSLLIGTVTALTVITVIR-CSLIMMLYYNGWLFEEIGKKPSYATTAFFVILGFISK-RATFFSYQGILPWLLPPKVEDTVAKYLQTMKPILGEKEFLELSEQAEEFKSTIAGGLQNKLWMKWAVSKNYLSDWWKEVVYMRYRDSL-IRTNVGCADVIYQKTTSNQAARAAYVTLNRQHFCNDIFKSEKMKPVSL-GGIPLCAQQYAEYYRTLRIPHETS-----DKMIRLPDAKHIAVYHKGCWYKIDIFHGKRMVKPSELEKSFQEILDSNDHISQQGEKYLSALTIGPRDLWARIRTEKFSKGGVNQESLSFIENSLEIVFLDEEERFFDEDDSTKYGREYARALHGDGYMLWCDKPSVYIFSKNGRFSSNAEHSPCDAMIYVQVREYIKYHEQFESPYG--PDGHC--VGSIEHVPKAERLCWDMDKETLDAIDEAFIISKGVADDFSNANVVFTEYGKDFMKKAKVSPDAYIQMALQMAYFKDQGKFEQTYEPAVMRLFKEGRTETVRSCSIWSCDFVRTMLKKDVGAGKKLEKLKEACDHHQDYYRTAMAGKGVDRHLFALYVVARYLEIKTPFLENVFGRNWSLSTSQTPQHQMVEYAKALNKEPSLFWPAGGFACPDGSNYGVCYTIGTTGDRMSFHVTTWNSLENTDSARFLKHILESLREIKDV 739          
BLAST of Carnitine O-palmitoyltransferase 1, liver isoform vs. Ensembl Celegans
Match: W03F9.4 (pep chromosome:WBcel235:V:147538:151388:-1 gene:WBGene00021002.1 transcript:W03F9.4a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:W03F9.4)

HSP 1 Score: 394.045 bits (1011), Expect = 1.227e-124
Identity = 247/674 (36.65%), Postives = 383/674 (56.82%), Query Frame = 3
Query:  474 LIASLMYSCGLWTAGVIVRKYTLSNLLYYMDWMYES-QTGPSMKTKAWMVLVTILGGGNPKLYSYQGXXXXXXXXXXXXTINKFLTSMEPLLSXXXXXXXXXXXXXXXXQHGFKIQFYLHLKYLWSSNYVSDWWEEFVYLSSRSSLMINSNYYGMDALMLRHEWIQAARAANLICASVQFMREL-NTEELEPLVIQGKVPLCSRQYERMFCTVRVPRNISRKNRSDQLVHYRESRYIVVICRGNYYKVNFMKGDQYLDPVDMEKQFQNILDTAVQPNDPSQ-YIGVLTAGERNQWA-INRESFFKDGCNKESLEIIEKAAFMLVLEDEFQDYNPNDESKLDAFGHSLLHGKGHDRWYDKSFNMVVFKNGRVGFNAEHSWADAPIMAHYWEYILLEDILSPKFGYTPDGHCRGVGKSNNI-SPQKLQWKLSKMIELEIEKCLLTTSKLIEDIDLHIVPFSEFGRGFMKTCKVSPDGFIQMALQLAYYRDSESFCLTYEACMTRLFREGRTETVRSCSNASCEFVRSMENKDLSNSDKINYLQLASNKHQKLYRDAMTGKGVDRHIFCMYVISKYLNIESEFLQKALSVPWKLSTSQTPHTQLTKF--DMRRYPNFLSAGGGFGPVTSDGYGVSYMMAGE-DIIFFHISSNISCQKTDSKRFANNLCQALLDIKKL 2471
            L++ L+ +    T   ++R  +L  +LYY  W++E     PS  T A+ V++  +       +SYQG LP L  P++  T+ K+L +M+P+L E+E+ EL + A EFK      +Q  L +K+  S NY+SDWW+E VY+  R SL I +N    D +  +    QAARAA +      F  ++  +E+++P+ + G +PLC++QY   + T+R+P   S     D+++   ++++I V  +G +YK++   G + + P ++EK FQ ILD+    +   + Y+  LT G R+ WA I  E F K G N+ESL  IE +  ++ L++E + ++ +D +K        LHG G+  W DK    +  KNGR   NAEHS  DA I     EYI   +     +G  PDGHC  VG   ++   ++L W + K     I++  + +  + +D     V F+E+G+ FMK  KVSPD +IQMALQ+AY++D   F  TYE  + RLF+EGRTETVRSCS  SC+FVR+M  KD+    K+  L+ A + HQ  YR AM GKGVDRH+F +YV+++YL I++ FL+      W LSTSQTP  Q+ ++   + + P+     GGF       YGV Y +    D + FH+++  S + TDS RF  ++ ++L +IK +
Sbjct:   79 LVSLLIGTVTALTVITVIR-CSLIMMLYYNGWLFEEIGKKPSYATTAFFVILGFISK-RATFFSYQGILPWLLPPKVEDTVAKYLQTMKPILGEKEFLELSEQAEEFKSTIAGGLQNKLWMKWAVSKNYLSDWWKEVVYMRYRDSL-IRTNVGCADVIYQKTTSNQAARAAYVTLNRQHFCNDIFKSEKMKPVSL-GGIPLCAQQYAEYYRTLRIPHETS-----DKMIRLPDAKHIAVYHKGCWYKIDIFHGKRMVKPSELEKSFQEILDSNDHISQQGEKYLSALTIGPRDLWARIRTEKFSKGGVNQESLSFIENSLEIVFLDEEERFFDEDDSTKYGREYARALHGDGYMLWCDKPSVYIFSKNGRFSSNAEHSPCDAMIYVQVREYIKYHEQFESPYG--PDGHC--VGSIEHVPKAERLCWDMDKETLDAIDEAFIISKGVADDFSNANVVFTEYGKDFMKKAKVSPDAYIQMALQMAYFKDQGKFEQTYEPAVMRLFKEGRTETVRSCSIWSCDFVRTMLKKDVGAGKKLEKLKEACDHHQDYYRTAMAGKGVDRHLFALYVVARYLEIKTPFLENVFGRNWSLSTSQTPQHQMVEYAKALNKEPSLFWPAGGFACPDGSNYGVCYTIGTTGDRMSFHVTTWNSLENTDSARFLKHILESLREIKDV 739          
BLAST of Carnitine O-palmitoyltransferase 1, liver isoform vs. Ensembl Celegans
Match: cpt-6 (Carnitine Palmitoyl Transferase [Source:UniProtKB/TrEMBL;Acc:Q23066])

HSP 1 Score: 320.857 bits (821), Expect = 5.426e-97
Identity = 239/740 (32.30%), Postives = 372/740 (50.27%), Query Frame = 3
Query:  294 YRIQNRFYNGLYPSQPGNWLGIVCGVFASSMVGF--DLSFGLIEKIEVQLQRVLELESPRDHLIASLMYSCGLWTAGVIVRKYTLSNLLYYMDWMYESQTGPSMKTKAWMVLVTILGGGNPKLYSYQGXXXXXXXXXXXXTINKFLTSMEPLLSXXXXXXXXXXXXXXXXQHGFKIQFYLHLKYLWSSNYVSDWWEEFVYLSSRSSLMINSNYYGMDALMLRHEWIQAARAANLICASVQFMRELNTEELEPLVIQGKVPLCSRQYERMFCTVRVPRNISRKNRSDQLVHYRESRYIVVICRGNYYKVNFMKGDQYLDPVD-MEKQFQNILDTAVQPNDPSQYIGVLTAGERNQWAINRESFFKDGC-NKESLEIIEKAAFMLVLEDEFQDYNPNDESK---LDAFGHSLLHGKGHDRWYDKSFNMVVFKNGRVGFNAEHSWADAPIMAHYWEYILLEDILSPKFGYTPDGHCRGVGKSNNISPQKLQWKLS------KMIELEIEKCLLTTSKLIEDIDLHIVPFSEFGRGFMKTCKVSPDGFIQMALQLAYYRDSESFCLTYEACMTRLFREGRTETVRSCSNASCEFVRSMENKDLSNSDKINYLQLASNKHQKLYRDAMTGKGVDRHIFCMYVISKYLNIESEFLQKALSVPWKLSTSQTPHTQLTKFDMRRYPNFLSAGGGFGPVTSDGYGVSYMMAGEDIIFFHISSNISCQKTDSKRFANNLCQALLDIKKLF 2474
            Y+  N   N L+P +P  ++     + A+    +  +    L+ K   ++  + +  +     +A++    G++T   +++ +  S    Y  +++++   P +KTK W ++  IL    P L S    LP LP+P L  TI+++L SM+ +LSE+EY  + K A EF +  G K+Q Y  +  L++ NYV+ +W+++ YL  R  LMINS+    D L+   E  +A RAA +    V     ++ ++ + L   G   +C+R Y+ M+   R P       + DQL+ +   ++IVV+ RG YYK++ +     +  V+ + K F  ++    +       I  LT   R+ W  NR+ +F     N + L+ IE A F   L DE  DY   DE K   L  F  + L G G +RW DKS N +  KN R G   EHS AD     H  E  +  D+   K+    +     V + N+    KL   L+      +M+  EI +C         D+DL+ + F +FG+G +K C VSPD FIQMA+QLA YRD   F LTYE    R F   RTET+R+ ++ SCEFV +M N + +   KI  L+ A   H    +  M G+GVDRH+F +Y++S+   I+S FL   ++  WKLSTS  P+    + D     +    G  FG V +DGYG+ Y   G   IF +I+S  S   TDS +FA  L ++  ++  LF
Sbjct:   28 YKTYNWIENTLWPIKPIPFVATTVALAATLHYKYPENAILDLLPKFGSEVAEIAKTTA-----VAAIGSYAGVFTLRKLLKHFYFS----YKGFLFDNPKKPCLKTKIWGIVRHILSISPPILESCDRLLPSLPVPALKDTISEYLDSMKHILSEQEYEIVAKQAHEFLENEGKKLQRYTWIYSLFTDNYVTSFWQKYAYLHGRYPLMINSSVAHCD-LLRDKEATRAHRAARVTWIEVMSHLAIDRQQYKAL---GDGLVCTRHYKNMYAVTREP-----GKKIDQLILHGIQKHIVVVLRGKYYKIHVVDDKNNIYTVEQLTKIFHEMISRDEKEEGVIGKIAALTHDTRDSWHRNRQKYFLGNVKNAQILKEIECAVFFFTL-DENDDYG-YDEKKPEVLSNFLANCLSGDGTNRWVDKSLNYICSKNARCGGTTEHSIADGAEFDHIMENFVYVDLEVLKYKSIEEQEKMAVIEENDKKSLKLATPLNFEVPDQEMLS-EITRCYDAHQIAKNDLDLYALAFRDFGKGRIKKCGVSPDAFIQMAIQLANYRDQGKFVLTYEPASARFFANSRTETLRTVNDHSCEFVEAMLNANETKEAKIALLKKACETHVLRNKKCMVGQGVDRHLFVLYILSQGTGIQSPFLDNYINQKWKLSTSHVPNVT-NQCDEDTDSDNTWLGACFGAVAADGYGICYRFGGNHGIFANITSYHSAANTDSTKFAKLLSESFHELSNLF 745          
BLAST of Carnitine O-palmitoyltransferase 1, liver isoform vs. Ensembl Fly
Match: whd (gene:FBgn0261862 transcript:FBtr0088308)

HSP 1 Score: 685.256 bits (1767), Expect = 0.000e+0
Identity = 355/774 (45.87%), Postives = 506/774 (65.37%), Query Frame = 3
Query:  165 MAEAHQAVAFSIKVSDDGIDWSLNFKAFKEIAKSGVKSWKKGLYRIQNRFYNGLYPSQPGNWLGIVCGVFASSMVGFDLSFGLIEKIEVQLQRVLELESPRDHLIASLMYSCGLWTAGVIVRKYTLSNLLYYMDWMYESQ---TGPSMKTKAWMVLVTILGGGN-PKLYSYQGXXXXXXXXXXXXTINKFLTSMEPLLSXXXXXXXXXXXXXXXXQHGFKIQFYLHLKYLWSSNYVSDWWEEFVYLSSRSSLMINSNYYGMDALMLRHEWIQAARAANLICASVQFMRELNTEELEPLVIQGKVPLCSRQYERMFCTVRVPRNISRKNRSDQLVHYRESRYIVVICRGNYYKVNFMKGDQYLDPVDMEKQFQNILDTAVQPNDPSQYIGVLTAGERNQWAINRESFFKDGCNKESLEIIEKAAFMLVLEDEFQDYNPNDESKLDAFGHSLLHGKGHDRWYDKSFNMVVFKNGRVGFNAEHSWADAPIMAHYWEYILLEDILSPKFGYTPDGHCRGVGKSNNISPQKLQWKLSKMIELEIEKCLLTTSKLIEDIDLHIVPFSEFGRGFMKTCKVSPDGFIQMALQLAYYRDSESFCLTYEACMTRLFREGRTETVRSCSNASCEFVRSMENKDLSNSDKINYLQLASNKHQKLYRDAMTGKGVDRHIFCMYVISKYLNIESEFLQKALSVPWKLSTSQTPHTQLTKFDMRRYPNFLSAGGGFGPVTSDGYGVSYMMAGEDIIFFHISSNISCQKTDSKRFANNLCQALLDIKKLF 2474
            MAEAH AVAFS  ++ +G D + + +    +  SGV+SWKK L R +N   NG+YP+   +   I          G+   F L  +I V L       +    + A  + +  +W +     +YTL  LL Y  WMYES+   +  S+ T  W+ +V +L   N P LYS+QGSLP+LPLP +  T+ ++L S+ PLL +E Y  +++LA EF++  G K+Q+YL LK  WS+NYVSDWWEE+VYL  RS L +NSN+YG DA+ +     QAARAAN+I   + F R +  +EL+P+++QG +PLCS QYER F T RVP        +D+++HYR+S +IVV+ +G YYK+      + L P +++ Q + IL     P +  +++  LTA  R++WA  R +FF  G N+ SL  IE AAF+L L+DE  +++      LD FG  LLHG G++RW+DK F + V  NGRVGFNAEH+WADAP++ H WEYI  +DI    +GY   G+ +G       +P +L W L   +  +IE+  +  +KLI +++L I+   ++G+GFMK C++SPD +IQMALQLAYYRD+  F LTYEA MTRLFREGRTETVR C+  S  +V++M+N + +N +++  +Q A ++HQ  Y+DAM G+G+DRH+FC+YV+SKYL ++S FL + LS PW+LSTSQTPH Q  K D++++PN +SAGGGFGPV  DGYGVSY++AGE++IFFHIS+  +CQ+TD  RFA N+ QAL DI+ +F
Sbjct:    1 MAEAHAAVAFSFAITHEGFDINYDHEVLNLVWNSGVRSWKKRLARARNGVRNGVYPAHIQSLWLISAIALGLHFAGYQAPFNLTNRILVHLPS----NTINWQVTACFLAALVVWLSICFTMRYTLKLLLMYKGWMYESRAPGSRVSLPTMLWVAVVRVLSSWNKPGLYSFQGSLPRLPLPSVKDTMTRYLRSVRPLLDDENYTRMERLAKEFEQTIGKKLQWYLILKSWWSTNYVSDWWEEYVYLRGRSPLCVNSNFYGTDAIFMNLTDKQAARAANVISLLLNFRRLIEHQELQPIMVQGMIPLCSWQYERTFNTARVP-----GLETDRIIHYRDSNHIVVLHKGCYYKMLIYYKGRILRPCELQVQIEEILKGKATPVEGEEHLAALTAWNRSKWAEARNTFFSWGVNQTSLRTIESAAFVLSLDDEPFEFDLARPELLDNFGKKLLHGNGYNRWFDKCFTVCVGTNGRVGFNAEHTWADAPVLGHLWEYIFGDDI----YGYDETGNTKGTPAFQPPTPTRLTWDLKPCLA-QIEEATIDVTKLINEVNLRILVHQDYGKGFMKKCRISPDAYIQMALQLAYYRDAGRFSLTYEASMTRLFREGRTETVRPCTIESSAWVKAMQNPNTTNDERVKMMQAACDRHQLGYQDAMCGRGIDRHLFCLYVVSKYLEVDSPFLNEVLSEPWRLSTSQTPHGQTPKMDLKKHPNCISAGGGFGPVADDGYGVSYIIAGENLIFFHISAKTTCQQTDVHRFAQNISQALSDIRSMF 760          
BLAST of Carnitine O-palmitoyltransferase 1, liver isoform vs. Ensembl Fly
Match: whd (gene:FBgn0261862 transcript:FBtr0088307)

HSP 1 Score: 685.256 bits (1767), Expect = 0.000e+0
Identity = 355/774 (45.87%), Postives = 506/774 (65.37%), Query Frame = 3
Query:  165 MAEAHQAVAFSIKVSDDGIDWSLNFKAFKEIAKSGVKSWKKGLYRIQNRFYNGLYPSQPGNWLGIVCGVFASSMVGFDLSFGLIEKIEVQLQRVLELESPRDHLIASLMYSCGLWTAGVIVRKYTLSNLLYYMDWMYESQ---TGPSMKTKAWMVLVTILGGGN-PKLYSYQGXXXXXXXXXXXXTINKFLTSMEPLLSXXXXXXXXXXXXXXXXQHGFKIQFYLHLKYLWSSNYVSDWWEEFVYLSSRSSLMINSNYYGMDALMLRHEWIQAARAANLICASVQFMRELNTEELEPLVIQGKVPLCSRQYERMFCTVRVPRNISRKNRSDQLVHYRESRYIVVICRGNYYKVNFMKGDQYLDPVDMEKQFQNILDTAVQPNDPSQYIGVLTAGERNQWAINRESFFKDGCNKESLEIIEKAAFMLVLEDEFQDYNPNDESKLDAFGHSLLHGKGHDRWYDKSFNMVVFKNGRVGFNAEHSWADAPIMAHYWEYILLEDILSPKFGYTPDGHCRGVGKSNNISPQKLQWKLSKMIELEIEKCLLTTSKLIEDIDLHIVPFSEFGRGFMKTCKVSPDGFIQMALQLAYYRDSESFCLTYEACMTRLFREGRTETVRSCSNASCEFVRSMENKDLSNSDKINYLQLASNKHQKLYRDAMTGKGVDRHIFCMYVISKYLNIESEFLQKALSVPWKLSTSQTPHTQLTKFDMRRYPNFLSAGGGFGPVTSDGYGVSYMMAGEDIIFFHISSNISCQKTDSKRFANNLCQALLDIKKLF 2474
            MAEAH AVAFS  ++ +G D + + +    +  SGV+SWKK L R +N   NG+YP+   +   I          G+   F L  +I V L       +    + A  + +  +W +     +YTL  LL Y  WMYES+   +  S+ T  W+ +V +L   N P LYS+QGSLP+LPLP +  T+ ++L S+ PLL +E Y  +++LA EF++  G K+Q+YL LK  WS+NYVSDWWEE+VYL  RS L +NSN+YG DA+ +     QAARAAN+I   + F R +  +EL+P+++QG +PLCS QYER F T RVP        +D+++HYR+S +IVV+ +G YYK+      + L P +++ Q + IL     P +  +++  LTA  R++WA  R +FF  G N+ SL  IE AAF+L L+DE  +++      LD FG  LLHG G++RW+DK F + V  NGRVGFNAEH+WADAP++ H WEYI  +DI    +GY   G+ +G       +P +L W L   +  +IE+  +  +KLI +++L I+   ++G+GFMK C++SPD +IQMALQLAYYRD+  F LTYEA MTRLFREGRTETVR C+  S  +V++M+N + +N +++  +Q A ++HQ  Y+DAM G+G+DRH+FC+YV+SKYL ++S FL + LS PW+LSTSQTPH Q  K D++++PN +SAGGGFGPV  DGYGVSY++AGE++IFFHIS+  +CQ+TD  RFA N+ QAL DI+ +F
Sbjct:    1 MAEAHAAVAFSFAITHEGFDINYDHEVLNLVWNSGVRSWKKRLARARNGVRNGVYPAHIQSLWLISAIALGLHFAGYQAPFNLTNRILVHLPS----NTINWQVTACFLAALVVWLSICFTMRYTLKLLLMYKGWMYESRAPGSRVSLPTMLWVAVVRVLSSWNKPGLYSFQGSLPRLPLPSVKDTMTRYLRSVRPLLDDENYTRMERLAKEFEQTIGKKLQWYLILKSWWSTNYVSDWWEEYVYLRGRSPLCVNSNFYGTDAIFMNLTDKQAARAANVISLLLNFRRLIEHQELQPIMVQGMIPLCSWQYERTFNTARVP-----GLETDRIIHYRDSNHIVVLHKGCYYKMLIYYKGRILRPCELQVQIEEILKGKATPVEGEEHLAALTAWNRSKWAEARNTFFSWGVNQTSLRTIESAAFVLSLDDEPFEFDLARPELLDNFGKKLLHGNGYNRWFDKCFTVCVGTNGRVGFNAEHTWADAPVLGHLWEYIFGDDI----YGYDETGNTKGTPAFQPPTPTRLTWDLKPCLA-QIEEATIDVTKLINEVNLRILVHQDYGKGFMKKCRISPDAYIQMALQLAYYRDAGRFSLTYEASMTRLFREGRTETVRPCTIESSAWVKAMQNPNTTNDERVKMMQAACDRHQLGYQDAMCGRGIDRHLFCLYVVSKYLEVDSPFLNEVLSEPWRLSTSQTPHGQTPKMDLKKHPNCISAGGGFGPVADDGYGVSYIIAGENLIFFHISAKTTCQQTDVHRFAQNISQALSDIRSMF 760          
BLAST of Carnitine O-palmitoyltransferase 1, liver isoform vs. Ensembl Fly
Match: whd (gene:FBgn0261862 transcript:FBtr0301281)

HSP 1 Score: 678.707 bits (1750), Expect = 0.000e+0
Identity = 352/774 (45.48%), Postives = 507/774 (65.50%), Query Frame = 3
Query:  165 MAEAHQAVAFSIKVSDDGIDWSLNFKAFKEIAKSGVKSWKKGLYRIQNRFYNGLYPSQPGNWLGIVCGVFASSMVGFDLSFGLIEKIEVQLQRVLELESPRDHLIASLMYSCGLWTAGVIVRKYTLSNLLYYMDWMYESQ---TGPSMKTKAWMVLVTILGGGN-PKLYSYQGXXXXXXXXXXXXTINKFLTSMEPLLSXXXXXXXXXXXXXXXXQHGFKIQFYLHLKYLWSSNYVSDWWEEFVYLSSRSSLMINSNYYGMDALMLRHEWIQAARAANLICASVQFMRELNTEELEPLVIQGKVPLCSRQYERMFCTVRVPRNISRKNRSDQLVHYRESRYIVVICRGNYYKVNFMKGDQYLDPVDMEKQFQNILDTAVQPNDPSQYIGVLTAGERNQWAINRESFFKDGCNKESLEIIEKAAFMLVLEDEFQDYNPNDESKLDAFGHSLLHGKGHDRWYDKSFNMVVFKNGRVGFNAEHSWADAPIMAHYWEYILLEDILSPKFGYTPDGHCRGVGKSNNISPQKLQWKLSKMIELEIEKCLLTTSKLIEDIDLHIVPFSEFGRGFMKTCKVSPDGFIQMALQLAYYRDSESFCLTYEACMTRLFREGRTETVRSCSNASCEFVRSMENKDLSNSDKINYLQLASNKHQKLYRDAMTGKGVDRHIFCMYVISKYLNIESEFLQKALSVPWKLSTSQTPHTQLTKFDMRRYPNFLSAGGGFGPVTSDGYGVSYMMAGEDIIFFHISSNISCQKTDSKRFANNLCQALLDIKKLF 2474
            MAEAH AVAFS  ++ +G D + + +    +  SGV+SWKK L R +N   NG+YP+   +   I          G+   F L  +I V L       +    + A  + +  +W +     +YTL  LL Y  WMYES+   +  S+ T  W+ +V +L   N P LYS+QGSLP+LPLP +  T+ ++L S+ PLL +E Y  +++LA EF++  G K+Q+YL LK  WS+NYVSDWWEE+VYL  RS L +NSN+YG DA+ +     QAARAAN+I   + F R +  +EL+P+++QG +PLCS QYER F T RVP        +D+++HYR+S +IVV+ +G YYK+      + L P +++ Q + IL     P +  +++  LTA  R++WA  R +FF  G N+ SL  IE AAF+L L+DE  +++      LD FG  LLHG G++RW+DK F + V  NGRVGFNAEH+W+DA I +H WE ++++D++S   GY   G+ +G       +P +L W L   +  +IE+  +  +KLI +++L I+   ++G+GFMK C++SPD +IQMALQLAYYRD+  F LTYEA MTRLFREGRTETVR C+  S  +V++M+N + +N +++  +Q A ++HQ  Y+DAM G+G+DRH+FC+YV+SKYL ++S FL + LS PW+LSTSQTPH Q  K D++++PN +SAGGGFGPV  DGYGVSY++AGE++IFFHIS+  +CQ+TD  RFA N+ QAL DI+ +F
Sbjct:    1 MAEAHAAVAFSFAITHEGFDINYDHEVLNLVWNSGVRSWKKRLARARNGVRNGVYPAHIQSLWLISAIALGLHFAGYQAPFNLTNRILVHLPS----NTINWQVTACFLAALVVWLSICFTMRYTLKLLLMYKGWMYESRAPGSRVSLPTMLWVAVVRVLSSWNKPGLYSFQGSLPRLPLPSVKDTMTRYLRSVRPLLDDENYTRMERLAKEFEQTIGKKLQWYLILKSWWSTNYVSDWWEEYVYLRGRSPLCVNSNFYGTDAIFMNLTDKQAARAANVISLLLNFRRLIEHQELQPIMVQGMIPLCSWQYERTFNTARVP-----GLETDRIIHYRDSNHIVVLHKGCYYKMLIYYKGRILRPCELQVQIEEILKGKATPVEGEEHLAALTAWNRSKWAEARNTFFSWGVNQTSLRTIESAAFVLSLDDEPFEFDLARPELLDNFGKKLLHGNGYNRWFDKCFTVCVGTNGRVGFNAEHTWSDAAIASHMWENLIVDDLVSD--GYDETGNTKGTPAFQPPTPTRLTWDLKPCLA-QIEEATIDVTKLINEVNLRILVHQDYGKGFMKKCRISPDAYIQMALQLAYYRDAGRFSLTYEASMTRLFREGRTETVRPCTIESSAWVKAMQNPNTTNDERVKMMQAACDRHQLGYQDAMCGRGIDRHLFCLYVVSKYLEVDSPFLNEVLSEPWRLSTSQTPHGQTPKMDLKKHPNCISAGGGFGPVADDGYGVSYIIAGENLIFFHISAKTTCQQTDVHRFAQNISQALSDIRSMF 762          
BLAST of Carnitine O-palmitoyltransferase 1, liver isoform vs. Ensembl Fly
Match: whd (gene:FBgn0261862 transcript:FBtr0301282)

HSP 1 Score: 678.707 bits (1750), Expect = 0.000e+0
Identity = 352/774 (45.48%), Postives = 507/774 (65.50%), Query Frame = 3
Query:  165 MAEAHQAVAFSIKVSDDGIDWSLNFKAFKEIAKSGVKSWKKGLYRIQNRFYNGLYPSQPGNWLGIVCGVFASSMVGFDLSFGLIEKIEVQLQRVLELESPRDHLIASLMYSCGLWTAGVIVRKYTLSNLLYYMDWMYESQ---TGPSMKTKAWMVLVTILGGGN-PKLYSYQGXXXXXXXXXXXXTINKFLTSMEPLLSXXXXXXXXXXXXXXXXQHGFKIQFYLHLKYLWSSNYVSDWWEEFVYLSSRSSLMINSNYYGMDALMLRHEWIQAARAANLICASVQFMRELNTEELEPLVIQGKVPLCSRQYERMFCTVRVPRNISRKNRSDQLVHYRESRYIVVICRGNYYKVNFMKGDQYLDPVDMEKQFQNILDTAVQPNDPSQYIGVLTAGERNQWAINRESFFKDGCNKESLEIIEKAAFMLVLEDEFQDYNPNDESKLDAFGHSLLHGKGHDRWYDKSFNMVVFKNGRVGFNAEHSWADAPIMAHYWEYILLEDILSPKFGYTPDGHCRGVGKSNNISPQKLQWKLSKMIELEIEKCLLTTSKLIEDIDLHIVPFSEFGRGFMKTCKVSPDGFIQMALQLAYYRDSESFCLTYEACMTRLFREGRTETVRSCSNASCEFVRSMENKDLSNSDKINYLQLASNKHQKLYRDAMTGKGVDRHIFCMYVISKYLNIESEFLQKALSVPWKLSTSQTPHTQLTKFDMRRYPNFLSAGGGFGPVTSDGYGVSYMMAGEDIIFFHISSNISCQKTDSKRFANNLCQALLDIKKLF 2474
            MAEAH AVAFS  ++ +G D + + +    +  SGV+SWKK L R +N   NG+YP+   +   I          G+   F L  +I V L       +    + A  + +  +W +     +YTL  LL Y  WMYES+   +  S+ T  W+ +V +L   N P LYS+QGSLP+LPLP +  T+ ++L S+ PLL +E Y  +++LA EF++  G K+Q+YL LK  WS+NYVSDWWEE+VYL  RS L +NSN+YG DA+ +     QAARAAN+I   + F R +  +EL+P+++QG +PLCS QYER F T RVP        +D+++HYR+S +IVV+ +G YYK+      + L P +++ Q + IL     P +  +++  LTA  R++WA  R +FF  G N+ SL  IE AAF+L L+DE  +++      LD FG  LLHG G++RW+DK F + V  NGRVGFNAEH+W+DA I +H WE ++++D++S   GY   G+ +G       +P +L W L   +  +IE+  +  +KLI +++L I+   ++G+GFMK C++SPD +IQMALQLAYYRD+  F LTYEA MTRLFREGRTETVR C+  S  +V++M+N + +N +++  +Q A ++HQ  Y+DAM G+G+DRH+FC+YV+SKYL ++S FL + LS PW+LSTSQTPH Q  K D++++PN +SAGGGFGPV  DGYGVSY++AGE++IFFHIS+  +CQ+TD  RFA N+ QAL DI+ +F
Sbjct:    1 MAEAHAAVAFSFAITHEGFDINYDHEVLNLVWNSGVRSWKKRLARARNGVRNGVYPAHIQSLWLISAIALGLHFAGYQAPFNLTNRILVHLPS----NTINWQVTACFLAALVVWLSICFTMRYTLKLLLMYKGWMYESRAPGSRVSLPTMLWVAVVRVLSSWNKPGLYSFQGSLPRLPLPSVKDTMTRYLRSVRPLLDDENYTRMERLAKEFEQTIGKKLQWYLILKSWWSTNYVSDWWEEYVYLRGRSPLCVNSNFYGTDAIFMNLTDKQAARAANVISLLLNFRRLIEHQELQPIMVQGMIPLCSWQYERTFNTARVP-----GLETDRIIHYRDSNHIVVLHKGCYYKMLIYYKGRILRPCELQVQIEEILKGKATPVEGEEHLAALTAWNRSKWAEARNTFFSWGVNQTSLRTIESAAFVLSLDDEPFEFDLARPELLDNFGKKLLHGNGYNRWFDKCFTVCVGTNGRVGFNAEHTWSDAAIASHMWENLIVDDLVSD--GYDETGNTKGTPAFQPPTPTRLTWDLKPCLA-QIEEATIDVTKLINEVNLRILVHQDYGKGFMKKCRISPDAYIQMALQLAYYRDAGRFSLTYEASMTRLFREGRTETVRPCTIESSAWVKAMQNPNTTNDERVKMMQAACDRHQLGYQDAMCGRGIDRHLFCLYVVSKYLEVDSPFLNEVLSEPWRLSTSQTPHGQTPKMDLKKHPNCISAGGGFGPVADDGYGVSYIIAGENLIFFHISAKTTCQQTDVHRFAQNISQALSDIRSMF 762          
BLAST of Carnitine O-palmitoyltransferase 1, liver isoform vs. Ensembl Fly
Match: CRAT (gene:FBgn0037440 transcript:FBtr0347005)

HSP 1 Score: 238.424 bits (607), Expect = 1.071e-67
Identity = 182/612 (29.74%), Postives = 310/612 (50.65%), Query Frame = 3
Query:  708 TINKFLTSMEPLLSXXXXXXXXXXXXXXXXQHGFKIQFYLHLKYLWSSNYVSDWWEEFVYLSSRSSLMINSNYYGMDALMLRHEWIQAARA-----ANLICASVQFMRELNTEELEPLVIQGKVPLCSRQYERMFCTVRVPRNISRKNRSDQLVHYRESRYIVVICRGNYYKVN-FMKGDQYLDPVDMEKQFQNILDTAVQPNDPSQYIGVLTAGERNQWAINRESFFKDGCNKESLEIIEKAAFMLVLEDEFQDYNPNDESKLDAFGHSLLHGKGH-----DRWYDKSFNMVVFKNGRVGFNAEHSWADAPIMAHYWEYILLEDILSPKFGYTPDGHCRGVGKSNNISPQKLQWKLS-KMIELEIEKCLLTTSKLIEDIDLHIVPFSEFGRGFMKTCKVSPDGFIQMALQLAYYRDSESFCLTYEACMTRLFREGRTETVRSCSNASCEFVRSMENKDLSNSDKINYLQLASNKHQKLYRDAMTGKGVDRHIFCMYVIS-KYLNIESEFLQK---ALSVPWKLSTSQTPHTQLTKFDMRRYPNFLSAGGGFGPVTSDGYGVSYMMAGEDIIFFHISSNISCQKTDSKRFANNLCQALLDIKKLF--NPLDS 2489
            T+N+F+T++EPLL+ EE+   K +  EF K+ G ++Q  L        N+++  W +  YL+ R  + +    +    +    +  + +RA     A +I    +F   ++  ++ P+V  GK  L + Q+ ++F T R+PR       +D++V+  +S Y+VVI + ++Y++  + K  + +    +  Q +NI+    Q   P    G+LT   R+ WA   E   +   N+++L+ I+ A F + L DE       +E+  D    SL+HG G      +RW DK+  +VV  NG VGF  EHS A+   +A   +Y++ +    P FG +        G  +    QK+Q+  S K +E  +        KL + + + ++ F+ FG+ F+K  ++ PD F+QMALQLA+Y+        YE+   R+F  GRTET+RSCSN S  F R+M++ ++++ ++   L+ A   HQ   + A+ GKGVDRH+  + +++ ++     EF +      S  +++STSQ      TK+D         A  G+GP T DGY   Y     DII   IS+   C  TD  +F   L Q+  ++K +   NP ++
Sbjct:   61 TLNRFMTTVEPLLTPEEFQRQKGITSEFLKKQGRELQLLLEETGSKEKNWLAHRWLKAAYLTYRDPVTV----FVSPGMTFPKQNFRDSRAFVDYTARVIYGLGEFNDMVHANKI-PIVKMGKNELDNSQFGKVFGTCRIPRR-----GTDEIVYNPDSDYVVVIYKNHFYQLKIYSKEGKLIAAPCLAAQLENIVLKETQVGVP---YGILTTDSRDNWAEAYEYLVETPGNRDALKTIQGALFTVSL-DEGTILKEGEET--DELILSLIHGSGSKINSGNRWMDKTIQLVVNPNGNVGFTYEHSPAEGQPIAMMMDYVVQKMKEDPSFGQS--------GSQDFAPAQKIQFSSSNKSLEKSLNVAQENVDKLADALQMKVLKFNGFGKDFIKKQRLGPDSFVQMALQLAFYKMHSEPPAQYESAHLRIFDGGRTETIRSCSNESLAFSRAMQDPNVTDQERAAKLREAVVSHQTYAKLALQGKGVDRHLLGLKLMALEHSKPIPEFFKSPGFVKSSHFRMSTSQV----ATKYD---------AFMGYGPATDDGYACCYNPRDNDII-LAISAWRHCPITDHLKFVKTLEQSFFEMKNVLEKNPPET 634          
BLAST of Carnitine O-palmitoyltransferase 1, liver isoform vs. Ensembl Zebrafish
Match: cpt1ab (carnitine palmitoyltransferase 1Ab (liver) [Source:ZFIN;Acc:ZDB-GENE-030131-3250])

HSP 1 Score: 726.472 bits (1874), Expect = 0.000e+0
Identity = 363/773 (46.96%), Postives = 510/773 (65.98%), Query Frame = 3
Query:  165 MAEAHQAVAFSIKVSDDGIDWSLNFKAFKEIAKSGVKSWKKGLYRIQNRFYNGLYPSQPGNWLGIVCGVFASSMVG-FDLSFGLIEKIEVQLQRVLELESPRDHLIASLMYSCGLWTAGVIVRKYTLSNLLYYMDWMYESQTGPSMKTKAWMVLVTILGGGNPKLYSYQGXXXXXXXXXXXXTINKFLTSMEPLLSXXXXXXXXXXXXXXXXQHGFKIQFYLHLKYLWSSNYVSDWWEEFVYLSSRSSLMINSNYYGMDALMLRHEWIQAARAANLICASVQFMRELNTEELEPLVIQGKVPLCSRQYERMFCTVRVPRNISRKNRSDQLVHYRESRYIVVICRGNYYKVNFMKGDQYLDPVDMEKQFQNILDTAVQPNDPSQYIGVLTAGERNQWAINRESFFKDGCNKESLEIIEKAAFMLVLEDEFQDYNPNDE-SKLDAFGHSLLHGKGHDRWYDKSFNMVVFKNGRVGFNAEHSWADAPIMAHYWEYILLEDILSPKFGYTPDGHCRGVGKSNNISPQKLQWKLSKMIELEIEKCLLTTSKLIEDIDLHIVPFSEFGRGFMKTCKVSPDGFIQMALQLAYYRDSESFCLTYEACMTRLFREGRTETVRSCSNASCEFVRSMENKDLSNSDKINYLQLASNKHQKLYRDAMTGKGVDRHIFCMYVISKYLNIESEFLQKALSVPWKLSTSQTPHTQLTKFDMRRYPNFLSAGGGFGPVTSDGYGVSYMMAGEDIIFFHISSNISCQKTDSKRFANNLCQALLDIKKLFN 2477
            MAEAHQAVAF   V+ DGID  L  +A ++I  SG+ SWKK   R +N    G+YP  P   + ++ G  +S+     D S G++ K+   L     +      ++  ++   GLW A   V +  L  LL +  WM+      S+KTK W+VLV +  G  P LYS+Q SLP+LP+P +  T+ ++L S  PL+ +E+Y  ++ LA +F+K  G K+Q+YL LK  W+SNYVSDWWEE++YL  RS +M+NSNYY MD L +    +QAARA N I A + + R+L+  +++PL++   +P+CS QYERMF T RVP        +D L H  ES++I V  +G +YKV      + L P ++E+Q + IL    +P    +++  LTAG+R  WA  R  FF  G NK+SL+ +EKAAF + L+D  Q Y P++    LD++G SLLHGK +DRW+DKS N++VFKNG +G NAEHSWADAPI+ H WE +L  D +  + GYT +GHC+G    N   PQ+LQW + +  +  I   L   + L +D+D+HI PF++FG+G +K CK SPDGFIQ+ALQLA++RD   FCLTYEA MTRLFREGRTETVRSC+N +C FV +M ++  +  +++  L+ A+ KHQ LY+ AMTGKG+DRH+FC+Y++SKYL  +S FL++ LS PW+LSTSQTP  Q+  FD++++P ++++GGGFGPV  DGYGVSY++ GED+I FHISS  S  +TDS RF +N+ QA+LDI  LF 
Sbjct:    1 MAEAHQAVAFQFTVTPDGIDLHLCHEALRQIYLSGIHSWKKRFIRFKNGVMTGVYPGSPSGLVVVLVGYMSSTKYAKIDPSLGILTKLSTHLPVSKYITEDGQRIVGGVLVGTGLWIAVTFVMRNALKYLLSWHGWMFNQHGTLSLKTKIWLVLVKLFSGPKPMLYSFQSSLPRLPVPPVKDTVRRYLESARPLMDDEQYKRMEGLAKDFEKNLGPKLQWYLKLKSWWTSNYVSDWWEEYIYLRGRSPIMVNSNYYAMDFLYVNPTSLQAARAGNSIHAMMMYRRKLDRAQIKPLMVLNTIPMCSSQYERMFNTSRVP-----GVETDVLQHVNESKHIAVYHKGRFYKVWMFYDGRLLLPREIEQQMERILADKSEPQPGEEFLAALTAGDRVPWAKARSQFFIRGKNKQSLDAVEKAAFFVTLDDSEQRYEPDNPIQSLDSYGKSLLHGKCYDRWFDKSLNLIVFKNGTMGLNAEHSWADAPIVGHLWEQVLSSDPV--RLGYTEEGHCKGNPHPNMPGPQRLQWDIPEECQTVISSSLKVANTLADDVDMHIFPFNDFGKGLIKKCKTSPDGFIQLALQLAHFRDKGKFCLTYEASMTRLFREGRTETVRSCTNETCAFVHAMMDEKATREERLKLLKAATEKHQNLYKLAMTGKGIDRHLFCLYLVSKYLGEDSPFLKEVLSEPWRLSTSQTPLQQMELFDLKKHPEYVTSGGGFGPVADDGYGVSYIILGEDLINFHISSKHSSHETDSHRFGSNIKQAMLDILDLFQ 766          
BLAST of Carnitine O-palmitoyltransferase 1, liver isoform vs. Ensembl Zebrafish
Match: CR352222.1 (carnitine palmitoyltransferase 1Ab (liver) [Source:NCBI gene;Acc:560000])

HSP 1 Score: 726.087 bits (1873), Expect = 0.000e+0
Identity = 363/773 (46.96%), Postives = 510/773 (65.98%), Query Frame = 3
Query:  165 MAEAHQAVAFSIKVSDDGIDWSLNFKAFKEIAKSGVKSWKKGLYRIQNRFYNGLYPSQPGNWLGIVCGVFASSMVG-FDLSFGLIEKIEVQLQRVLELESPRDHLIASLMYSCGLWTAGVIVRKYTLSNLLYYMDWMYESQTGPSMKTKAWMVLVTILGGGNPKLYSYQGXXXXXXXXXXXXTINKFLTSMEPLLSXXXXXXXXXXXXXXXXQHGFKIQFYLHLKYLWSSNYVSDWWEEFVYLSSRSSLMINSNYYGMDALMLRHEWIQAARAANLICASVQFMRELNTEELEPLVIQGKVPLCSRQYERMFCTVRVPRNISRKNRSDQLVHYRESRYIVVICRGNYYKVNFMKGDQYLDPVDMEKQFQNILDTAVQPNDPSQYIGVLTAGERNQWAINRESFFKDGCNKESLEIIEKAAFMLVLEDEFQDYNPNDE-SKLDAFGHSLLHGKGHDRWYDKSFNMVVFKNGRVGFNAEHSWADAPIMAHYWEYILLEDILSPKFGYTPDGHCRGVGKSNNISPQKLQWKLSKMIELEIEKCLLTTSKLIEDIDLHIVPFSEFGRGFMKTCKVSPDGFIQMALQLAYYRDSESFCLTYEACMTRLFREGRTETVRSCSNASCEFVRSMENKDLSNSDKINYLQLASNKHQKLYRDAMTGKGVDRHIFCMYVISKYLNIESEFLQKALSVPWKLSTSQTPHTQLTKFDMRRYPNFLSAGGGFGPVTSDGYGVSYMMAGEDIIFFHISSNISCQKTDSKRFANNLCQALLDIKKLFN 2477
            MAEAHQAVAF   V+ DGID  L  +A ++I  SG+ SWKK   R +N    G+YP  P   + ++ G  +S+     D S G++ K+   L     +      ++  ++   GLW A   V +  L  LL +  WM+      S+KTK W+VLV +  G  P LYS+Q SLP+LP+P +  T+ ++L S  PL+ +E+Y  ++ LA +F+K  G K+Q+YL LK  W+SNYVSDWWEE++YL  RS +M+NSNYY MD L +    +QAARA N I A + + R+L+  +++PL++   +P+CS QYERMF T RVP        +D L H  ES++I V  +G +YKV      + L P ++E+Q + IL    +P    +++  LTAG+R  WA  R  FF  G NK+SL+ +EKAAF + L+D  Q Y P++    LD++G SLLHGK +DRW+DKS N++VFKNG +G NAEHSWADAPI+ H WE +L  D +  + GYT +GHC+G    N   PQ+LQW + +  +  I   L   + L +D+D+HI PF++FG+G +K CK SPDGFIQ+ALQLA++RD   FCLTYEA MTRLFREGRTETVRSC+N +C FV +M ++  +  +++  L+ A+ KHQ LY+ AMTGKG+DRH+FC+Y++SKYL  +S FL++ LS PW+LSTSQTP  Q+  FD++++P ++++GGGFGPV  DGYGVSY++ GED+I FHISS  S  +TDS RF +N+ QA+LDI  LF 
Sbjct:    1 MAEAHQAVAFQFTVTPDGIDLHLCHEALRQIYLSGIHSWKKRFIRFKNGVMTGVYPGSPSGLVVVLVGYMSSTKYAKIDPSLGILTKLSTHLPVSKYITEDGQRIVGGVLVGTGLWIAVTFVMRNALKYLLSWHGWMFNQHGTLSLKTKIWLVLVKLFSGPKPMLYSFQSSLPRLPVPPVKDTVRRYLESARPLMDDEQYKRMEGLAKDFEKNLGPKLQWYLKLKSWWTSNYVSDWWEEYIYLRGRSPIMVNSNYYAMDFLYVNPTSLQAARAGNSIHAMMMYRRKLDRAQIKPLMVLNTIPMCSSQYERMFNTSRVP-----GVETDVLQHVNESKHIAVYHKGRFYKVWMFYDGRLLLPREIEQQMERILADKSEPQPGEEFLAALTAGDRVPWAKARSQFFIRGKNKQSLDAVEKAAFFVTLDDSEQRYEPDNPIQSLDSYGKSLLHGKCYDRWFDKSLNLIVFKNGTMGLNAEHSWADAPIVGHLWEQVLSSDPV--RLGYTEEGHCKGNPHPNMPGPQRLQWDIPEECQTVISSSLKVANTLADDVDMHIFPFNDFGKGLIKKCKTSPDGFIQLALQLAHFRDKGKFCLTYEASMTRLFREGRTETVRSCTNETCAFVHAMIDEKATREERLKLLKAATEKHQNLYKLAMTGKGIDRHLFCLYLVSKYLGEDSPFLKEVLSEPWRLSTSQTPLQQMELFDLKKHPEYVTSGGGFGPVADDGYGVSYIILGEDLINFHISSKHSSHETDSHRFGSNIKQAMLDILDLFQ 766          
BLAST of Carnitine O-palmitoyltransferase 1, liver isoform vs. Ensembl Zebrafish
Match: cpt1cb (carnitine palmitoyltransferase 1Cb [Source:ZFIN;Acc:ZDB-GENE-050417-155])

HSP 1 Score: 725.317 bits (1871), Expect = 0.000e+0
Identity = 372/775 (48.00%), Postives = 510/775 (65.81%), Query Frame = 3
Query:  165 MAEAHQAVAFSIKVSDDGIDWSLNFKAFKEIAKSGVKSWKKGLYRIQNRFYNGLYPSQPGNWLGIVCGVFASSMVGFDLSFGLIEKIEVQLQRVLELESPRDHLIASLMYSCGLWTAGVIVRKYTLSNLLYYMDWMYESQTGPSMKTKAWMVLVTILGGGNPKLYSYQGXXXXXXXXXXXXTINKFLTSMEPLLSXXXXXXXXXXXXXXXXQHGFKIQFYLHLKYLWSSNYVSDWWEEFVYLSSRSSLMINSNYYGMDALMLRHEWIQAARAANLICASVQFMRELNTEELEPLVIQGKV-PLCSRQYERMFCTVRVPRNISRKNRSDQLVHYRESRYIVVICRGNYYKVNFMKGDQYLDPVDMEKQFQNILDTAVQPNDPSQYIGVLTAGERNQWAINRESFFKDGCNKESLEIIEKAAFMLVLEDEFQDYNPNDESK-LDAFGHSLLHGKGHDRWYDKSFNMVVFKNGRVGFNAEHSWADAPIMAHYWEYILLEDILSPKFGYTPDGHCRGVGKSNNISPQKLQWKLSKMIELEIEKCLLTTSKLIEDIDLHIVPFSEFGRGFMKTCKVSPDGFIQMALQLAYYRDSESFCLTYEACMTRLFREGRTETVRSCSNASCEFVRSMEN-KDLSNSDKINYLQLASNKHQKLYRDAMTGKGVDRHIFCMYVISKYLNIESEFLQKALSVPWKLSTSQTPHTQLTKFDMRRYPNFLSAGGGFGPVTSDGYGVSYMMAGEDIIFFHISSNISCQKTDSKRFANNLCQALLDIKKLFNP 2480
            MAEAHQAVAF   +S +GI+  L+++A  +I  SG++SWKK + RI+NR   G YP+ P +WL IV  + A+  +  D S GLI KI+  L   L L      ++++L++S  LW + ++  ++ L  LL Y  WM+E     S KTK W  LV +L    P LYSYQ SLP LP+P +  T+ ++L S++PLL  + +  +++L  EF+K  G ++Q YL LK LW++NYVSDWWEE+VYL SRS +M+NSNYYGMD L +     QAARA N I A   + R++N EEL P  I G V PLC+ Q ERMF T R P        +D L H+++S ++ V  RG Y+++   +  + L P +++ Q Q ILD    P+   + +G LTAG R  WA  R+ FF  G NK+SL+ IEKAAF + L+D+ +     + S+ LD +  SLLHGK +DRW+DKSF++VV+KNG+ G NAEHSWADAPI+AH WE+ L  D      GY  DG+CRG    +   PQ+L W +   ++ +I + L     L +++D H+ PF +FG+G +K  K+SPD F+Q+ALQLAYYRD  +FCLTYEA MTRLFREGRTETVRSCSN SC FV ++E  +D     K+  L+  + KHQ LYR AMTG G+DRH+FC+YV+SKYL +ES FL++ LS PW+LSTSQTP  Q+  FD+  +P F+S GGGFGPV  DGYGVSY++ GED+I FH+S   SC++TDS +F   + QA++D+  L NP
Sbjct:    1 MAEAHQAVAFQFTISPEGINLHLSYQALNQIYLSGLRSWKKRISRIKNRIIKGAYPASPSSWLFIVIAILATMYMQSDPSMGLIAKIQEHLPLSLSLSPQGQTMLSALLFSTLLWMSLILTLRFCLKLLLSYHRWMFEQHGHMSTKTKVWATLVKLLSSRKPLLYSYQTSLPHLPVPPIKDTLERYLESVKPLLDLDGFQRMRRLTSEFEKSLGNRLQRYLRLKALWATNYVSDWWEEYVYLRSRSPIMVNSNYYGMDFLYVTPTPNQAARAGNTITALFLYRRKVNREELNPSRIPGTVIPLCAAQCERMFNTTRTP-----GEETDVLQHWQDSEFVAVYHRGRYFRLWVYRAGRLLSPREIQFQIQRILDDPSPPSPGEEKLGALTAGNRTPWARVRKQFFSSGVNKQSLDCIEKAAFFVTLDDQAEGMKGENPSENLDRYAKSLLHGKCYDRWFDKSFSVVVYKNGKNGLNAEHSWADAPIVAHLWEFTLATDTF--HLGYNSDGNCRGDVDHSLPHPQRLSWDIPFEVQTQISESLAVAQALADEVDCHVFPFRKFGKGLIKKMKLSPDSFVQLALQLAYYRDRGTFCLTYEASMTRLFREGRTETVRSCSNESCAFVLALEGGEDREQCRKL--LRKTAEKHQNLYRLAMTGSGIDRHLFCLYVVSKYLGVESPFLKEVLSEPWRLSTSQTPVQQMELFDLVNHPEFISLGGGFGPVADDGYGVSYIIMGEDMINFHVSCKHSCKETDSHKFGCQVSQAMVDLMTLLNP 766          
BLAST of Carnitine O-palmitoyltransferase 1, liver isoform vs. Ensembl Zebrafish
Match: cpt1ab (carnitine palmitoyltransferase 1Ab (liver) [Source:ZFIN;Acc:ZDB-GENE-030131-3250])

HSP 1 Score: 721.85 bits (1862), Expect = 0.000e+0
Identity = 363/774 (46.90%), Postives = 512/774 (66.15%), Query Frame = 3
Query:  165 MAEAHQAVAFSIKVSDDGIDWSLNFKAFKEIAKSGVKSWKKGLYRIQNRFYNGLYPSQPGNWLGIVCGVFASSMVG-FDLSFGLIEKIEVQLQRVLELESPRDHLIASLMYSCGLWTAGVIVRKYTLSNLLYYMDWMYESQTGPSMKTKAWMVLVTILGGGNPKLYSYQGXXXXXXXXXXXXTINKFLTSMEPLLSXXXXXXXXXXXXXXXXQHGFKIQFYLHLKYLWSSNYVSDWWEEFVYLSSRSSLMINSNYYGMDALMLRHEWIQAARAANLICASVQFMRELNTEELEPL-VIQGKVPLCSRQYERMFCTVRVPRNISRKNRSDQLVHYRESRYIVVICRGNYYKVNFMKGDQYLDPVDMEKQFQNILDTAVQPNDPSQYIGVLTAGERNQWAINRESFFKDGCNKESLEIIEKAAFMLVLEDEFQDYNPNDE-SKLDAFGHSLLHGKGHDRWYDKSFNMVVFKNGRVGFNAEHSWADAPIMAHYWEYILLEDILSPKFGYTPDGHCRGVGKSNNISPQKLQWKLSKMIELEIEKCLLTTSKLIEDIDLHIVPFSEFGRGFMKTCKVSPDGFIQMALQLAYYRDSESFCLTYEACMTRLFREGRTETVRSCSNASCEFVRSMENKDLSNSDKINYLQLASNKHQKLYRDAMTGKGVDRHIFCMYVISKYLNIESEFLQKALSVPWKLSTSQTPHTQLTKFDMRRYPNFLSAGGGFGPVTSDGYGVSYMMAGEDIIFFHISSNISCQKTDSKRFANNLCQALLDIKKLFN 2477
            MAEAHQAVAF   V+ DGID  L  +A ++I  SG+ SWKK   R +N    G+YP  P   + ++ G  +S+     D S G++ K+   L     +      ++  ++   GLW A   V +  L  LL +  WM+      S+KTK W+VLV +  G  P LYS+Q SLP+LP+P +  T+ ++L S  PL+ +E+Y  ++ LA +F+K  G K+Q+YL LK  W+SNYVSDWWEE++YL  RS +M+NSNYY MD L +    +QAARA N I A + + R+L+  +++PL +++ +VPLCS Q+ERMF T R+P        +D L H  ES++I V  +G +YKV      + L P ++E+Q + IL    +P    +++  LTAG+R  WA  R  FF  G NK+SL+ +EKAAF + L+D  Q Y P++    LD++G SLLHGK +DRW+DKS N++VFKNG +G NAEHSWADAPI+ H WE +L  D +  + GYT +GHC+G    N   PQ+LQW + +  +  I   L   + L +D+D+HI PF++FG+G +K CK SPDGFIQ+ALQLA++RD   FCLTYEA MTRLFREGRTETVRSC+N +C FV +M ++  +  +++  L+ A+ KHQ LY+ AMTGKG+DRH+FC+Y++SKYL  +S FL++ LS PW+LSTSQTP  Q+  FD++++P ++++GGGFGPV  DGYGVSY++ GED+I FHISS  S  +TDS RF +N+ QA+LDI  LF 
Sbjct:    1 MAEAHQAVAFQFTVTPDGIDLHLCHEALRQIYLSGIHSWKKRFIRFKNGVMTGVYPGSPSGLVVVLVGYMSSTKYAKIDPSLGILTKLSTHLPVSKYITEDGQRIVGGVLVGTGLWIAVTFVMRNALKYLLSWHGWMFNQHGTLSLKTKIWLVLVKLFSGPKPMLYSFQSSLPRLPVPPVKDTVRRYLESARPLMDDEQYKRMEGLAKDFEKNLGPKLQWYLKLKSWWTSNYVSDWWEEYIYLRGRSPIMVNSNYYAMDFLYVNPTSLQAARAGNSIHAMMMYRRKLDRAQIKPLYLLENRVPLCSAQWERMFNTCRIP-----GLETDVLQHVNESKHIAVYHKGRFYKVWMFYDGRLLLPREIEQQMERILADKSEPQPGEEFLAALTAGDRVPWAKARSQFFIRGKNKQSLDAVEKAAFFVTLDDSEQRYEPDNPIQSLDSYGKSLLHGKCYDRWFDKSLNLIVFKNGTMGLNAEHSWADAPIVGHLWEQVLSSDPV--RLGYTEEGHCKGNPHPNMPGPQRLQWDIPEECQTVISSSLKVANTLADDVDMHIFPFNDFGKGLIKKCKTSPDGFIQLALQLAHFRDKGKFCLTYEASMTRLFREGRTETVRSCTNETCAFVHAMMDEKATREERLKLLKAATEKHQNLYKLAMTGKGIDRHLFCLYLVSKYLGEDSPFLKEVLSEPWRLSTSQTPLQQMELFDLKKHPEYVTSGGGFGPVADDGYGVSYIILGEDLINFHISSKHSSHETDSHRFGSNIKQAMLDILDLFQ 767          
BLAST of Carnitine O-palmitoyltransferase 1, liver isoform vs. Ensembl Zebrafish
Match: cpt1b (carnitine palmitoyltransferase 1B (muscle) [Source:ZFIN;Acc:ZDB-GENE-041010-9])

HSP 1 Score: 706.442 bits (1822), Expect = 0.000e+0
Identity = 361/771 (46.82%), Postives = 500/771 (64.85%), Query Frame = 3
Query:  165 MAEAHQAVAFSIKVSDDGIDWSLNFKAFKEIAKSGVKSWKKGLYRIQNRFYNGLYPSQPGNWLGIVCGVFASSMVGFDLSFGLIEKIEVQLQRVLELESPRDHLIASLMYSCGLWTAGVIVRKYTLSNLLYYMDWMYESQTGPSMKTKAWMVLVTILGGGNPKLYSYQGXXXXXXXXXXXXTINKFLTSMEPLLSXXXXXXXXXXXXXXXXQHGFKIQFYLHLKYLWSSNYVSDWWEEFVYLSSRSSLMINSNYYGMDALMLRHEWIQAARAANLICASVQFMRELNTEELEPLVIQGKVPLCSRQYERMFCTVRVPRNISRKNRSDQLVHYRESRYIVVICRGNYYKVNFMKGDQYLDPVDMEKQFQNILDTAVQPNDPSQYIGVLTAGERNQWAINRESFFKDGCNKESLEIIEKAAFMLVLEDEFQDYNPNDESKLDAFGHSLLHGKGHDRWYDKSFNMVVFKNGRVGFNAEHSWADAPIMAHYWEYILLEDILSPKFGYTPDGHCRGVGKSNNISPQKLQWKLSKMIELEIEKCLLTTSKLIEDIDLHIVPFSEFGRGFMKTCKVSPDGFIQMALQLAYYRDSESFCLTYEACMTRLFREGRTETVRSCSNASCEFVRSMENKDLSNSDKINYLQLASNKHQKLYRDAMTGKGVDRHIFCMYVISKYLNIESEFLQKALSVPWKLSTSQTPHTQLTKFDMRRYPNFLSAGGGFGPVTSDGYGVSYMMAGEDIIFFHISSNISCQKTDSKRFANNLCQALLDIKKLFN 2477
            MAEAHQAVAF   V+ DGID  L+ +  K I  SGV SWKK   R +N    G+YP+ P +WL +V  + ++     D S G I+KI+  L     +      ++++++++ GLW + + + +Y L  LL Y  W++ES    S  TK W+ LV +L G  P LYS+QGSLP LP+P +  TI ++L S+ PLL +E+Y +++ +A +FKK    K+Q +L LK  W++NYVSDWWEE++YL  R  +M+NSN+Y MD L +   + QAARA N++ A +Q+ R+L   EL PL   G VP+CS QYERMF T R+P        +D + H ++ +++VV  RG  +KV    G ++L P ++E QFQ ILD   +P      +  LTAG R  WA  R  +F +G N+ SLE IE AAF L L+DE   Y+P +   LD +  SLLHGK +DRW+DKSFN++V+KNG++G N EHSWAD+PI+ H WEY+L  D      GYT +GHC+G        P +LQW + K  +  IE        + +D+D H   F+EFG+G +K C+ SPD FIQ+ALQLA YRD   FCLTYE+ MTR+FREGRTETVRSC+  S  FVR+ME+   +N  ++   + A+ KHQ +YR AMTG G+DRH+FC+Y++SK + I+S FL++ LS PW+LSTSQTP  QL   D +++P ++SAGGGFGPV  DGYGVSY++ GE++I FHISS  S  +TDS RF  N+ QA+ DI+ LFN
Sbjct:    1 MAEAHQAVAFQFTVTPDGIDLQLSREVLKHIYISGVTSWKKRAIRFKNSVLTGVYPASPSSWLFVVIAIMSTMYARIDPSMGTIDKIKTSLPVSEFMTVQTQTVLSAILFATGLWLSVIFLLRYLLKALLSYHAWIFESHGKMSYSTKVWLSLVKLLSGRRPLLYSFQGSLPHLPVPSIDDTIRRYLESVRPLLDDEQYKQMETVANDFKKDPAPKLQKHLKLKSWWATNYVSDWWEEYIYLRGRDPIMVNSNFYTMDLLYVIPTYRQAARAGNVVHAMLQYRRKLERGELTPLRALGIVPMCSFQYERMFNTTRIP-----GIETDFVQHLKDRKHLVVYHRGRLFKVWLYYGGRHLWPSELELQFQRILDDKSEPQPGELKLPSLTAGNRVPWARARLKYFGEGVNRASLEAIETAAFFLTLDDEAHGYDPENIRSLDLYAKSLLHGKCYDRWFDKSFNLIVYKNGKMGVNTEHSWADSPIIGHMWEYVLATDCF--HLGYTAEGHCKGDVNKTLAPPTRLQWDIPKACQEIIEGSYRIAKGIADDVDFHGCLFNEFGKGLIKKCRTSPDAFIQLALQLAQYRDKGEFCLTYESSMTRMFREGRTETVRSCTCESTAFVRAMEDDTTTNEQRLALFKQAAEKHQNMYRLAMTGAGIDRHLFCLYIVSKVMGIDSPFLKQVLSEPWRLSTSQTPQQQLNLIDTQKFPKYVSAGGGFGPVADDGYGVSYIIVGENLITFHISSKFSSPETDSFRFGQNIRQAMQDIRALFN 764          
BLAST of Carnitine O-palmitoyltransferase 1, liver isoform vs. Ensembl Xenopus
Match: cpt1al (carnitine palmitoyltransferase 1A (liver) like [Source:NCBI gene;Acc:100135089])

HSP 1 Score: 741.88 bits (1914), Expect = 0.000e+0
Identity = 366/773 (47.35%), Postives = 517/773 (66.88%), Query Frame = 3
Query:  165 MAEAHQAVAFSIKVSDDGIDWSLNFKAFKEIAKSGVKSWKKGLYRIQNRFYNGLYPSQPGNWLGIVCGVFASSMVGFDLSFGLIEKIEVQLQRVLELESPRDHLIASLMYSCGLWTAGVIVRKYTLSNLLYYMDWMYESQTGPSMKTKAWMVLVTILGGGNPKLYSYQGXXXXXXXXXXXXTINKFLTSMEPLLSXXXXXXXXXXXXXXXXQHGFKIQFYLHLKYLWSSNYVSDWWEEFVYLSSRSSLMINSNYYGMDALMLRHEWIQAARAANLICASVQFMRELNTEELEPLVIQGKV-PLCSRQYERMFCTVRVPRNISRKNRSDQLVHYRESRYIVVICRGNYYKVNFMKGDQYLDPVDMEKQFQNILDTAVQPNDPSQYIGVLTAGERNQWAINRESFFKDGCNKESLEIIEKAAFMLVLEDEFQDYNPNDE-SKLDAFGHSLLHGKGHDRWYDKSFNMVVFKNGRVGFNAEHSWADAPIMAHYWEYILLEDILSPKFGYTPDGHCRGVGKSNNISPQKLQWKLSKMIELEIEKCLLTTSKLIEDIDLHIVPFSEFGRGFMKTCKVSPDGFIQMALQLAYYRDSESFCLTYEACMTRLFREGRTETVRSCSNASCEFVRSMENKDLSNSDKINYLQLASNKHQKLYRDAMTGKGVDRHIFCMYVISKYLNIESEFLQKALSVPWKLSTSQTPHTQLTKFDMRRYPNFLSAGGGFGPVTSDGYGVSYMMAGEDIIFFHISSNISCQKTDSKRFANNLCQALLDIKKLFN 2477
            MAEAHQAVAF   V+ +GID  L+ +A K++  SG++SWKK   R++N F  G+YP+ P +WL +V  +  +     D S G+IEKI+  L       S    L+++L++S GLW A ++  ++ L  LL Y  WMYE     S  TK W+ LV I  G NP LYSYQ  LP+LP+P +  T+ ++L S+ PL+++EEY  +  LA +F+     ++Q+YL LK  W++NYVSDWWEE++YL  R  +M+NSNYY MD L +    +QAARAAN + A + + R++  EEL+P  + G + PLCS Q+ER F T R+P        +D + HY +S++IVV  +G +++V   +G + L+P ++E QFQNIL+    P    + +  LTAGER  WA  R+++F+ G N ++L+++E+AAF + L+D+ +     D  + LDA+G SLLHGK +DRW+DKSF  +VFKNG++G NAEHSWADAPI+ H WE++L  D    + GY  +G+C+G   SN   PQ+LQW++S+  +  I+  L     L +D+D H  PF EFG+G +K C+ SPD FIQ+ALQLA+YRD   FCLTYEA MTRLFREGRTETVRSC+  S +FV++M N   +N +++   +LA+ KHQ LYR AMTG G+DRH+FC+YV+SKYL ++S FL++ LS PW+LSTSQTP  Q+  FD+  +P ++S GGGFGPV  DGYGVSY++ GE++I FHISS  S  +TDS RF  ++  AL DI  LF 
Sbjct:    1 MAEAHQAVAFQFTVTPEGIDLRLSHEALKQVYLSGLRSWKKKFARVKNSFITGVYPASPSSWLFVVIAIMGTLYARVDPSMGMIEKIKEHL----PASSEGRILVSALLFSTGLWFALIMTMRFILKQLLSYHGWMYEQHGKMSATTKLWLALVKIFSGRNPMLYSYQAVLPRLPVPGVKETVQRYLDSVRPLMNDEEYKRMTGLAKDFEVNLAPRLQWYLKLKSWWAANYVSDWWEEYIYLRGRGPIMVNSNYYAMDFLYVTPTPVQAARAANTVHAILLYRRKVTREELKPSRVPGSIIPLCSSQWERTFNTTRIP-----GEETDTIQHYADSKHIVVYHKGRFFRVWVYQGGRLLNPKELELQFQNILNDPSPPQPGEEKLAALTAGERTAWAKARKTYFRSGKNLQALDLVERAAFFVTLQDDEEGLRTEDPVNSLDAYGKSLLHGKCYDRWFDKSFTFIVFKNGKIGLNAEHSWADAPIVGHMWEFVLATDCF--QLGYNEEGNCKGQVDSNLPVPQRLQWEISEECQEVIQSSLAVAQALADDVDFHTFPFKEFGKGLIKKCRTSPDAFIQIALQLAHYRDKGKFCLTYEASMTRLFREGRTETVRSCTVESSQFVKAMMNPSQTNEERLKLFRLAAEKHQMLYRHAMTGGGIDRHLFCLYVVSKYLGVDSPFLKEVLSEPWRLSTSQTPIQQVELFDLVNHPEYVSCGGGFGPVADDGYGVSYIIVGENLINFHISSKFSSHETDSHRFGKHIQGALRDILALFK 762          
BLAST of Carnitine O-palmitoyltransferase 1, liver isoform vs. Ensembl Xenopus
Match: cpt1al (carnitine palmitoyltransferase 1A (liver) like [Source:NCBI gene;Acc:100135089])

HSP 1 Score: 736.102 bits (1899), Expect = 0.000e+0
Identity = 363/776 (46.78%), Postives = 516/776 (66.49%), Query Frame = 3
Query:  165 MAEAHQAVAFSIKVSDDGIDWSLNFKAFKEIAKSGVKSWKKGLYRIQNRFYNGLYPSQPGNWLGIVCGVFASSMVGFDLSFGLIEKIEVQLQRVLELESPRDHLIASLMYSCGLWTAGVIVRKYTLSNLLYYMDWMYESQTGPSMKTKAWMVLVTILGGGNPKLYSYQGXXXXXXXXXXXXTINKFLTSMEPLLSXXXXXXXXXXXXXXXXQHGFKIQFYLHLKYLWSSNYVSDWWEEFVYLSSRSSLMINSNYYGMDALMLRHEWIQAARAANLICASVQFMRELNTEELEPLVIQGKVP-----LCSRQYERMFCTVRVPRNISRKNRSDQLVHYRESRYIVVICRGNYYKVNFMKGDQYLDPVDMEKQFQNILDTAVQPNDPSQYIGVLTAGERNQWAINRESFFKDGCNKESLEIIEKAAFMLVLEDEFQDYNPNDE-SKLDAFGHSLLHGKGHDRWYDKSFNMVVFKNGRVGFNAEHSWADAPIMAHYWEYILLEDILSPKFGYTPDGHCRGVGKSNNISPQKLQWKLSKMIELEIEKCLLTTSKLIEDIDLHIVPFSEFGRGFMKTCKVSPDGFIQMALQLAYYRDSESFCLTYEACMTRLFREGRTETVRSCSNASCEFVRSMENKDLSNSDKINYLQLASNKHQKLYRDAMTGKGVDRHIFCMYVISKYLNIESEFLQKALSVPWKLSTSQTPHTQLTKFDMRRYPNFLSAGGGFGPVTSDGYGVSYMMAGEDIIFFHISSNISCQKTDSKRFANNLCQALLDIKKLF 2474
            MAEAHQAVAF   V+ +GID  L+ +A K++  SG++SWKK   R++N F  G+YP+ P +WL +V  +  +     D S G+IEKI+  L     L      ++++L++S GLW A ++  ++ L  LL Y  WMYE     S  TK W+ LV I  G NP LYSYQ  LP+LP+P +  T+ ++L S+ PL+++EEY  +  LA +F+     ++Q+YL LK  W++NYVSDWWEE++YL  R  +M+NSNYY MD L +    +QAARAAN + A + + R+L    ++ L++  +VP     LCS Q+ER F T R+P        +D + HY +S++IVV  +G +++V   +G + L+P ++E QFQNIL+    P    + +  LTAGER  WA  R+++F+ G N ++L+++E+AAF + L+D+ +     D  + LDA+G SLLHGK +DRW+DKSF  +VFKNG++G NAEHSWADAPI+ H WE++L  D    + GY  +G+C+G   SN   PQ+LQW++S+  +  I+  L     L +D+D H  PF EFG+G +K C+ SPD FIQ+ALQLA+YRD   FCLTYEA MTRLFREGRTETVRSC+  S +FV++M N   +N +++   +LA+ KHQ LYR AMTG G+DRH+FC+YV+SKYL ++S FL++ LS PW+LSTSQTP  Q+  FD+  +P ++S GGGFGPV  DGYGVSY++ GE++I FHISS  S  +TDS RF  ++  AL DI  LF
Sbjct:    1 MAEAHQAVAFQFTVTPEGIDLRLSHEALKQVYLSGLRSWKKKFARVKNSFITGVYPASPSSWLFVVIAIMGTLYARVDPSMGMIEKIKEHLPASSYLSHQGQSIVSALLFSTGLWFALIMTMRFILKQLLSYHGWMYEQHGKMSATTKLWLALVKIFSGRNPMLYSYQAVLPRLPVPGVKETVQRYLDSVRPLMNDEEYKRMTGLAKDFEVNLAPRLQWYLKLKSWWAANYVSDWWEEYIYLRGRGPIMVNSNYYAMDFLYVTPTPVQAARAANTVHAILLYRRKLINAHIDFLLLNSRVPGSIIPLCSSQWERTFNTTRIP-----GEETDTIQHYADSKHIVVYHKGRFFRVWVYQGGRLLNPKELELQFQNILNDPSPPQPGEEKLAALTAGERTAWAKARKTYFRSGKNLQALDLVERAAFFVTLQDDEEGLRTEDPVNSLDAYGKSLLHGKCYDRWFDKSFTFIVFKNGKIGLNAEHSWADAPIVGHMWEFVLATDCF--QLGYNEEGNCKGQVDSNLPVPQRLQWEISEECQEVIQSSLAVAQALADDVDFHTFPFKEFGKGLIKKCRTSPDAFIQIALQLAHYRDKGKFCLTYEASMTRLFREGRTETVRSCTVESSQFVKAMMNPSQTNEERLKLFRLAAEKHQMLYRHAMTGGGIDRHLFCLYVVSKYLGVDSPFLKEVLSEPWRLSTSQTPIQQVELFDLVNHPEYVSCGGGFGPVADDGYGVSYIIVGENLINFHISSKFSSHETDSHRFGKHIQGALRDILALF 769          
BLAST of Carnitine O-palmitoyltransferase 1, liver isoform vs. Ensembl Xenopus
Match: cpt1al (carnitine palmitoyltransferase 1A (liver) like [Source:NCBI gene;Acc:100135089])

HSP 1 Score: 732.635 bits (1890), Expect = 0.000e+0
Identity = 358/753 (47.54%), Postives = 508/753 (67.46%), Query Frame = 3
Query:  165 MAEAHQAVAFSIKVSDDGIDWSLNFKAFKEIAKSGVKSWKKGLYRIQNRFYNGLYPSQPGNWLGIVCGVFASSMVGFDLSFGLIEKIEVQLQRVLELESPRDHLIASLMYSCGLWTAGVIVRKYTLSNLLYYMDWMYESQTGPSMKTKAWMVLVTILGGGNPKLYSYQGXXXXXXXXXXXXTINKFLTSMEPLLSXXXXXXXXXXXXXXXXQHGFKIQFYLHLKYLWSSNYVSDWWEEFVYLSSRSSLMINSNYYGMDALMLRHEWIQAARAANLICASVQFMRELNTEELEPLVIQGKVPLCSRQYERMFCTVRVPRNISRKNRSDQLVHYRESRYIVVICRGNYYKVNFMKGDQYLDPVDMEKQFQNILDTAVQPNDPSQYIGVLTAGERNQWAINRESFFKDGCNKESLEIIEKAAFMLVLEDEFQDYNPNDE-SKLDAFGHSLLHGKGHDRWYDKSFNMVVFKNGRVGFNAEHSWADAPIMAHYWEYILLEDILSPKFGYTPDGHCRGVGKSNNISPQKLQWKLSKMIELEIEKCLLTTSKLIEDIDLHIVPFSEFGRGFMKTCKVSPDGFIQMALQLAYYRDSESFCLTYEACMTRLFREGRTETVRSCSNASCEFVRSMENKDLSNSDKINYLQLASNKHQKLYRDAMTGKGVDRHIFCMYVISKYLNIESEFLQKALSVPWKLSTSQTPHTQLTKFDMRRYPNFLSAGGGFGPVTSDGYGVSYMMAGEDIIFFHISSNISCQKTDS 2420
            MAEAHQAVAF   V+ +GID  L+ +A K++  SG++SWKK   R++N F  G+YP+ P +WL +V  +  +     D S G+IEKI+  L     L      ++++L++S GLW A ++  ++ L  LL Y  WMYE     S  TK W+ LV I  G NP LYSYQ  LP+LP+P +  T+ ++L S+ PL+++EEY  +  LA +F+     ++Q+YL LK  W++NYVSDWWEE++YL  R  +M+NSNYY MD L +    +QAARAAN + A + + R++  EEL+PL+IQ  +P+CS QYE MF T R+P        +D + HY +S++IVV  +G +++V   +G + L+P ++E QFQNIL+    P    + +  LTAGER  WA  R+++F+ G N ++L+++E+AAF + L+D+ +     D  + LDA+G SLLHGK +DRW+DKSF  +VFKNG++G NAEHSWADAPI+ H WE++L  D    + GY  +G+C+G   SN   PQ+LQW++S+  +  I+  L     L +D+D H  PF EFG+G +K C+ SPD FIQ+ALQLA+YRD   FCLTYEA MTRLFREGRTETVRSC+  S +FV++M N   +N +++   +LA+ KHQ LYR AMTG G+DRH+FC+YV+SKYL ++S FL++ LS PW+LSTSQTP  Q+  FD+  +P ++S GGGFGPV  DGYGVSY++ GE++I FHISS  S  +T S
Sbjct:    1 MAEAHQAVAFQFTVTPEGIDLRLSHEALKQVYLSGLRSWKKKFARVKNSFITGVYPASPSSWLFVVIAIMGTLYARVDPSMGMIEKIKEHLPASSYLSHQGQSIVSALLFSTGLWFALIMTMRFILKQLLSYHGWMYEQHGKMSATTKLWLALVKIFSGRNPMLYSYQAVLPRLPVPGVKETVQRYLDSVRPLMNDEEYKRMTGLAKDFEVNLAPRLQWYLKLKSWWAANYVSDWWEEYIYLRGRGPIMVNSNYYAMDFLYVTPTPVQAARAANTVHAILLYRRKVTREELKPLMIQDCLPMCSAQYEHMFNTTRIP-----GVDTDTIQHYADSKHIVVYHKGRFFRVWVYQGGRLLNPKELELQFQNILNDPSPPQPGEEKLAALTAGERTAWAKARKTYFRSGKNLQALDLVERAAFFVTLQDDEEGLRTEDPVNSLDAYGKSLLHGKCYDRWFDKSFTFIVFKNGKIGLNAEHSWADAPIVGHMWEFVLATDCF--QLGYNEEGNCKGQVDSNLPVPQRLQWEISEECQEVIQSSLAVAQALADDVDFHTFPFKEFGKGLIKKCRTSPDAFIQIALQLAHYRDKGKFCLTYEASMTRLFREGRTETVRSCTVESSQFVKAMMNPSQTNEERLKLFRLAAEKHQMLYRHAMTGGGIDRHLFCLYVVSKYLGVDSPFLKEVLSEPWRLSTSQTPIQQVELFDLVNHPEYVSCGGGFGPVADDGYGVSYIIVGENLINFHISSKFSSHETVS 746          
BLAST of Carnitine O-palmitoyltransferase 1, liver isoform vs. Ensembl Xenopus
Match: rflcii (relaxin family locus C type II [Source:Xenbase;Acc:XB-GENE-5794248])

HSP 1 Score: 729.554 bits (1882), Expect = 0.000e+0
Identity = 356/773 (46.05%), Postives = 515/773 (66.62%), Query Frame = 3
Query:  165 MAEAHQAVAFSIKVSDDGIDWSLNFKAFKEIAKSGVKSWKKGLYRIQNRFYNGLYPSQPGNWLGIVCGVFASSM-VGFDLSFGLIEKIEVQLQRVLELESPRDHLIASLMYSCGLWTAGVIVRKYTLSNLLYYMDWMYESQTGPSMKTKAWMVLVTILGGGNPKLYSYQGXXXXXXXXXXXXTINKFLTSMEPLLSXXXXXXXXXXXXXXXXQHGFKIQFYLHLKYLWSSNYVSDWWEEFVYLSSRSSLMINSNYYGMDALMLRHEWIQAARAANLICASVQFMRELNTEELEPLVIQGKVPLCSRQYERMFCTVRVPRNISRKNRSDQLVHYRESRYIVVICRGNYYKVNFMKGDQYLDPVDMEKQFQNILDTAVQPNDPSQYIGVLTAGERNQWAINRESFFKDGCNKESLEIIEKAAFMLVLEDEFQDYNPNDE-SKLDAFGHSLLHGKGHDRWYDKSFNMVVFKNGRVGFNAEHSWADAPIMAHYWEYILLEDILSPKFGYTPDGHCRGVGKSNNISPQKLQWKLSKMIELEIEKCLLTTSKLIEDIDLHIVPFSEFGRGFMKTCKVSPDGFIQMALQLAYYRDSESFCLTYEACMTRLFREGRTETVRSCSNASCEFVRSMENKDLSNSDKINYLQLASNKHQKLYRDAMTGKGVDRHIFCMYVISKYLNIESEFLQKALSVPWKLSTSQTPHTQLTKFDMRRYPNFLSAGGGFGPVTSDGYGVSYMMAGEDIIFFHISSNISCQKTDSKRFANNLCQALLDIKKLFN 2477
            MAEAHQAVAF   V+ DGID  L+ +A ++I  SG+ SWKK   R +N    G++PS P +WL +V GV ++SM    D SFG+IEKI   L     +     ++++ +++  GLW + +   +Y+L  LL Y  WM+E     S  T+ WM +V +L G  P LYS+Q SLP+LP+P +  T+ ++L S++PL+ +E++  ++ LA +F    G ++Q+YL LK  W++NYVSDWWEE++YL  R  +M+NSNYY MD L +    IQAARA N I A + + R+L+ EE++PL++   +P+CS QYERMF + R+P        +D + H ++S++IVV  +G Y+KV      + L P ++E Q Q I+D    P    + +  LTAG+R  WA  R+++F +G NK+S++ +EKAAF + L++  Q YN  D  + LD++  SLLHGK +DRW+DK+ + VVFKNG++G N EHSWADAPI+ H WEY++  D +  + GY  DGHC+G    N   P +LQW + +  +  +E+ L     L +D+D H  PF+ FG+G +K  + SPD F+Q++LQLA+YRD E FCLTYEA MTRLFREGRTETVRSC+  SC+FV +M +   +NS  +   + A+ KHQ++YR AMTG G+DRH+FC+YV+SKYL ++S FL++ LS PW+LSTSQTP  Q+  F + ++P  +S+GGGFGPV  DGYGVSY++ GE++I FHISS  S  +TDS RF  ++ QA++DI  LFN
Sbjct:    1 MAEAHQAVAFQFTVTPDGIDLRLSHEALRQIYLSGLHSWKKKFIRFKNGILTGVFPSSPSSWLIVVVGVTSASMYTKVDPSFGIIEKINNALSATGYMTPQTQNIVSGVLFGTGLWVSLIATMRYSLKKLLSYHGWMFEEHGKLSASTRIWMGMVKLLSGRKPMLYSFQTSLPRLPVPPVKDTVKRYLDSVKPLMDKEKFERMEGLAKDFANNLGPRLQWYLKLKSWWATNYVSDWWEEYIYLRGRGPIMVNSNYYAMDFLYVLPTHIQAARAGNAIHAILLYRRKLDREEIKPLMVSSTIPMCSAQYERMFNSSRIP-----GIETDTIQHVKDSKHIVVYHKGRYFKVWLYHDGRLLKPREIEHQMQKIIDDTSSPQPGEEKLAALTAGDRVPWAKARKAYFANGKNKQSMDAVEKAAFFVTLDETEQGYNKEDPVNSLDSYAKSLLHGKCYDRWFDKTMSFVVFKNGKMGMNVEHSWADAPIVGHLWEYVMATDKM--ELGYNEDGHCKGDVNGNIPPPSRLQWDIPEECQNVVEESLTVAKALADDVDFHSFPFNSFGKGLIKKSRTSPDAFVQLSLQLAHYRDKEKFCLTYEASMTRLFREGRTETVRSCTIESCDFVLAMSDPSQTNSVLLQLFKEAAEKHQQMYRLAMTGSGIDRHLFCLYVVSKYLGVDSPFLKEVLSEPWRLSTSQTPQQQVHLFQLEKFPENVSSGGGFGPVADDGYGVSYIIVGENLINFHISSKFSSPETDSHRFGKHIKQAMIDILALFN 766          
BLAST of Carnitine O-palmitoyltransferase 1, liver isoform vs. Ensembl Xenopus
Match: rflcii (relaxin family locus C type II [Source:Xenbase;Acc:XB-GENE-5794248])

HSP 1 Score: 725.702 bits (1872), Expect = 0.000e+0
Identity = 357/780 (45.77%), Postives = 518/780 (66.41%), Query Frame = 3
Query:  165 MAEAHQAVAFSIKVSDDGIDWSLNFKAFKEIAKSGVKSWKKGLYRIQNRFYNGLYPSQPGNWLGIVCGVFASSM-VGFDLSFGLIEKIE------VQLQRVLELESPR-DHLIASLMYSCGLWTAGVIVRKYTLSNLLYYMDWMYESQTGPSMKTKAWMVLVTILGGGNPKLYSYQGXXXXXXXXXXXXTINKFLTSMEPLLSXXXXXXXXXXXXXXXXQHGFKIQFYLHLKYLWSSNYVSDWWEEFVYLSSRSSLMINSNYYGMDALMLRHEWIQAARAANLICASVQFMRELNTEELEPLVIQGKVPLCSRQYERMFCTVRVPRNISRKNRSDQLVHYRESRYIVVICRGNYYKVNFMKGDQYLDPVDMEKQFQNILDTAVQPNDPSQYIGVLTAGERNQWAINRESFFKDGCNKESLEIIEKAAFMLVLEDEFQDYNPNDE-SKLDAFGHSLLHGKGHDRWYDKSFNMVVFKNGRVGFNAEHSWADAPIMAHYWEYILLEDILSPKFGYTPDGHCRGVGKSNNISPQKLQWKLSKMIELEIEKCLLTTSKLIEDIDLHIVPFSEFGRGFMKTCKVSPDGFIQMALQLAYYRDSESFCLTYEACMTRLFREGRTETVRSCSNASCEFVRSMENKDLSNSDKINYLQLASNKHQKLYRDAMTGKGVDRHIFCMYVISKYLNIESEFLQKALSVPWKLSTSQTPHTQLTKFDMRRYPNFLSAGGGFGPVTSDGYGVSYMMAGEDIIFFHISSNISCQKTDSKRFANNLCQALLDIKKLFN 2477
            MAEAHQAVAF   V+ DGID  L+ +A ++I  SG+ SWKK   R +N    G++PS P +WL +V GV ++SM    D SFG+IEKI         L  V    +P+  ++++ +++  GLW + +   +Y+L  LL Y  WM+E     S  T+ WM +V +L G  P LYS+Q SLP+LP+P +  T+ ++L S++PL+ +E++  ++ LA +F    G ++Q+YL LK  W++NYVSDWWEE++YL  R  +M+NSNYY MD L +    IQAARA N I A + + R+L+ EE++PL++   +P+CS QYERMF + R+P        +D + H ++S++IVV  +G Y+KV      + L P ++E Q Q I+D    P    + +  LTAG+R  WA  R+++F +G NK+S++ +EKAAF + L++  Q YN  D  + LD++  SLLHGK +DRW+DK+ + VVFKNG++G N EHSWADAPI+ H WEY++  D +  + GY  DGHC+G    N   P +LQW + +  +  +E+ L     L +D+D H  PF+ FG+G +K  + SPD F+Q++LQLA+YRD E FCLTYEA MTRLFREGRTETVRSC+  SC+FV +M +   +N  ++   + A+ KHQ++YR AMTG G+DRH+FC+YV+SKYL ++S FL++ LS PW+LSTSQTP  Q+  F + ++P  +S+GGGFGPV  DGYGVSY++ GE++I FHISS  S  +TDS RF  ++ QA++DI  LFN
Sbjct:    1 MAEAHQAVAFQFTVTPDGIDLRLSHEALRQIYLSGLHSWKKKFIRFKNGILTGVFPSSPSSWLIVVVGVTSASMYTKVDPSFGIIEKINNVPYIYGHLPNVPGYMTPQTQNIVSGVLFGTGLWVSLIATMRYSLKKLLSYHGWMFEEHGKLSASTRIWMGMVKLLSGRKPMLYSFQTSLPRLPVPPVKDTVKRYLDSVKPLMDKEKFERMEGLAKDFANNLGPRLQWYLKLKSWWATNYVSDWWEEYIYLRGRGPIMVNSNYYAMDFLYVLPTHIQAARAGNAIHAILLYRRKLDREEIKPLMVSSTIPMCSAQYERMFNSSRIP-----GIETDTIQHVKDSKHIVVYHKGRYFKVWLYHDGRLLKPREIEHQMQKIIDDTSSPQPGEEKLAALTAGDRVPWAKARKAYFANGKNKQSMDAVEKAAFFVTLDETEQGYNKEDPVNSLDSYAKSLLHGKCYDRWFDKTMSFVVFKNGKMGMNVEHSWADAPIVGHLWEYVMATDKM--ELGYNEDGHCKGDVNGNIPPPSRLQWDIPEECQNVVEESLTVAKALADDVDFHSFPFNSFGKGLIKKSRTSPDAFVQLSLQLAHYRDKEKFCLTYEASMTRLFREGRTETVRSCTIESCDFVLAMSDPSQTNEKRLQLFKEAAEKHQQMYRLAMTGSGIDRHLFCLYVVSKYLGVDSPFLKEVLSEPWRLSTSQTPQQQVHLFQLEKFPENVSSGGGFGPVADDGYGVSYIIVGENLINFHISSKFSSPETDSHRFGKHIKQAMIDILALFN 773          
BLAST of Carnitine O-palmitoyltransferase 1, liver isoform vs. Ensembl Mouse
Match: Cpt1a (carnitine palmitoyltransferase 1a, liver [Source:MGI Symbol;Acc:MGI:1098296])

HSP 1 Score: 730.324 bits (1884), Expect = 0.000e+0
Identity = 360/773 (46.57%), Postives = 500/773 (64.68%), Query Frame = 3
Query:  165 MAEAHQAVAFSIKVSDDGIDWSLNFKAFKEIAKSGVKSWKKGLYRIQNRFYNGLYPSQPGNWLGIVCGVFASSMVGFDLSFGLIEKIEVQLQRVLELESPRDHLIASLMYSCGLWTAGVIVRKYTLSNLLYYMDWMYESQTGPSMKTKAWMVLVTILGGGNPKLYSYQGXXXXXXXXXXXXTINKFLTSMEPLLSXXXXXXXXXXXXXXXXQHGFKIQFYLHLKYLWSSNYVSDWWEEFVYLSSRSSLMINSNYYGMDALMLRHEWIQAARAANLICASVQFMRELNTEELEPLVIQGK-VPLCSRQYERMFCTVRVPRNISRKNRSDQLVHYRESRYIVVICRGNYYKVNFMKGDQYLDPVDMEKQFQNILDTAVQPNDPSQYIGVLTAGERNQWAINRESFFKDGCNKESLEIIEKAAFMLVLEDEFQDYNPND-ESKLDAFGHSLLHGKGHDRWYDKSFNMVVFKNGRVGFNAEHSWADAPIMAHYWEYILLEDILSPKFGYTPDGHCRGVGKSNNISPQKLQWKLSKMIELEIEKCLLTTSKLIEDIDLHIVPFSEFGRGFMKTCKVSPDGFIQMALQLAYYRDSESFCLTYEACMTRLFREGRTETVRSCSNASCEFVRSMENKDLSNSDKINYLQLASNKHQKLYRDAMTGKGVDRHIFCMYVISKYLNIESEFLQKALSVPWKLSTSQTPHTQLTKFDMRRYPNFLSAGGGFGPVTSDGYGVSYMMAGEDIIFFHISSNISCQKTDSKRFANNLCQALLDIKKLFN 2477
            MAEAHQAVAF   V+ DGID  L+ +A K+I  SG+ SWKK   R +N    G++P+ P +WL +V GV +S     D S G+I KI   L     + S   ++++ +++  GLW A ++  +Y+L  LL Y  WM+      S  T+ WM +V +  G  P LYS+Q SLP+LP+P +  T++++L S+ PL+ E ++  +  LA +F    G K+Q+YL LK  W++NYVSDWWEE++YL  R  +M+NSNYY M+ L +    IQAARA N I A + + R ++ EEL+P+ + G  +PLCS Q+ER+F T R+P        +D + H ++SR+IVV  RG Y+KV      + L P ++E+Q Q ILD   +P      +  LTA +R  WA  R+++F  G NK+SL+ +EKAAF + L++  Q Y   D E+ +D++  SLLHG+  DRW+DKS   VVFKN ++G NAEHSWADAPI+ H WEY++  D+   + GY+ DGHC+G    N   P +LQW +    +  IE  L + S L  D+DLH  PF  FG+G +K C+ SPD FIQ+ALQLA+Y+D   FCLTYEA MTRLFREGRTETVRSC+  SC FV +M +   +   +    ++A  KHQ LYR AMTG G+DRH+FC+YV+SKYL ++S FL++ LS PW+LSTSQTP  Q+  FD  +YP+++S GGGFGPV  DGYGVSY++ GE+ I FHISS  S  +TDS RF  +L QA++DI  LF 
Sbjct:    1 MAEAHQAVAFQFTVTPDGIDLRLSHEALKQICLSGLHSWKKKFIRFKNGIITGVFPASPSSWLIVVVGVISSMHTKVDPSLGMIAKINRTLDTTGRMSSQTKNIVSGVLFGTGLWVAIIMTMRYSLKVLLSYHGWMFAEHGKMSRSTRIWMAMVKVFSGRKPMLYSFQTSLPRLPVPAVKDTVSRYLESVRPLMKEGDFQRMTALAQDFAVNLGPKLQWYLKLKSWWATNYVSDWWEEYIYLRGRGPIMVNSNYYAMEMLYITPTHIQAARAGNTIHAILLYRRTVDREELKPIRLLGSTIPLCSAQWERLFNTSRIP-----GEETDTIQHVKDSRHIVVYHRGRYFKVWLYHDGRLLRPRELEQQMQQILDDTSEPQPGEAKLAALTAADRVPWAKCRQTYFARGKNKQSLDAVEKAAFFVTLDESEQGYREEDPEASIDSYAKSLLHGRCFDRWFDKSITFVVFKNSKIGINAEHSWADAPIVGHLWEYVMATDVF--QLGYSEDGHCKGDKNPNIPKPTRLQWDIPGECQEVIETSLSSASFLANDVDLHSFPFDTFGKGLIKKCRTSPDAFIQLALQLAHYKDMGKFCLTYEASMTRLFREGRTETVRSCTTESCNFVLAMMDPTTTAEQRFKLFKIACEKHQHLYRLAMTGAGIDRHLFCLYVVSKYLAVDSPFLKEVLSEPWRLSTSQTPQQQVELFDFEKYPDYVSCGGGFGPVADDGYGVSYIIVGENFIHFHISSKFSSPETDSHRFGKHLRQAMMDIITLFG 766          
BLAST of Carnitine O-palmitoyltransferase 1, liver isoform vs. Ensembl Mouse
Match: Cpt1b (carnitine palmitoyltransferase 1b, muscle [Source:MGI Symbol;Acc:MGI:1098297])

HSP 1 Score: 717.998 bits (1852), Expect = 0.000e+0
Identity = 362/773 (46.83%), Postives = 506/773 (65.46%), Query Frame = 3
Query:  165 MAEAHQAVAFSIKVSDDGIDWSLNFKAFKEIAKSGVKSWKKGLYRIQNRFYNGLYPSQPGNWLGIVCGVFASSMVGFDLSFGLIEKIEVQL-QRVLELESPR-DHLIASLMYSCGLWTAGVIVRKYTLSNLLYYMDWMYESQTGPSMKTKAWMVLVTILGGGNPKLYSYQGXXXXXXXXXXXXTINKFLTSMEPLLSXXXXXXXXXXXXXXXXQHGFKIQFYLHLKYLWSSNYVSDWWEEFVYLSSRSSLMINSNYYGMDALMLRHEWIQAARAANLICASVQFMRELNTEELEPLVIQGKVPLCSRQYERMFCTVRVPRNISRKNRSDQLVHYRESRYIVVICRGNYYKVNFMKGDQYLDPVDMEKQFQNILDTAVQPNDPSQYIGVLTAGERNQWAINRESFFKDGCNKESLEIIEKAAFMLVLEDEFQDYNPNDESKLDAFGHSLLHGKGHDRWYDKSFNMVVFKNGRVGFNAEHSWADAPIMAHYWEYILLEDILSPKFGYTPDGHCRGVGKSNNISPQKLQWKLSKMIELEIEKCLLTTSKLIEDIDLHIVPFSEFGRGFMKTCKVSPDGFIQMALQLAYYRDSESFCLTYEACMTRLFREGRTETVRSCSNASCEFVRSMENKDLSNSDKINYLQLASNKHQKLYRDAMTGKGVDRHIFCMYVISKYLNIESEFLQKALSVPWKLSTSQTPHTQLTKFDMRRYPNFLSAGGGFGPVTSDGYGVSYMMAGEDIIFFHISSNISCQKTDSKRFANNLCQALLDIKKLFN 2477
            MAEAHQAVAF   V+ DG+D+ L+ +A + I  SG+ SWKK L RI+N    G+YP  P +WL +V     S+    D+S GL++ I+  L +R     +P+ + L++ +++S G+W  G+   + TL  LL Y  WM+E  +  S  TK W + V +L    P LYS+Q SLPKLP+P + +TI+++L S+ PLL +E Y+ ++ LA EF+ +   ++Q YL LK  W++NYVSDWWEE+VYL SRS LM+NSNYY MD +++++  +QAAR  N + A + + R+L+ EE++P++  G VP+CS Q ERMF T R+P        +D L H  ESR++ V  +G ++KV   +G + L P D+E QFQ ILD    P    + +  LTAG R +WA  R++FF  G NK SL+ IE+AAF + L+++   YNP+DE+ L  +G +LLHG  ++RW+DKSF ++  KNG +G N EHSWADAPI+ H WE++L  D      GYT  GHC G   +    PQ+L W + +     IE        L +D++L+   F  FG+G +K C+ SPD F+Q+ALQLA++RD   FCLTYEA MTR+FREGRTETVRSC+N S  FV++M        D  +  + AS KHQ +YR AMTG G+DRH+FC+Y++SKYL + S FL + LS PW LSTSQ P  Q+  FD ++YPN L AGGGFGPV  DGYGVSYM+AGE+ +FFHISS  S  +T+++RF N++ QALLDI +LF 
Sbjct:    1 MAEAHQAVAFQFTVTPDGVDFRLSREALRHIYLSGINSWKKRLIRIKNGILRGVYPGSPTSWLVVVMATVGSNYCKVDISMGLVDCIQRCLPERYGHFGTPQTEALLSMVIFSTGVWATGIFFFRQTLKLLLSYHGWMFEMHSKTSHATKIWAICVRLLSSRRPMLYSFQTSLPKLPVPSVPATIHRYLDSVRPLLDDEAYYRMETLAKEFQDKTAPRLQKYLVLKSWWATNYVSDWWEEYVYLRSRSPLMVNSNYYAMDFVLIKNTNVQAARLGNAVHAMIMYRRKLDREEIKPVMALGMVPMCSYQMERMFNTTRIP-----GKETDLLQHLSESRHVAVYHKGRFFKVWLYEGSRLLKPRDLEMQFQRILDDPSPPQPGEEKLAALTAGGRVEWAEARQTFFSSGKNKMSLDAIERAAFFVTLDEDSHCYNPDDETSLSLYGKALLHGNCYNRWFDKSFTLISCKNGLLGLNTEHSWADAPIIGHLWEFVLGTDTF--HLGYTETGHCVGEPNTTLPPPQRLPWDIPEQCREAIENSYQVAKALADDVELYCFQFLPFGKGLIKKCRTSPDAFVQIALQLAHFRDKGKFCLTYEASMTRMFREGRTETVRSCTNESAAFVQAMMKGSHKKQDLQDLFRKASEKHQNMYRLAMTGAGIDRHLFCLYIVSKYLGVSSPFLAEVLSEPWSLSTSQIPQFQICMFDPKQYPNHLGAGGGFGPVADDGYGVSYMIAGENTMFFHISSKYSSSETNAQRFGNHIRQALLDIAELFK 766          
BLAST of Carnitine O-palmitoyltransferase 1, liver isoform vs. Ensembl Mouse
Match: Cpt1c (carnitine palmitoyltransferase 1c [Source:MGI Symbol;Acc:MGI:2446526])

HSP 1 Score: 610.142 bits (1572), Expect = 0.000e+0
Identity = 320/771 (41.50%), Postives = 462/771 (59.92%), Query Frame = 3
Query:  165 MAEAHQAVAFSIKVSDDGIDWSLNFKAFKEIAKSGVKSWKKGLYRIQNRFYNGLYPSQPGNWLGIVCGVFASSMVGFDLSFGLIEKIEVQLQRVLELESPRDHLIASLMYSCGLWTAGVIVRKYTLSNLLYYMDWMYESQTGPSMKTKAWMVLVTILGGGNPKLYSYQGXXXXXXXXXXXXTINKFLTSMEPLLSXXXXXXXXXXXXXXXXQHGFKIQFYLHLKYLWSSNYVSDWWEEFVYLSSRSSLMINSNYYGMDALMLRHEWIQAARAANLICASVQFMRELNTEELEPLVIQGKVPLCSRQYERMFCTVRVPRNISRKNRSDQLVHYRESRYIVVICRGNYYKVNFMKGDQYLDPVDMEKQFQNILDTAVQPNDPSQYIGVLTAGERNQWAINRESFFKDGCNKESLEIIEKAAFMLVLEDEFQDYNPNDES-KLDAFGHSLLHGKGHDRWYDKSFNMVVFKNGRVGFNAEHSWADAPIMAHYWEYILLEDILSPKFGYTPDGHCRGVGKSNNISPQKLQWKLSKMIELEIEKCLLTTSKLIEDIDLHIVPFSEFGRGFMKTCKVSPDGFIQMALQLAYYRDSESFCLTYEACMTRLFREGRTETVRSCSNASCEFVRSMENKDLSNSDKINYLQLASNKHQKLYRDAMTGKGVDRHIFCMYVISKYLNIESEFLQKALSVPWKLSTSQTPHTQLTKFDMRRYPNFLSAGGGFGPVTSDGYGVSYMMAGEDIIFFHISSNISCQKTDSKRFANNLCQALLDIKKLF 2474
            MAEAHQA +    +S DG +  L+   ++EI    ++SWK+ L+R+ N F  G+ P+ P +WL +   +  + ++  D S GL+EKI+  L             +++ +++  LW A +      L  LL +  W+ E     S  TK W+ LV I  G +P+L+S+Q +LP+ P+P    T+ K+L S+ P+L ++ +     LA +F + H  ++Q YL LK   +SNYVSDWWEEFVYL SR SL INS YY MD L +    +QAARA N +   + +   LN +E+ P ++ G  PLCS QYERMF T R+P         D L H ++SR++ V  RG +++V     +  L P  +E+QFQ+ILD         +++  LTA  R+ WA  RES         +LE +E AAF + L+ E       D +  LDA+ H+LL G+GHDRW+DKSF ++VF NG++G + EHSWAD P+  H WE+ L  +    + GY  DGHC+G        PQ+LQW L + I+  I   L     L  +ID H+ PFS FG+ F+K C VS D FIQ+ LQLA++RD   FCLTYE+ MTRLF EGRTETVRSC+  +C+FVR+M+NK+ ++   +   ++A +KHQ L + AM+G+G+DRH+F +Y++S+ L+++S FL +  S  W LSTSQ P  Q    D+  YP+++S+GGGFGP    GYG+SY+  GE+ I FHISS  S  +TDS R   ++  ALLD+  LF
Sbjct:    1 MAEAHQASSLLSSLSSDGAEVELSSPVWQEIYLCALRSWKRHLWRVWNDFLAGVVPATPLSWLFLFSTIQLACLLQLDPSLGLMEKIKELLPDWGGQHHQLQGFLSAAVFASCLWGALIFTLHVALRLLLSHHGWLLEPHGAMSSPTKTWLALVRIFSGRHPRLFSFQRALPRQPVPSAQETVRKYLESVRPVLGDDAFDRATALANDFLRLHAPRLQLYLQLKSWCTSNYVSDWWEEFVYLRSRGSL-INSTYYMMDFLYVTPTPLQAARAGNAVHTLLLYRHLLNRQEISPTLLMGMRPLCSAQYERMFNTTRIP-----GVEKDHLRHLQDSRHVAVFHRGRFFRVGTHSPNGLLSPRALEQQFQDILDDPSPACPLEEHLAALTAAPRSMWAQVRESVKTHAAT--ALEAVEGAAFFVSLDSEPAGLTREDPAASLDAYAHALLAGRGHDRWFDKSFTLIVFSNGKLGLSVEHSWADCPVSGHLWEFTLATECF--QLGYATDGHCKGHPDPTLPQPQRLQWDLPEQIQPSISLALRGAKTLSGNIDCHVFPFSHFGKSFIKCCHVSSDSFIQLVLQLAHFRDRGQFCLTYESAMTRLFLEGRTETVRSCTREACQFVRAMDNKE-TDQHCLALFRVAVDKHQALLKAAMSGQGIDRHLFALYIMSRLLHMQSPFLTQVQSQQWLLSTSQVPVQQTHLIDVHNYPDYVSSGGGFGPAHDHGYGISYIFMGENAITFHISSKKSSTETDSHRLGQHIENALLDVASLF 760          
BLAST of Carnitine O-palmitoyltransferase 1, liver isoform vs. Ensembl Mouse
Match: Cpt1c (carnitine palmitoyltransferase 1c [Source:MGI Symbol;Acc:MGI:2446526])

HSP 1 Score: 610.142 bits (1572), Expect = 0.000e+0
Identity = 320/771 (41.50%), Postives = 462/771 (59.92%), Query Frame = 3
Query:  165 MAEAHQAVAFSIKVSDDGIDWSLNFKAFKEIAKSGVKSWKKGLYRIQNRFYNGLYPSQPGNWLGIVCGVFASSMVGFDLSFGLIEKIEVQLQRVLELESPRDHLIASLMYSCGLWTAGVIVRKYTLSNLLYYMDWMYESQTGPSMKTKAWMVLVTILGGGNPKLYSYQGXXXXXXXXXXXXTINKFLTSMEPLLSXXXXXXXXXXXXXXXXQHGFKIQFYLHLKYLWSSNYVSDWWEEFVYLSSRSSLMINSNYYGMDALMLRHEWIQAARAANLICASVQFMRELNTEELEPLVIQGKVPLCSRQYERMFCTVRVPRNISRKNRSDQLVHYRESRYIVVICRGNYYKVNFMKGDQYLDPVDMEKQFQNILDTAVQPNDPSQYIGVLTAGERNQWAINRESFFKDGCNKESLEIIEKAAFMLVLEDEFQDYNPNDES-KLDAFGHSLLHGKGHDRWYDKSFNMVVFKNGRVGFNAEHSWADAPIMAHYWEYILLEDILSPKFGYTPDGHCRGVGKSNNISPQKLQWKLSKMIELEIEKCLLTTSKLIEDIDLHIVPFSEFGRGFMKTCKVSPDGFIQMALQLAYYRDSESFCLTYEACMTRLFREGRTETVRSCSNASCEFVRSMENKDLSNSDKINYLQLASNKHQKLYRDAMTGKGVDRHIFCMYVISKYLNIESEFLQKALSVPWKLSTSQTPHTQLTKFDMRRYPNFLSAGGGFGPVTSDGYGVSYMMAGEDIIFFHISSNISCQKTDSKRFANNLCQALLDIKKLF 2474
            MAEAHQA +    +S DG +  L+   ++EI    ++SWK+ L+R+ N F  G+ P+ P +WL +   +  + ++  D S GL+EKI+  L             +++ +++  LW A +      L  LL +  W+ E     S  TK W+ LV I  G +P+L+S+Q +LP+ P+P    T+ K+L S+ P+L ++ +     LA +F + H  ++Q YL LK   +SNYVSDWWEEFVYL SR SL INS YY MD L +    +QAARA N +   + +   LN +E+ P ++ G  PLCS QYERMF T R+P         D L H ++SR++ V  RG +++V     +  L P  +E+QFQ+ILD         +++  LTA  R+ WA  RES         +LE +E AAF + L+ E       D +  LDA+ H+LL G+GHDRW+DKSF ++VF NG++G + EHSWAD P+  H WE+ L  +    + GY  DGHC+G        PQ+LQW L + I+  I   L     L  +ID H+ PFS FG+ F+K C VS D FIQ+ LQLA++RD   FCLTYE+ MTRLF EGRTETVRSC+  +C+FVR+M+NK+ ++   +   ++A +KHQ L + AM+G+G+DRH+F +Y++S+ L+++S FL +  S  W LSTSQ P  Q    D+  YP+++S+GGGFGP    GYG+SY+  GE+ I FHISS  S  +TDS R   ++  ALLD+  LF
Sbjct:    1 MAEAHQASSLLSSLSSDGAEVELSSPVWQEIYLCALRSWKRHLWRVWNDFLAGVVPATPLSWLFLFSTIQLACLLQLDPSLGLMEKIKELLPDWGGQHHQLQGFLSAAVFASCLWGALIFTLHVALRLLLSHHGWLLEPHGAMSSPTKTWLALVRIFSGRHPRLFSFQRALPRQPVPSAQETVRKYLESVRPVLGDDAFDRATALANDFLRLHAPRLQLYLQLKSWCTSNYVSDWWEEFVYLRSRGSL-INSTYYMMDFLYVTPTPLQAARAGNAVHTLLLYRHLLNRQEISPTLLMGMRPLCSAQYERMFNTTRIP-----GVEKDHLRHLQDSRHVAVFHRGRFFRVGTHSPNGLLSPRALEQQFQDILDDPSPACPLEEHLAALTAAPRSMWAQVRESVKTHAAT--ALEAVEGAAFFVSLDSEPAGLTREDPAASLDAYAHALLAGRGHDRWFDKSFTLIVFSNGKLGLSVEHSWADCPVSGHLWEFTLATECF--QLGYATDGHCKGHPDPTLPQPQRLQWDLPEQIQPSISLALRGAKTLSGNIDCHVFPFSHFGKSFIKCCHVSSDSFIQLVLQLAHFRDRGQFCLTYESAMTRLFLEGRTETVRSCTREACQFVRAMDNKE-TDQHCLALFRVAVDKHQALLKAAMSGQGIDRHLFALYIMSRLLHMQSPFLTQVQSQQWLLSTSQVPVQQTHLIDVHNYPDYVSSGGGFGPAHDHGYGISYIFMGENAITFHISSKKSSTETDSHRLGQHIENALLDVASLF 760          
BLAST of Carnitine O-palmitoyltransferase 1, liver isoform vs. Ensembl Mouse
Match: Cpt1a (carnitine palmitoyltransferase 1a, liver [Source:MGI Symbol;Acc:MGI:1098296])

HSP 1 Score: 304.294 bits (778), Expect = 1.330e-94
Identity = 164/404 (40.59%), Postives = 244/404 (60.40%), Query Frame = 3
Query:  165 MAEAHQAVAFSIKVSDDGIDWSLNFKAFKEIAKSGVKSWKKGLYRIQNRFYNGLYPSQPGNWLGIVCGVFASSMVGFDLSFGLIEKIEVQLQRVLELESPRDHLIASLMYSCGLWTAGVIVRKYTLSNLLYYMDWMYESQTGPSMKTKAWMVLVTILGGGNPKLYSYQGXXXXXXXXXXXXTINKFLTSMEPLLSXXXXXXXXXXXXXXXXQHGFKIQFYLHLKYLWSSNYVSDWWEEFVYLSSRSSLMINSNYYGMDALMLRHEWIQAARAANLICASVQFMRELNTEELEPLVIQGK-VPLCSRQYERMFCTVRVPRNISRKNRSDQLVHYRESRYIVVICRGNYYKVNFMKGDQYLDPVDMEKQFQNILDTAVQPNDPSQYIGVLTAGERNQWAINRESFF 1373
            MAEAHQAVAF   V+ DGID  L+ +A K+I  SG+ SWKK   R +N    G++P+ P +WL +V GV +S     D S G+I KI   L     + S   ++++ +++  GLW A ++  +Y+L  LL Y  WM+      S  T+ WM +V +  G  P LYS+Q SLP+LP+P +  T++++L S+ PL+ E ++  +  LA +F    G K+Q+YL LK  W++NYVSDWWEE++YL  R  +M+NSNYY M+ L +    IQAARA N I A + + R ++ EEL+P+ + G  +PLCS Q+ER+F T R+P        +D + H ++SR+IVV  RG Y+KV      + L P ++E+Q Q ILD   +P      +  LTA +R  WA  R+++F
Sbjct:    1 MAEAHQAVAFQFTVTPDGIDLRLSHEALKQICLSGLHSWKKKFIRFKNGIITGVFPASPSSWLIVVVGVISSMHTKVDPSLGMIAKINRTLDTTGRMSSQTKNIVSGVLFGTGLWVAIIMTMRYSLKVLLSYHGWMFAEHGKMSRSTRIWMAMVKVFSGRKPMLYSFQTSLPRLPVPAVKDTVSRYLESVRPLMKEGDFQRMTALAQDFAVNLGPKLQWYLKLKSWWATNYVSDWWEEYIYLRGRGPIMVNSNYYAMEMLYITPTHIQAARAGNTIHAILLYRRTVDREELKPIRLLGSTIPLCSAQWERLFNTSRIP-----GEETDTIQHVKDSRHIVVYHRGRYFKVWLYHDGRLLRPRELEQQMQQILDDTSEPQPGEAKLAALTAADRVPWAKCRQTYF 399          
BLAST of Carnitine O-palmitoyltransferase 1, liver isoform vs. UniProt/SwissProt
Match: sp|P50416|CPT1A_HUMAN (Carnitine O-palmitoyltransferase 1, liver isoform OS=Homo sapiens OX=9606 GN=CPT1A PE=1 SV=2)

HSP 1 Score: 739.184 bits (1907), Expect = 0.000e+0
Identity = 369/773 (47.74%), Postives = 509/773 (65.85%), Query Frame = 3
Query:  165 MAEAHQAVAFSIKVSDDGIDWSLNFKAFKEIAKSGVKSWKKGLYRIQNRFYNGLYPSQPGNWLGIVCGVFASSMVGFDLSFGLIEKIEVQLQRVLELESPRDHLIASLMYSCGLWTAGVIVRKYTLSNLLYYMDWMYESQTGPSMKTKAWMVLVTILGGGNPKLYSYQGXXXXXXXXXXXXTINKFLTSMEPLLSXXXXXXXXXXXXXXXXQHGFKIQFYLHLKYLWSSNYVSDWWEEFVYLSSRSSLMINSNYYGMDALMLRHEWIQAARAANLICASVQFMRELNTEELEPLVIQGK-VPLCSRQYERMFCTVRVPRNISRKNRSDQLVHYRESRYIVVICRGNYYKVNFMKGDQYLDPVDMEKQFQNILDTAVQPNDPSQYIGVLTAGERNQWAINRESFFKDGCNKESLEIIEKAAFMLVLEDEFQDYNPND-ESKLDAFGHSLLHGKGHDRWYDKSFNMVVFKNGRVGFNAEHSWADAPIMAHYWEYILLEDILSPKFGYTPDGHCRGVGKSNNISPQKLQWKLSKMIELEIEKCLLTTSKLIEDIDLHIVPFSEFGRGFMKTCKVSPDGFIQMALQLAYYRDSESFCLTYEACMTRLFREGRTETVRSCSNASCEFVRSMENKDLSNSDKINYLQLASNKHQKLYRDAMTGKGVDRHIFCMYVISKYLNIESEFLQKALSVPWKLSTSQTPHTQLTKFDMRRYPNFLSAGGGFGPVTSDGYGVSYMMAGEDIIFFHISSNISCQKTDSKRFANNLCQALLDIKKLFN 2477
            MAEAHQAVAF   V+ DGID  L+ +A ++I  SG+ SWKK   R +N    G+YP+ P +WL +V GV  +     D S G+I KI   L+    + S   ++++ +++  GLW A ++  +Y+L  LL Y  WM+      S  TK WM +V I  G  P LYS+Q SLP+LP+P +  T+N++L S+ PL+ EE++  +  LA +F    G ++Q+YL LK  W++NYVSDWWEE++YL  R  LM+NSNYY MD L +    IQAARA N I A + + R+L+ EE++P+ + G  +PLCS Q+ERMF T R+P        +D + H R+S++IVV  RG Y+KV      + L P +ME+Q Q ILD   +P      +  LTAG+R  WA  R+++F  G NK+SL+ +EKAAF + L++  + Y   D ++ +D++  SLLHG+ +DRW+DKSF  VVFKNG++G NAEHSWADAPI+AH WEY++  D L  + GY  DGHC+G    N   P +LQW +    +  IE  L T + L  D+D H  PF  FG+G +K C+ SPD F+Q+ALQLA+Y+D   FCLTYEA MTRLFREGRTETVRSC+  SC+FVR+M +   +   ++   +LAS KHQ +YR AMTG G+DRH+FC+YV+SKYL +ES FL++ LS PW+LSTSQTP  Q+  FD+   P ++S+GGGFGPV  DGYGVSY++ GE++I FHISS  SC +TDS RF  +L +A+ DI  LF 
Sbjct:    1 MAEAHQAVAFQFTVTPDGIDLRLSHEALRQIYLSGLHSWKKKFIRFKNGIITGVYPASPSSWLIVVVGVMTTMYAKIDPSLGIIAKINRTLETANCMSSQTKNVVSGVLFGTGLWVALIVTMRYSLKVLLSYHGWMFTEHGKMSRATKIWMGMVKIFSGRKPMLYSFQTSLPRLPVPAVKDTVNRYLQSVRPLMKEEDFKRMTALAQDFAVGLGPRLQWYLKLKSWWATNYVSDWWEEYIYLRGRGPLMVNSNYYAMDLLYILPTHIQAARAGNAIHAILLYRRKLDREEIKPIRLLGSTIPLCSAQWERMFNTSRIP-----GEETDTIQHMRDSKHIVVYHRGRYFKVWLYHDGRLLKPREMEQQMQRILDNTSEPQPGEARLAALTAGDRVPWARCRQAYFGRGKNKQSLDAVEKAAFFVTLDETEEGYRSEDPDTSMDSYAKSLLHGRCYDRWFDKSFTFVVFKNGKMGLNAEHSWADAPIVAHLWEYVMSIDSL--QLGYAEDGHCKGDINPNIPYPTRLQWDIPGECQEVIETSLNTANLLANDVDFHSFPFVAFGKGIIKKCRTSPDAFVQLALQLAHYKDMGKFCLTYEASMTRLFREGRTETVRSCTTESCDFVRAMVDPAQTVEQRLKLFKLASEKHQHMYRLAMTGSGIDRHLFCLYVVSKYLAVESPFLKEVLSEPWRLSTSQTPQQQVELFDLENNPEYVSSGGGFGPVADDGYGVSYILVGENLINFHISSKFSCPETDSHRFGRHLKEAMTDIITLFG 766          
BLAST of Carnitine O-palmitoyltransferase 1, liver isoform vs. UniProt/SwissProt
Match: sp|P97742|CPT1A_MOUSE (Carnitine O-palmitoyltransferase 1, liver isoform OS=Mus musculus OX=10090 GN=Cpt1a PE=1 SV=4)

HSP 1 Score: 730.324 bits (1884), Expect = 0.000e+0
Identity = 360/773 (46.57%), Postives = 500/773 (64.68%), Query Frame = 3
Query:  165 MAEAHQAVAFSIKVSDDGIDWSLNFKAFKEIAKSGVKSWKKGLYRIQNRFYNGLYPSQPGNWLGIVCGVFASSMVGFDLSFGLIEKIEVQLQRVLELESPRDHLIASLMYSCGLWTAGVIVRKYTLSNLLYYMDWMYESQTGPSMKTKAWMVLVTILGGGNPKLYSYQGXXXXXXXXXXXXTINKFLTSMEPLLSXXXXXXXXXXXXXXXXQHGFKIQFYLHLKYLWSSNYVSDWWEEFVYLSSRSSLMINSNYYGMDALMLRHEWIQAARAANLICASVQFMRELNTEELEPLVIQGK-VPLCSRQYERMFCTVRVPRNISRKNRSDQLVHYRESRYIVVICRGNYYKVNFMKGDQYLDPVDMEKQFQNILDTAVQPNDPSQYIGVLTAGERNQWAINRESFFKDGCNKESLEIIEKAAFMLVLEDEFQDYNPND-ESKLDAFGHSLLHGKGHDRWYDKSFNMVVFKNGRVGFNAEHSWADAPIMAHYWEYILLEDILSPKFGYTPDGHCRGVGKSNNISPQKLQWKLSKMIELEIEKCLLTTSKLIEDIDLHIVPFSEFGRGFMKTCKVSPDGFIQMALQLAYYRDSESFCLTYEACMTRLFREGRTETVRSCSNASCEFVRSMENKDLSNSDKINYLQLASNKHQKLYRDAMTGKGVDRHIFCMYVISKYLNIESEFLQKALSVPWKLSTSQTPHTQLTKFDMRRYPNFLSAGGGFGPVTSDGYGVSYMMAGEDIIFFHISSNISCQKTDSKRFANNLCQALLDIKKLFN 2477
            MAEAHQAVAF   V+ DGID  L+ +A K+I  SG+ SWKK   R +N    G++P+ P +WL +V GV +S     D S G+I KI   L     + S   ++++ +++  GLW A ++  +Y+L  LL Y  WM+      S  T+ WM +V +  G  P LYS+Q SLP+LP+P +  T++++L S+ PL+ E ++  +  LA +F    G K+Q+YL LK  W++NYVSDWWEE++YL  R  +M+NSNYY M+ L +    IQAARA N I A + + R ++ EEL+P+ + G  +PLCS Q+ER+F T R+P        +D + H ++SR+IVV  RG Y+KV      + L P ++E+Q Q ILD   +P      +  LTA +R  WA  R+++F  G NK+SL+ +EKAAF + L++  Q Y   D E+ +D++  SLLHG+  DRW+DKS   VVFKN ++G NAEHSWADAPI+ H WEY++  D+   + GY+ DGHC+G    N   P +LQW +    +  IE  L + S L  D+DLH  PF  FG+G +K C+ SPD FIQ+ALQLA+Y+D   FCLTYEA MTRLFREGRTETVRSC+  SC FV +M +   +   +    ++A  KHQ LYR AMTG G+DRH+FC+YV+SKYL ++S FL++ LS PW+LSTSQTP  Q+  FD  +YP+++S GGGFGPV  DGYGVSY++ GE+ I FHISS  S  +TDS RF  +L QA++DI  LF 
Sbjct:    1 MAEAHQAVAFQFTVTPDGIDLRLSHEALKQICLSGLHSWKKKFIRFKNGIITGVFPASPSSWLIVVVGVISSMHTKVDPSLGMIAKINRTLDTTGRMSSQTKNIVSGVLFGTGLWVAIIMTMRYSLKVLLSYHGWMFAEHGKMSRSTRIWMAMVKVFSGRKPMLYSFQTSLPRLPVPAVKDTVSRYLESVRPLMKEGDFQRMTALAQDFAVNLGPKLQWYLKLKSWWATNYVSDWWEEYIYLRGRGPIMVNSNYYAMEMLYITPTHIQAARAGNTIHAILLYRRTVDREELKPIRLLGSTIPLCSAQWERLFNTSRIP-----GEETDTIQHVKDSRHIVVYHRGRYFKVWLYHDGRLLRPRELEQQMQQILDDTSEPQPGEAKLAALTAADRVPWAKCRQTYFARGKNKQSLDAVEKAAFFVTLDESEQGYREEDPEASIDSYAKSLLHGRCFDRWFDKSITFVVFKNSKIGINAEHSWADAPIVGHLWEYVMATDVF--QLGYSEDGHCKGDKNPNIPKPTRLQWDIPGECQEVIETSLSSASFLANDVDLHSFPFDTFGKGLIKKCRTSPDAFIQLALQLAHYKDMGKFCLTYEASMTRLFREGRTETVRSCTTESCNFVLAMMDPTTTAEQRFKLFKIACEKHQHLYRLAMTGAGIDRHLFCLYVVSKYLAVDSPFLKEVLSEPWRLSTSQTPQQQVELFDFEKYPDYVSCGGGFGPVADDGYGVSYIIVGENFIHFHISSKFSSPETDSHRFGKHLRQAMMDIITLFG 766          
BLAST of Carnitine O-palmitoyltransferase 1, liver isoform vs. UniProt/SwissProt
Match: sp|Q68Y62|CPT1A_HORSE (Carnitine O-palmitoyltransferase 1, liver isoform OS=Equus caballus OX=9796 GN=CPT1A PE=2 SV=1)

HSP 1 Score: 727.628 bits (1877), Expect = 0.000e+0
Identity = 364/773 (47.09%), Postives = 504/773 (65.20%), Query Frame = 3
Query:  165 MAEAHQAVAFSIKVSDDGIDWSLNFKAFKEIAKSGVKSWKKGLYRIQNRFYNGLYPSQPGNWLGIVCGVFASSMVGFDLSFGLIEKIEVQLQRVLELESPRDHLIASLMYSCGLWTAGVIVRKYTLSNLLYYMDWMYESQTGPSMKTKAWMVLVTILGGGNPKLYSYQGXXXXXXXXXXXXTINKFLTSMEPLLSXXXXXXXXXXXXXXXXQHGFKIQFYLHLKYLWSSNYVSDWWEEFVYLSSRSSLMINSNYYGMDALMLRHEWIQAARAANLICASVQFMRELNTEELEPLVIQGK-VPLCSRQYERMFCTVRVPRNISRKNRSDQLVHYRESRYIVVICRGNYYKVNFMKGDQYLDPVDMEKQFQNILDTAVQPNDPSQYIGVLTAGERNQWAINRESFFKDGCNKESLEIIEKAAFMLVLEDEFQDYNPND-ESKLDAFGHSLLHGKGHDRWYDKSFNMVVFKNGRVGFNAEHSWADAPIMAHYWEYILLEDILSPKFGYTPDGHCRGVGKSNNISPQKLQWKLSKMIELEIEKCLLTTSKLIEDIDLHIVPFSEFGRGFMKTCKVSPDGFIQMALQLAYYRDSESFCLTYEACMTRLFREGRTETVRSCSNASCEFVRSMENKDLSNSDKINYLQLASNKHQKLYRDAMTGKGVDRHIFCMYVISKYLNIESEFLQKALSVPWKLSTSQTPHTQLTKFDMRRYPNFLSAGGGFGPVTSDGYGVSYMMAGEDIIFFHISSNISCQKTDSKRFANNLCQALLDIKKLFN 2477
            MAEAHQAVAF   V+ DGID  L+ +A K+I  SG+ SWKK   R +N    G+YP+ P +WL +V GV ++     D S G+I KI   L     + S   ++++ +++  GLW A +I  +Y+L  LL Y  WM+      S  T+ WM +V I  G  P LYS+Q SLP+LP+P +  T+N++L S+ PL+ +E++  +  LA +F    G ++Q+YL LK  W++NYVSDWWEE+VYL  R  LM+NSNYY MD L +    +QAA A N I A + +  +L+ EE++P++  G  VPLCS Q+ERMF T R+P        +D + H R+S++IVV  +G Y+KV      + L P ++E+  Q ILD   +P+     +  LTAGER  WA  R+++F  G NK+SL+ +EKAAF + L++  Q Y   D ++ +D++  SLLHG+  DRW+DKSF  +VFKNG++G NAEHSWADAP++ H WEY++  D    + GY  DGHC+G    N   P +LQW + +  +  IE  L T + L  D+D H  PF  FG+G +K C+ SPD F+Q+ALQLA+Y+D   FCLTYEA MTRLFREGRTETVRSCS+ SC FV +M +   +   K+   ++AS KHQ LYR AMTG G+DRH+FC+YV+SKYL ++S FL++ LS PW+LSTSQTP  Q+  FD+ R P ++S+GGGFGPV  DGYGVSY++ GE++I FHISS  S  +TDS RF  +L QA+ DI  LF 
Sbjct:    1 MAEAHQAVAFQFTVTPDGIDLRLSHEALKQICLSGLHSWKKKFIRFKNGVITGVYPASPSSWLIVVVGVMSTMYAKIDPSLGIIAKINRTLDTTGYMSSQTKNIVSGVLFGTGLWVALIITMRYSLKVLLSYHGWMFAEHGKMSRATRIWMCMVKIFSGRKPMLYSFQTSLPRLPVPAVKDTVNRYLESVRPLMKDEDFKRMTALAQDFAVNLGPRLQWYLKLKSWWATNYVSDWWEEYVYLRGRGPLMVNSNYYAMDLLYVIPTHLQAATAGNGIHAILLYRHKLDREEIKPILFLGSTVPLCSAQWERMFNTCRIP-----GEETDTIQHLRDSKHIVVFHKGRYFKVWLYHDGRLLKPREIEQHIQRILDDPSEPHAGEAKLAALTAGERVPWAKCRQAYFGRGKNKQSLDAVEKAAFFVTLDETEQGYREEDPDASMDSYAKSLLHGRCSDRWFDKSFTFIVFKNGKMGMNAEHSWADAPVVGHLWEYVMSTDCF--QLGYAEDGHCKGDTNPNIPYPTRLQWDIPEECQDVIETSLNTANILASDVDFHSFPFHAFGKGLIKKCRTSPDAFVQLALQLAHYKDMGKFCLTYEASMTRLFREGRTETVRSCSSESCNFVLAMVDPTQTVKQKLRLFKIASEKHQHLYRLAMTGSGIDRHLFCLYVVSKYLAVDSPFLKEVLSEPWRLSTSQTPQQQVELFDLERNPEYVSSGGGFGPVADDGYGVSYILVGENLINFHISSKFSSPETDSHRFGKHLKQAMNDIMALFG 766          
BLAST of Carnitine O-palmitoyltransferase 1, liver isoform vs. UniProt/SwissProt
Match: sp|P32198|CPT1A_RAT (Carnitine O-palmitoyltransferase 1, liver isoform OS=Rattus norvegicus OX=10116 GN=Cpt1a PE=1 SV=2)

HSP 1 Score: 724.931 bits (1870), Expect = 0.000e+0
Identity = 362/773 (46.83%), Postives = 503/773 (65.07%), Query Frame = 3
Query:  165 MAEAHQAVAFSIKVSDDGIDWSLNFKAFKEIAKSGVKSWKKGLYRIQNRFYNGLYPSQPGNWLGIVCGVFASSMVGFDLSFGLIEKIEVQLQRVLELESPRDHLIASLMYSCGLWTAGVIVRKYTLSNLLYYMDWMYESQTGPSMKTKAWMVLVTILGGGNPKLYSYQGXXXXXXXXXXXXTINKFLTSMEPLLSXXXXXXXXXXXXXXXXQHGFKIQFYLHLKYLWSSNYVSDWWEEFVYLSSRSSLMINSNYYGMDALMLRHEWIQAARAANLICASVQFMRELNTEELEPLVIQGK-VPLCSRQYERMFCTVRVPRNISRKNRSDQLVHYRESRYIVVICRGNYYKVNFMKGDQYLDPVDMEKQFQNILDTAVQPNDPSQYIGVLTAGERNQWAINRESFFKDGCNKESLEIIEKAAFMLVLEDEFQDYNPND-ESKLDAFGHSLLHGKGHDRWYDKSFNMVVFKNGRVGFNAEHSWADAPIMAHYWEYILLEDILSPKFGYTPDGHCRGVGKSNNISPQKLQWKLSKMIELEIEKCLLTTSKLIEDIDLHIVPFSEFGRGFMKTCKVSPDGFIQMALQLAYYRDSESFCLTYEACMTRLFREGRTETVRSCSNASCEFVRSMENKDLSNSDKINYLQLASNKHQKLYRDAMTGKGVDRHIFCMYVISKYLNIESEFLQKALSVPWKLSTSQTPHTQLTKFDMRRYPNFLSAGGGFGPVTSDGYGVSYMMAGEDIIFFHISSNISCQKTDSKRFANNLCQALLDIKKLFN 2477
            MAEAHQAVAF   V+ DGID  L+ +A K+I  SG+ SWKK   R +N    G++P+ P +WL +V GV +S     D S G+I KI   L     + S   ++++ +++  GLW A ++  +Y+L  LL Y  WM+      S  TK WM +V +L G  P LYS+Q SLP+LP+P +  T++++L S+ PL+ EE++  +  LA +F    G K+Q+YL LK  W++NYVSDWWEE++YL  R  LM+NSNYY M+ L +    IQAARA N I A + + R L+ EEL+P+ + G  +PLCS Q+ER+F T R+P        +D + H ++SR+IVV  RG Y+KV      + L P ++E+Q Q ILD   +P      +  LTA +R  WA  R+++F  G NK+SL+ +EKAAF + L++  Q Y   D E+ +D++  SLLHG+  DRW+DKS   VVFKN ++G NAEHSWADAP++ H WEY++  D+   + GY+ DGHC+G    N   P +LQW +    +  I+  L + S L  D+DLH  PF  FG+G +K C+ SPD FIQ+ALQLA+Y+D   FCLTYEA MTRLFREGRTETVRSC+  SC FV++M +   +   ++   ++A  KHQ LYR AMTG G+DRH+FC+YV+SKYL ++S FL++ LS PW+LSTSQTP  Q+  FD  + P+++S GGGFGPV  DGYGVSY++ GE+ I FHISS  S  +TDS RF  +L QA++DI  LF 
Sbjct:    1 MAEAHQAVAFQFTVTPDGIDLRLSHEALKQICLSGLHSWKKKFIRFKNGIITGVFPANPSSWLIVVVGVISSMHAKVDPSLGMIAKISRTLDTTGRMSSQTKNIVSGVLFGTGLWVAVIMTMRYSLKVLLSYHGWMFAEHGKMSRSTKIWMAMVKVLSGRKPMLYSFQTSLPRLPVPAVKDTVSRYLESVRPLMKEEDFQRMTALAQDFAVNLGPKLQWYLKLKSWWATNYVSDWWEEYIYLRGRGPLMVNSNYYAMEMLYITPTHIQAARAGNTIHAILLYRRTLDREELKPIRLLGSTIPLCSAQWERLFNTSRIP-----GEETDTIQHIKDSRHIVVYHRGRYFKVWLYHDGRLLRPRELEQQMQQILDDPSEPQPGEAKLAALTAADRVPWAKCRQTYFARGKNKQSLDAVEKAAFFVTLDESEQGYREEDPEASIDSYAKSLLHGRCFDRWFDKSITFVVFKNSKIGINAEHSWADAPVVGHLWEYVMATDVF--QLGYSEDGHCKGDTNPNIPKPTRLQWDIPGECQEVIDASLSSASLLANDVDLHSFPFDSFGKGLIKKCRTSPDAFIQLALQLAHYKDMGKFCLTYEASMTRLFREGRTETVRSCTMESCNFVQAMMDPKSTAEQRLKLFKIACEKHQHLYRLAMTGAGIDRHLFCLYVVSKYLAVDSPFLKEVLSEPWRLSTSQTPQQQVELFDFEKNPDYVSCGGGFGPVADDGYGVSYIIVGENFIHFHISSKFSSPETDSHRFGKHLRQAMMDIITLFG 766          
BLAST of Carnitine O-palmitoyltransferase 1, liver isoform vs. UniProt/SwissProt
Match: sp|Q924X2|CPT1B_MOUSE (Carnitine O-palmitoyltransferase 1, muscle isoform OS=Mus musculus OX=10090 GN=Cpt1b PE=1 SV=1)

HSP 1 Score: 717.998 bits (1852), Expect = 0.000e+0
Identity = 362/773 (46.83%), Postives = 506/773 (65.46%), Query Frame = 3
Query:  165 MAEAHQAVAFSIKVSDDGIDWSLNFKAFKEIAKSGVKSWKKGLYRIQNRFYNGLYPSQPGNWLGIVCGVFASSMVGFDLSFGLIEKIEVQL-QRVLELESPR-DHLIASLMYSCGLWTAGVIVRKYTLSNLLYYMDWMYESQTGPSMKTKAWMVLVTILGGGNPKLYSYQGXXXXXXXXXXXXTINKFLTSMEPLLSXXXXXXXXXXXXXXXXQHGFKIQFYLHLKYLWSSNYVSDWWEEFVYLSSRSSLMINSNYYGMDALMLRHEWIQAARAANLICASVQFMRELNTEELEPLVIQGKVPLCSRQYERMFCTVRVPRNISRKNRSDQLVHYRESRYIVVICRGNYYKVNFMKGDQYLDPVDMEKQFQNILDTAVQPNDPSQYIGVLTAGERNQWAINRESFFKDGCNKESLEIIEKAAFMLVLEDEFQDYNPNDESKLDAFGHSLLHGKGHDRWYDKSFNMVVFKNGRVGFNAEHSWADAPIMAHYWEYILLEDILSPKFGYTPDGHCRGVGKSNNISPQKLQWKLSKMIELEIEKCLLTTSKLIEDIDLHIVPFSEFGRGFMKTCKVSPDGFIQMALQLAYYRDSESFCLTYEACMTRLFREGRTETVRSCSNASCEFVRSMENKDLSNSDKINYLQLASNKHQKLYRDAMTGKGVDRHIFCMYVISKYLNIESEFLQKALSVPWKLSTSQTPHTQLTKFDMRRYPNFLSAGGGFGPVTSDGYGVSYMMAGEDIIFFHISSNISCQKTDSKRFANNLCQALLDIKKLFN 2477
            MAEAHQAVAF   V+ DG+D+ L+ +A + I  SG+ SWKK L RI+N    G+YP  P +WL +V     S+    D+S GL++ I+  L +R     +P+ + L++ +++S G+W  G+   + TL  LL Y  WM+E  +  S  TK W + V +L    P LYS+Q SLPKLP+P + +TI+++L S+ PLL +E Y+ ++ LA EF+ +   ++Q YL LK  W++NYVSDWWEE+VYL SRS LM+NSNYY MD +++++  +QAAR  N + A + + R+L+ EE++P++  G VP+CS Q ERMF T R+P        +D L H  ESR++ V  +G ++KV   +G + L P D+E QFQ ILD    P    + +  LTAG R +WA  R++FF  G NK SL+ IE+AAF + L+++   YNP+DE+ L  +G +LLHG  ++RW+DKSF ++  KNG +G N EHSWADAPI+ H WE++L  D      GYT  GHC G   +    PQ+L W + +     IE        L +D++L+   F  FG+G +K C+ SPD F+Q+ALQLA++RD   FCLTYEA MTR+FREGRTETVRSC+N S  FV++M        D  +  + AS KHQ +YR AMTG G+DRH+FC+Y++SKYL + S FL + LS PW LSTSQ P  Q+  FD ++YPN L AGGGFGPV  DGYGVSYM+AGE+ +FFHISS  S  +T+++RF N++ QALLDI +LF 
Sbjct:    1 MAEAHQAVAFQFTVTPDGVDFRLSREALRHIYLSGINSWKKRLIRIKNGILRGVYPGSPTSWLVVVMATVGSNYCKVDISMGLVDCIQRCLPERYGHFGTPQTEALLSMVIFSTGVWATGIFFFRQTLKLLLSYHGWMFEMHSKTSHATKIWAICVRLLSSRRPMLYSFQTSLPKLPVPSVPATIHRYLDSVRPLLDDEAYYRMETLAKEFQDKTAPRLQKYLVLKSWWATNYVSDWWEEYVYLRSRSPLMVNSNYYAMDFVLIKNTNVQAARLGNAVHAMIMYRRKLDREEIKPVMALGMVPMCSYQMERMFNTTRIP-----GKETDLLQHLSESRHVAVYHKGRFFKVWLYEGSRLLKPRDLEMQFQRILDDPSPPQPGEEKLAALTAGGRVEWAEARQTFFSSGKNKMSLDAIERAAFFVTLDEDSHCYNPDDETSLSLYGKALLHGNCYNRWFDKSFTLISCKNGLLGLNTEHSWADAPIIGHLWEFVLGTDTF--HLGYTETGHCVGEPNTTLPPPQRLPWDIPEQCREAIENSYQVAKALADDVELYCFQFLPFGKGLIKKCRTSPDAFVQIALQLAHFRDKGKFCLTYEASMTRMFREGRTETVRSCTNESAAFVQAMMKGSHKKQDLQDLFRKASEKHQNMYRLAMTGAGIDRHLFCLYIVSKYLGVSSPFLAEVLSEPWSLSTSQIPQFQICMFDPKQYPNHLGAGGGFGPVADDGYGVSYMIAGENTMFFHISSKYSSSETNAQRFGNHIRQALLDIAELFK 766          
BLAST of Carnitine O-palmitoyltransferase 1, liver isoform vs. TrEMBL
Match: A0A210QUP7 (Carnitine O-palmitoyltransferase 1, liver isoform OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT06875 PE=3 SV=1)

HSP 1 Score: 799.275 bits (2063), Expect = 0.000e+0
Identity = 388/771 (50.32%), Postives = 543/771 (70.43%), Query Frame = 3
Query:  165 MAEAHQAVAFSIKVSDDGIDWSLNFKAFKEIAKSGVKSWKKGLYRIQNRFYNGLYPSQPGNWLGIVCGVFASSMVGFDLSFGLIEKIEVQLQRVLELESPRDHLIASLMYSCGLWTAGVIVRKYTLSNLLYYMDWMYESQTGPSMKTKAWMVLVTILGGGNPKLYSYQGXXXXXXXXXXXXTINKFLTSMEPLLSXXXXXXXXXXXXXXXXQHGFKIQFYLHLKYLWSSNYVSDWWEEFVYLSSRSSLMINSNYYGMDALMLRHEWIQAARAANLICASVQFMRELNTEELEPLVIQGKVPLCSRQYERMFCTVRVPRNISRKNRSDQLVHYRESRYIVVICRGNYYKVNFMKGDQYLDPVDMEKQFQNILDTAVQPNDPSQYIGVLTAGERNQWAINRESFFKDGCNKESLEIIEKAAFMLVLEDEFQDYNPNDESKLDAFGHSLLHGKGHDRWYDKSFNMVVFKNGRVGFNAEHSWADAPIMAHYWEYILLEDILSPKFGYTPDGHCRGVGKSNNISPQKLQWKLSKMIELEIEKCLLTTSKLIEDIDLHIVPFSEFGRGFMKTCKVSPDGFIQMALQLAYYRDSESFCLTYEACMTRLFREGRTETVRSCSNASCEFVRSMENKDLSNSDKINYLQLASNKHQKLYRDAMTGKGVDRHIFCMYVISKYLNIESEFLQKALSVPWKLSTSQTPHTQLTKFDMRRYPNFLSAGGGFGPVTSDGYGVSYMMAGEDIIFFHISSNISCQKTDSKRFANNLCQALLDIKKLFN 2477
            MAEAH AVAFS  V+ +GID +LN +A + + KSGV+SWKK + R +N+  NG+YP+ P +WL I   V  + + G+D+SFGL+  ++  +  V E  S        +++S  LW A   + KYTL  LL+Y  WMYE +   S++TK WM LV + GG  P L SYQ +LPK+ +P++  TI+ +L S+ PL+ +E+Y  ++ LA +F    G K+  YL LK  WS+NY+SDWWEE+VYLS RS +M+NSN+YG+DA+++    IQAARAAN++ A + + REL+TE+L P+++   +PLCS QYER F T R+P  I +    D+L++ ++S++I V CRG Y+K+   +  + L P ++E   Q I+D   +P    +++  LTAG+R  WA  R  +F  G NK SL+ IEKAAF L L+DE QD++ +D +K+D FG S+LHGKG+DRW+DKSF +VV  NGR+GFNAEHSWADAPIMAH WEY  +ED    KFGY  DGH  G  +    +P +L+W+L K     IE  L   ++L+ D+DLHI+  + +G+GFMKTC+VSPD +IQ+ALQLAYYR ++ FCLTYE+ MTRL++EGRTETVRSC+  SC FVRSM++   +++D+I  +++A+  HQ  YRDAMTGKG+DRH+FCMYV+SKYL  +S FL + LS PW+LSTSQTPH Q TK D+ ++P  +SAGGGFGPV  DGYGVSY++AGED+IFFH+S  +SC  T+SK+F +++ QA+ DIK +F+
Sbjct:    1 MAEAHSAVAFSFSVTQEGIDVNLNHEALRAVWKSGVRSWKKRIGRAKNQVKNGVYPATPMSWLFIASIVLGTQLAGYDISFGLVGWLQTHIPWVREASSVVSLYTCCILFSTLLWVAKANLMKYTLKMLLHYHGWMYEPRGPMSLRTKLWMGLVKLFGGKKPLLMSYQSALPKINVPQVGDTIDTYLKSVRPLMDDEKYNRMQDLAKDFLNGMGPKLNRYLKLKSWWSTNYISDWWEEYVYLSGRSPIMVNSNFYGIDAVLVHPTKIQAARAANVVHAMLLYRRELDTEQLNPILLNQTIPLCSNQYERQFQTTRIP-GIEK----DKLMYSKDSQHIAVYCRGRYFKMYVYQRGRLLKPCELEISLQMIIDDQTEPAPGEEHLAALTAGDRVPWAKARTEYFSKGKNKASLDAIEKAAFFLSLDDEPQDFDAHDSTKMDRFGRSMLHGKGYDRWFDKSFTLVVLSNGRIGFNAEHSWADAPIMAHLWEYSSVEDKF--KFGYKADGHTNGEPEMTPPNPIRLEWELPKTCIAVIENSLEVANQLLNDVDLHIIMHNAYGKGFMKTCRVSPDAYIQLALQLAYYRSAQKFCLTYESSMTRLYKEGRTETVRSCTIESCAFVRSMDDPSKTDADRIKLMKVATETHQMGYRDAMTGKGIDRHLFCMYVVSKYLGTDSPFLSEVLSEPWRLSTSQTPHQQTTKLDLVKHPEHISAGGGFGPVADDGYGVSYIVAGEDVIFFHVSCKVSCPTTNSKKFGDSINQAMQDIKNMFS 764          
BLAST of Carnitine O-palmitoyltransferase 1, liver isoform vs. TrEMBL
Match: A0A267DZG0 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig027428g1 PE=3 SV=1)

HSP 1 Score: 780.015 bits (2013), Expect = 0.000e+0
Identity = 387/774 (50.00%), Postives = 538/774 (69.51%), Query Frame = 3
Query:  165 MAEAHQAVAFSIKVSDDGIDWSLNFKAFKEIAKSGVKSWKKGLYRIQNRFYNGLYPSQPGNWLGIVCGVFASSMVGFDLSFGLIEKIEVQLQRVLELESPRDHLIASLMYSCGLWTAGVIVRKYTLSNLLYYMDWMYESQ-TGPSMKTKAWMVLVTIL-GGGNPKLYSYQGXXXXXXXXXXXXTINKFLTSMEPLLSXXXXXXXXXXXXXXXXQ-HGFKIQFYLHLKYLWSSNYVSDWWEEFVYLSSRSSLMINSNYYGMDALMLRHEWIQAARAANLICASVQFMRELNTEELEPLVIQGKVPLCSRQYERMFCTVRVPRNISRKNRSDQLVHYRESRYIVVICRGNYYKVNFMKGDQYLDPVDMEKQFQNILDTAVQPNDPSQYIGVLTAGERNQWAINRESFFKDGCNKESLEIIEKAAFMLVLEDEFQDYNPNDESKLDAFGHSLLHGKGHDRWYDKSFNMVVFKNGRVGFNAEHSWADAPIMAHYWEYILLEDILSPKFGYTPDGHCRGVGKSNNISPQKLQWKLSKMIELEIEKCLLTTSKLIEDIDLHIVPFSEFGRGFMKTCKVSPDGFIQMALQLAYYRDSES-FCLTYEACMTRLFREGRTETVRSCSNASCEFVRSMENKDLSNSDKINYLQLASNKHQKLYRDAMTGKGVDRHIFCMYVISKYLNIESEFLQKALSVPWKLSTSQTPHTQLTKFDMRRYPNFLSAGGGFGPVTSDGYGVSYMMAGEDIIFFHISSNISCQKTDSKRFANNLCQALLDIKKLF 2474
            MAEAHQAV F+  ++D GI +  +  A  ++ +SGV+++KK     +NR  NG+YP++PG+ L  +  +  ++M G DLS G ++ +   + + L +  P D  ++  + +CGLW + +++ K  +  LL Y  WMYE+     S +TK W VLV +L       LYS+QG+LP+LP+P +  TI ++L SMEPLLS+++  E+++LA EFK +    K+QFYL LK  W+ NYVSDWWEEFVYL SR  +M+NSNYYG+DA+ +R   +QAARAAN+  + +Q+ R+L+ EE++PL I   VPLCS QYER+F T R+P      +  D+++H  ++++I V   G Y+KV F    ++L+P ++E+QFQ+IL+    P      +  LTAGER  WA  R  FF  G N+ SL+ IE+AAF+L L++E  DY+P D+S+LD F  SLLHG G +RW+DK+F +VVF NGR+GFNAEHSWADAP+++  WE  ++   + P  GY  DGHC+G  K    +P +LQW LS      I   L   + L+ D+DLH+V  ++FG+G MKTC++SPD F+Q+ALQLAY+RDS   FCLTYEA MTRLFREGRTETVRSC+N SCEFVR+ME+ + S +D I  ++ A++KHQ +YRDAMTGKGVDRH+F +YV+SKY  I+S FL+KAL   WKLSTSQTPH Q  K D+R  P+ +SAGGGFGPV+ DGYGVSY++AGED IFFHISS +SC  T+S+RF + +C+AL D+K LF
Sbjct:    1 MAEAHQAVVFAFNITDQGIQFEFDKDALHQVWRSGVRAYKKRYAGFKNRLRNGIYPAKPGSLLTTMLVMILATMFGNDLSLGYVKLLNPVVVKYLGVVPPHDTYVSCALIACGLWLSAILLYKQLIGCLLAYHGWMYEAHGRSISWRTKVWSVLVKLLVSCKRAGLYSFQGALPRLPVPNVDDTIRRYLVSMEPLLSDDQMAEMRQLADEFKSKGTAKKLQFYLRLKSWWAPNYVSDWWEEFVYLYSRDPIMVNSNYYGIDAIFVRPTRVQAARAANVSWSMLQYWRKLSREEVKPLSINDTVPLCSWQYERLFATTRIP-----GDERDRIMHLNDAKHIAVYHAGRYFKVYFYYAGRWLEPCELEQQFQSILNDKSAPAAGEADLAALTAGERRVWARARRDFFSRGANRTSLDAIERAAFVLALDEESADYDPEDDSQLDRFAKSLLHGNGCNRWFDKTFTLVVFANGRIGFNAEHSWADAPVLSQLWEETVITSDIVPGVGYNSDGHCKGSPKGTVPNPIRLQWDLSASCRDVISSQLRVATNLLNDVDLHLVVHTQFGKGAMKTCRMSPDAFVQLALQLAYFRDSGGQFCLTYEASMTRLFREGRTETVRSCTNQSCEFVRAMESGNASKADLIRLVRAAADKHQTMYRDAMTGKGVDRHLFTLYVVSKYCKIQSPFLEKALHCQWKLSTSQTPHGQTGKLDLRNSPDSISAGGGFGPVSEDGYGVSYIIAGEDTIFFHISSRVSCDLTNSRRFGDQICRALQDLKNLF 769          
BLAST of Carnitine O-palmitoyltransferase 1, liver isoform vs. TrEMBL
Match: R7T4M2 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_178036 PE=3 SV=1)

HSP 1 Score: 779.63 bits (2012), Expect = 0.000e+0
Identity = 394/772 (51.04%), Postives = 531/772 (68.78%), Query Frame = 3
Query:  165 MAEAHQAVAFSIKVSDDGIDWSLNFKAFKEIAKSGVKSWKKGLYRIQNRFYNGLYPSQPGNWLGIVCGVFASSMVGFDLSFGLIEKIEVQLQRVLELESPRDHLIASLMYSCGLWTAGVIVRKYTLSNLLYYMDWMYESQTGPSMKTKAWMVLVTILGGGNPKLYSYQGXXXXXXXXXXXXTINKFLTSMEPLLSXXXXXXXXXXXXXXXXQHGFKIQFYLHLKYLWSSNYVSDWWEEFVYLSSRSSLMINSNYYGMDALMLRHEWIQAARAANLICASVQFMRELNTEELEPLVIQGKVPLCSRQYERMFCTVRVPRNISRKNRSDQLVHYRESRYIVVICRGNYYKVNFMKGDQYLDPVDMEKQFQNILDTAVQPNDPSQYIGVLTAGERNQWAINRESFFKDGCNKESLEIIEKAAFMLVLEDEFQDYNPNDESKLDAFGHSLLHGKGHDRWYDKSFNMVVFKNGRVGFNAEHSWADAPIMAHYWEYILLEDILSPKFGYTPDGHCRGVGKSNNISPQKLQWKLSKMIELEIEKCLLTTSKLIEDIDLHIVPFSEFGRGFMKTCKVSPDGFIQMALQLAYYRDSESFCLTYEACMTRLFREGRTETVRSCSNASCEFVRSMENKDLSNSDKINYLQLASNKHQKLYRDAMTGKGVDRHIFCMYVISKYLNIESEFLQKALSVPWKLSTSQTPHTQLTKFDMRRYPNFLSAGGGFGPVTSDGYGVSYMMAGEDIIFFHISSNISCQKTDSKRFANNLCQALLDIKKLFNP 2480
            MAEAH AVAFS  V D+G++  LN +A   + +SGV+SWKK L RI+N+F+NG+YP+ P +WL  +  V A  M   D SFG I  ++  +  +  + +P+   I  L+YS  LW   +++ KYTL  LL Y  WM+E +   S+ TKAW++LV +L G  P+LYSYQGSLPKLP+P L+ T+ ++L S+ PL  +E+Y  ++ L  EFK   G K+Q+YL LK  W++NYVSDWWEE+VYL  RS +M+NSN+YG+DA++      QAARAAN+I A +QF R ++ E+L P+++   VPLCS QYER F T RVP        +D L H  +S++I V  +G Y+KV      + L P ++E   Q ILD   +P    +++  LTAG+R  WA  R  +F  G NK SL+ IEKAAF++ L+++ Q+++ +D + LDAFG S+LHGKG+DRW+DKSF +VV  NGR+GFNAEHSWADAP MAH WE+ +    L   +GY  DGH +G   +   +P KLQW+L +  +  I   L     LI D+DLH++    +G+GFMK CKVSPD FIQMALQLAYYRD+  FCLTYEA MTRL+REGRTETVRSCS  S  F R+MENK +S ++ I  ++ A+ +HQ  YR AMTG G+DRH+FC+YV+SKYL IES FL++ LS PW+LSTSQTPH Q  K D+ + P+ +SAGGGFGPV  DGYGVSY++AGED+IFFHISS  SC +TDSKRF   + ++L D+ +LF+P
Sbjct:    1 MAEAHSAVAFSFTVDDEGVNVRLNHEALHAVWQSGVRSWKKRLGRIKNQFHNGVYPASPASWLFTLTIVLAFYMAAIDPSFGFISFLQAHVPGMEAIGAPKSEYIGCLIYSVVLWFTFILLFKYTLKALLTYTGWMHEPRGKVSIITKAWLLLVKLLEGPKPRLYSYQGSLPKLPVPSLAQTMKQYLRSVRPLCDDEKYQRMENLVQEFKSGIGRKLQWYLVLKSWWATNYVSDWWEEYVYLRGRSPIMVNSNFYGVDAVLRHATTNQAARAANIIYAMLQFRRLIDREDLGPIMLNKTVPLCSWQYERQFNTSRVP-----GVETDTLKHVMDSKHIAVYHKGRYFKVYIYTKGRLLAPCEIEVMLQKILDNQDEPAAGEKHLAALTAGDRIPWARARADYFAKGVNKASLDAIEKAAFVVALDEDEQNFDRDDPNLLDAFGRSMLHGKGYDRWFDKSFTLVVCSNGRIGFNAEHSWADAPCMAHCWEHCMF---LDDAYGYRDDGHTKGEVTTQPPNPIKLQWELPEACQAAISNSLAVAQDLINDVDLHLLMHDAYGKGFMKKCKVSPDAFIQMALQLAYYRDAGKFCLTYEASMTRLYREGRTETVRSCSVESSAFARAMENKSVSKAECIKLMRKATERHQDGYRAAMTGGGIDRHLFCLYVVSKYLGIESPFLKEVLSEPWRLSTSQTPHQQTDKLDLTKNPDLISAGGGFGPVADDGYGVSYIVAGEDMIFFHISSKRSCAETDSKRFGRTIQRSLQDLHELFSP 764          
BLAST of Carnitine O-palmitoyltransferase 1, liver isoform vs. TrEMBL
Match: A0A267H3D6 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig014131g1 PE=3 SV=1)

HSP 1 Score: 778.474 bits (2009), Expect = 0.000e+0
Identity = 386/774 (49.87%), Postives = 539/774 (69.64%), Query Frame = 3
Query:  165 MAEAHQAVAFSIKVSDDGIDWSLNFKAFKEIAKSGVKSWKKGLYRIQNRFYNGLYPSQPGNWLGIVCGVFASSMVGFDLSFGLIEKIEVQLQRVLELESPRDHLIASLMYSCGLWTAGVIVRKYTLSNLLYYMDWMYESQ-TGPSMKTKAWMVLVTIL-GGGNPKLYSYQGXXXXXXXXXXXXTINKFLTSMEPLLSXXXXXXXXXXXXXXXXQ-HGFKIQFYLHLKYLWSSNYVSDWWEEFVYLSSRSSLMINSNYYGMDALMLRHEWIQAARAANLICASVQFMRELNTEELEPLVIQGKVPLCSRQYERMFCTVRVPRNISRKNRSDQLVHYRESRYIVVICRGNYYKVNFMKGDQYLDPVDMEKQFQNILDTAVQPNDPSQYIGVLTAGERNQWAINRESFFKDGCNKESLEIIEKAAFMLVLEDEFQDYNPNDESKLDAFGHSLLHGKGHDRWYDKSFNMVVFKNGRVGFNAEHSWADAPIMAHYWEYILLEDILSPKFGYTPDGHCRGVGKSNNISPQKLQWKLSKMIELEIEKCLLTTSKLIEDIDLHIVPFSEFGRGFMKTCKVSPDGFIQMALQLAYYRDSES-FCLTYEACMTRLFREGRTETVRSCSNASCEFVRSMENKDLSNSDKINYLQLASNKHQKLYRDAMTGKGVDRHIFCMYVISKYLNIESEFLQKALSVPWKLSTSQTPHTQLTKFDMRRYPNFLSAGGGFGPVTSDGYGVSYMMAGEDIIFFHISSNISCQKTDSKRFANNLCQALLDIKKLF 2474
            MAEAHQAV F+  ++D GI +  +  A  ++ +SGV+++KK     +NR  NG+YP++PG+ L  +  +  ++M G DLS G ++ +   + + L +  P D  ++  + +CGLW + +++ K  +  LL Y  WMYE+     S +TK W VLV +L       LYS+QG+LP+LP+P +  TI ++L SMEPLLS+++  E+++LA EFK +    K+QFYL LK  W+ NYVSDWWEEFVYL SR  +M+NSNYYG+DA+ +R   +QAARAAN+  + +Q+ R+L+ EE++PL I   VPLCS QYER+F T R+P      +  D+++H  ++++I V   G Y+KV F    ++L+P ++E+QFQ+IL+    P+     +  LTAGER  WA  R  FF  G N+ SL+ IE+AAF+L L++E  DY+P D+S+LD F  SLLHG G +RW+DK+F +VVF NGR+GFNAEHSWADAP+++  WE  ++   + P  GY  DGHC+G  K    +P +LQW LS      I   L   + L+ D+DLH+V  ++FG+G MKTC++SPD F+Q+ALQLAY+RDS   FCLTYEA MTRLFREGRTETVRSC+N SCEFVR+ME+ + S ++ I  ++ A++KHQ +YRDAMTGKGVDRH+F +YV+SKY  I+S FL+KAL   WKLSTSQTPH Q  K D+R  P+ +SAGGGFGPV+ DGYGVSY++AGED IFFHISS +SC  T+S+RF + +C+AL D+K LF
Sbjct:    1 MAEAHQAVVFAFNITDQGIQFEFDKDALHQVWRSGVRAYKKRYAGFKNRLRNGIYPAKPGSLLTTMLVMILATMFGNDLSLGYVKLLNPVVVKYLGVVPPHDTYVSCALIACGLWLSAILLYKQLIGCLLAYHGWMYEAHGRSISWRTKVWSVLVKLLVSCKRAGLYSFQGALPRLPVPNVDDTIRRYLVSMEPLLSDDQMAEMRQLADEFKSKGTAKKLQFYLRLKSWWAPNYVSDWWEEFVYLYSRDPIMVNSNYYGIDAIFVRPTRVQAARAANVSWSMLQYWRKLSREEVKPLSINDTVPLCSWQYERLFATTRIP-----GDERDRIMHLNDAKHIAVYHAGRYFKVYFYYAGRWLEPCELEQQFQSILNDKSAPSAGEADLAALTAGERRIWARARRDFFSRGANRTSLDAIERAAFVLALDEESADYDPEDDSQLDRFAKSLLHGNGCNRWFDKTFTLVVFANGRIGFNAEHSWADAPVLSQLWEETVITSDIVPGVGYNSDGHCKGSPKGTVPNPIRLQWDLSASCRDVISSQLRVATNLLNDVDLHLVVHTQFGKGAMKTCRMSPDAFVQLALQLAYFRDSGGQFCLTYEASMTRLFREGRTETVRSCTNQSCEFVRAMESGNASKAELIRLVRAAADKHQTMYRDAMTGKGVDRHLFTLYVVSKYCKIQSPFLEKALHCQWKLSTSQTPHGQTGKLDLRNSPDSISAGGGFGPVSEDGYGVSYIIAGEDTIFFHISSRVSCDLTNSRRFGDQICRALQDLKNLF 769          
BLAST of Carnitine O-palmitoyltransferase 1, liver isoform vs. TrEMBL
Match: A0A267E4Y5 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig029955g1 PE=3 SV=1)

HSP 1 Score: 777.704 bits (2007), Expect = 0.000e+0
Identity = 385/774 (49.74%), Postives = 539/774 (69.64%), Query Frame = 3
Query:  165 MAEAHQAVAFSIKVSDDGIDWSLNFKAFKEIAKSGVKSWKKGLYRIQNRFYNGLYPSQPGNWLGIVCGVFASSMVGFDLSFGLIEKIEVQLQRVLELESPRDHLIASLMYSCGLWTAGVIVRKYTLSNLLYYMDWMYESQ-TGPSMKTKAWMVLVTIL-GGGNPKLYSYQGXXXXXXXXXXXXTINKFLTSMEPLLSXXXXXXXXXXXXXXXXQ-HGFKIQFYLHLKYLWSSNYVSDWWEEFVYLSSRSSLMINSNYYGMDALMLRHEWIQAARAANLICASVQFMRELNTEELEPLVIQGKVPLCSRQYERMFCTVRVPRNISRKNRSDQLVHYRESRYIVVICRGNYYKVNFMKGDQYLDPVDMEKQFQNILDTAVQPNDPSQYIGVLTAGERNQWAINRESFFKDGCNKESLEIIEKAAFMLVLEDEFQDYNPNDESKLDAFGHSLLHGKGHDRWYDKSFNMVVFKNGRVGFNAEHSWADAPIMAHYWEYILLEDILSPKFGYTPDGHCRGVGKSNNISPQKLQWKLSKMIELEIEKCLLTTSKLIEDIDLHIVPFSEFGRGFMKTCKVSPDGFIQMALQLAYYRDSES-FCLTYEACMTRLFREGRTETVRSCSNASCEFVRSMENKDLSNSDKINYLQLASNKHQKLYRDAMTGKGVDRHIFCMYVISKYLNIESEFLQKALSVPWKLSTSQTPHTQLTKFDMRRYPNFLSAGGGFGPVTSDGYGVSYMMAGEDIIFFHISSNISCQKTDSKRFANNLCQALLDIKKLF 2474
            MAEAHQAV F+  ++D GI +  +  A  ++ +SGV+++KK     +NR  NG+YP++PG+ L  +  +  ++M G DLS G ++ +   + + L +  P D  ++  + +CG+W + +++ K  +  LL Y  WMYE+     S +TK W VLV +L       LYS+QG+LP+LP+P +  TI ++L SMEPLLS+++  E+++LA EFK +    K+QFYL LK  W+ NYVSDWWEEFVYL SR  +M+NSNYYG+DA+ +R   +QAARAAN+  + +Q+ R+L+ EE++PL I   VPLCS QYER+F T R+P      +  D+++H  ++++I V   G Y+KV F    ++L+P ++E+QFQ+IL+    P+     +  LTAGER  WA  R  FF  G N+ SL+ IE+AAF+L L++E  DY+P D+S+LD F  SLLHG G +RW+DK+F +VVF NGR+GFNAEHSWADAP+++  WE  ++   + P  GY  DGHC+G  K    +P +LQW LS      I   L   + L+ D+DLH+V  ++FG+G MKTC++SPD F+Q+ALQLAY+RDS   FCLTYEA MTRLFREGRTETVRSC+N SCEFVR+ME+ + S ++ I  ++ A++KHQ +YRDAMTGKGVDRH+F +YV+SKY  I+S FL+KAL   WKLSTSQTPH Q  K D+R  P+ +SAGGGFGPV+ DGYGVSY++AGED IFFHISS +SC  T+S+RF + +C+AL D+K LF
Sbjct:    1 MAEAHQAVVFAFNITDQGIQFEFDKDALHQVWRSGVRAYKKRYAGFKNRLRNGIYPAKPGSLLTTMLVMILATMFGNDLSLGYVKLLNPVVVKYLGVVPPHDTYVSCALIACGIWLSAILLYKQLIGCLLAYHGWMYEAHGRSISWRTKVWSVLVKLLVSCKRAGLYSFQGALPRLPVPNVDDTIRRYLVSMEPLLSDDQMAEMRQLADEFKSKGTAKKLQFYLRLKSWWAPNYVSDWWEEFVYLYSRDPIMVNSNYYGIDAIFVRPTRVQAARAANVSWSMLQYWRKLSREEVKPLSINDTVPLCSWQYERLFATTRIP-----GDERDRIMHLNDAKHIAVYHAGRYFKVYFYYAGRWLEPCELEQQFQSILNDKSAPSAGEADLAALTAGERRIWARARRDFFSRGANRTSLDAIERAAFVLALDEESADYDPEDDSQLDRFAKSLLHGNGCNRWFDKTFTLVVFANGRIGFNAEHSWADAPVLSQLWEETVITSDIVPGVGYNSDGHCKGSPKGTVPNPIRLQWDLSASCRDVISSQLRVATNLLNDVDLHLVVHTQFGKGAMKTCRMSPDAFVQLALQLAYFRDSGGQFCLTYEASMTRLFREGRTETVRSCTNQSCEFVRAMESGNASKAELIRLVRAAADKHQTMYRDAMTGKGVDRHLFTLYVVSKYCKIQSPFLEKALHCQWKLSTSQTPHGQTGKLDLRNSPDSISAGGGFGPVSEDGYGVSYIIAGEDTIFFHISSRVSCDLTNSRRFGDQICRALQDLKNLF 769          
BLAST of Carnitine O-palmitoyltransferase 1, liver isoform vs. Ensembl Cavefish
Match: ENSAMXT00000012385.2 (carnitine O-palmitoyltransferase 1, liver isoform [Source:NCBI gene;Acc:103035972])

HSP 1 Score: 724.161 bits (1868), Expect = 0.000e+0
Identity = 376/804 (46.77%), Postives = 522/804 (64.93%), Query Frame = 3
Query:  114 ELFKYIPIYI---K*TFNG*MAEAHQAVAFSIKVSDDGIDWSLNFKAFKEIAKSGVKSWKKGLYRIQNRFYNGLYPSQPGNWLGIVCGVFASSMVGFDLSFGLIEKIEVQLQRVLELESPRDHLIASLMYSCGLWTAGVIVRKYTLSNLLYYMDWMYESQTGPSMKTKAWMVLVTILGGGNPKLYSYQGXXXXXXXXXXXXTINKFLTSMEPLLSXXXXXXXXXXXXXXXXQHGFKIQFYLHLKYLWSSNYVSDWWEEFVYLSSRSSLMINSNYYGMDALMLRHEWIQAARAANLICASVQFMRELNTEELEPLVIQGK-VPLCSRQYERMFCTVRVPRNISRKNRSDQLVHYRESRYIVVICRGNYYKVNFMKGDQYLDPVDMEKQFQNILDTAVQPNDPSQYIGVLTAGERNQWAINRESFFKDGCNKESLEIIEKAAFMLVLEDEFQDYNPNDES-KLDAFGHSLLHGKGHDRWYDKSFNMVVFKNGRVGFNAEHSWADAPIMAHYWEYILLEDILSPKFGYTPDGHCRGVGKSNNISPQKLQWKLSKMIELEIEKCLLTTSKLIEDIDLHIVPFSEFGRGFMKTCKVSPDGFIQMALQLAYYRDSESFCLTYEACMTRLFREGRTETVRSCSNASCEFVRSMEN-KDLSNSDKINYLQLASNKHQKLYRDAMTGKGVDRHIFCMYVISKYLNIESEFLQKALSVPWKLSTSQTPHTQLTKFDMRRYPNFLSAGGGFGPVTSDGYGVSYMMAGEDIIFFHISSNISCQKTDSKRFANNLCQALLDIKKL--FNPLDSSGDK 2501
            E FK  P  +   K  ++  MAEAHQAVAF   ++ +GID  L+ +A +++  SG++SWKK + R++N    G+YP+ P +WL +V  + A+     D S GLI KI+  L     +      +++++++S  LW + +   K  L  LL Y  WM+E     S  TK W++LV I  G  P LYSYQGSLP LP+P +  T+ ++L S+ PL S+ E+  +  LA EF+   G ++Q+YL LK LW+SNYVSDWWEE++YL  R  +M+NSNYYGMD L +    IQAARA N + A + + R LN EE++P  I G  +PLC+ Q ER+F T R+P        +D +VH+++S Y+ V  RG Y+++   +  + L P ++E Q Q ILD    P    + +G  TAG+R  WA  R+ FF  G NK SL+ IEKAAF + L+D+ Q    +D +  +D +  SLLHGK +DRW+DKSF++V+FKNG+ G NAEHSWADAPI++H WEY L  D  S + GY  +GHC+G    +   PQ+L W + K  + ++ +CL     L +DID H+  F +FG+G +K  K+SPDGFIQ+ALQLA+YRD   FCLTYEA MTRLFREGRTETVRSCS+ SC F+++ EN +DL    ++  ++ AS KHQ LYR AMTG G+DRH+FC+YV+SKYL IES FL++ALS PW+LSTSQTP  QL  FD   +P++++ GGGFGPV  DGYGVSY + GE II FH+SS  SC  TDS +F   + +AL D+ +L   N  D++G +
Sbjct:   11 EPFKIFPPKLDSRKSRWDSGMAEAHQAVAFQFTITPEGIDLQLSHEALRQVYLSGLRSWKKRIVRLKNNVITGVYPASPSSWLFVVIAILATMYTRSDPSMGLIAKIQEHLPASGSMSMQCQTVVSAVLFSTLLWLSLIFTMKLCLKQLLSYHRWMFEQHGNVSTTTKVWVMLVRIFSGRQPLLYSYQGSLPNLPVPAIKDTVKRYLESVRPLKSDSEFERMTNLAKEFEDSLGSRLQWYLKLKALWASNYVSDWWEEYIYLRGRGPIMVNSNYYGMDFLYVTPTPIQAARAGNTLHAVLMYRRRLNKEEIKPSRIPGTFIPLCAAQCERIFNTTRIP-----GEETDTVVHWQDSEYVAVYHRGRYFRLWLYQAGRMLSPREIEYQIQRILDDPSPPAPGEEKLGAFTAGDRIPWAKARKEFFSSGVNKRSLDCIEKAAFFVTLDDDEQGMMGDDPAANVDRYAKSLLHGKCYDRWFDKSFSVVIFKNGKNGLNAEHSWADAPIVSHMWEYALATD--SFQLGYNEEGHCKGDVNPSLPQPQRLTWDIPKQCQEQVAQCLAVAQPLADDIDFHVFAFRDFGKGSIKKIKMSPDGFIQLALQLAFYRDRGVFCLTYEASMTRLFREGRTETVRSCSSESCAFIKAFENGEDLEVCRRL--IRNASEKHQMLYRLAMTGAGIDRHLFCLYVVSKYLGIESPFLKEALSEPWRLSTSQTPFQQLELFDFVNHPDYITCGGGFGPVADDGYGVSYSLIGEKIISFHVSSKHSCPDTDSHKFGTQIRKALHDLLQLMTINQSDAAGSE 805          
BLAST of Carnitine O-palmitoyltransferase 1, liver isoform vs. Ensembl Cavefish
Match: cpt1ab (carnitine O-palmitoyltransferase 1, liver isoform-like [Source:NCBI gene;Acc:103025592])

HSP 1 Score: 704.901 bits (1818), Expect = 0.000e+0
Identity = 358/781 (45.84%), Postives = 507/781 (64.92%), Query Frame = 3
Query:  165 MAEAHQAVAFSIKVSDDGIDWSLNFKAFKEIAKSGVKSWKKGLYRIQNRFYNGLYPSQPGNWLGIVCGVFA-SSMVGFDLSFGLIEKIEVQLQRVLELESPRDHLIASLMYSCGLWTAGVIVRKYTLSNLLYYMDWMYESQTGPSMKTKAWMVLVTILGGGNPKLYSYQGXXXXXXXXXXXXTINKFLTSMEPLLSXXXXXXXXXXXXXXXXQHGFKIQFYLHLKYLWSSNYVSDWWEEFVYLSSRSSLMINSNYYGMDALMLRHEWIQAARAANLICASVQFMRELNTEELEPLVIQGKVPLCSRQYERMFCTVRVPRNISRKNRSDQLVHYRESRYIVVICRGNYYKVNFMKGDQYLDPVDMEKQFQNILDTAVQPNDPSQYIGVLTAGERNQWAINRESFFKDGCNKESLEIIEKAAFMLVLEDEFQDYNP-NDESKLDAFGHSLLHGKGHDRWYDKSFNMVVFKNGRVGFNAEHSWADAPIMAHYWEYILLEDILSPKFGYTPDGHCRGVGKSNNISPQKLQWKLSKMIELEIEKCLLTTSKLIEDIDLHIVPFSEFGRGFMKTCKVSPDGFIQMALQLAYYRDSESFCLTYEACMTRLFREGRTETVRSCSNASCEFVRSMENKDLSNSDKINYLQLASNKHQKLYRDAMTGKGVDRHIFCMYVISKYLNIESEFLQKALSVPWKLSTSQTPHTQLTKFDMRRYPNFLSAGGGFGPVTSDGYGVSYMMAGEDIIFFHISSNISCQKTDSKRFANNLCQALLDIKKLFNPLDSSGDK 2501
            MAEAHQAVAF   V+ DGID  L  +A +++  SG+ +WKK   R +N    G+YP  P   L +V G  + +     D SFG++ K+   +     +      +   ++   GLW   + V +  L +LL +  WMY      S+ TK W+VLV +  G  P LYSYQ SLP LP+P + ST+ ++L S   L+ +E+Y  ++ LA +F+K  G ++Q+YL LK  W+SNYVSDWWEE+VYL  R  +M+NSNYY MD L +    +QAARA N I +++ + R+L+  +++PL++   +P+CS QYERMF T RVP        +D + H  ES++IVV  +G ++KV      + L P ++E+Q + IL    +P      +  LTAGER  WA  R  FF  G NK +L+ +EKAAF + L+D  Q Y+P N    LD++  SLLHGK +DRW+DKSFN++VFKNG +G NAEH+WADAPI+ H WE +L  D ++   GY  DGHC+G    +   PQ+LQW + +  +  I   L   + L +D+D HI+PFS+FG+G +K CK SPD FIQ+ALQLA++RD   FCLTYEA MTRLF+EGRTETVRSC+  SC+FVR+M ++  +  +++  L++A++KHQ LYR AMTGKG+DRH+FC+YV+S+YL ++S FL++ LS PW+LSTSQTP  Q+  F++ + P ++++GGGFGPV  DGYGVSY++ GE++I FHISS  S  +TDS RF  ++ QA+ DI  LF  LD    K
Sbjct:    1 MAEAHQAVAFQFTVTPDGIDLQLCHEALRQVYLSGLHNWKKKFVRFKNGVMTGVYPGSPTGLLVVVSGYMSYAKYTKMDPSFGIVAKLATHIPISKYITEDGQRIAGGVLVGTGLWVTIIFVMRNVLKSLLSWHGWMYNRHGTVSIGTKMWLVLVKLFSGRKPMLYSYQSSLPNLPVPSVKSTVKRYLESARALMDDEDYKRMEGLAKDFEKNLGPRVQWYLKLKSWWTSNYVSDWWEEYVYLRGRGPIMVNSNYYAMDFLYVFPTHLQAARAGNAIHSAMLYRRKLDRAQIKPLMVLNTIPMCSSQYERMFNTTRVP-----GVETDVIQHVNESKHIVVYHKGRFFKVWMFYDGRLLFPREIEQQMERILADTSEPQPGEMTLAALTAGERVPWAKARTEFFSKGKNKHALDSVEKAAFFVTLDDTEQRYDPKNPVQSLDSYAKSLLHGKCYDRWFDKSFNLIVFKNGTMGLNAEHTWADAPIVGHLWEQVLAFDPVT--LGYAEDGHCKGKTHPSLPGPQRLQWDIPEECQSVIASSLKVANALADDVDSHIIPFSDFGKGLIKKCKTSPDAFIQLALQLAHFRDKGKFCLTYEASMTRLFKEGRTETVRSCTVQSCDFVRAMMDEKQTREERLRLLKVAADKHQDLYRMAMTGKGIDRHLFCLYVVSRYLGVDSPFLKEVLSEPWRLSTSQTPLQQVDLFNLAKNPEYVTSGGGFGPVADDGYGVSYIILGENLINFHISSKHSSPETDSHRFGQHIQQAMRDILSLFQ-LDKKATK 773          
BLAST of Carnitine O-palmitoyltransferase 1, liver isoform vs. Ensembl Cavefish
Match: cpt1ab (carnitine O-palmitoyltransferase 1, liver isoform-like [Source:NCBI gene;Acc:103025592])

HSP 1 Score: 700.664 bits (1807), Expect = 0.000e+0
Identity = 358/782 (45.78%), Postives = 509/782 (65.09%), Query Frame = 3
Query:  165 MAEAHQAVAFSIKVSDDGIDWSLNFKAFKEIAKSGVKSWKKGLYRIQNRFYNGLYPSQPGNWLGIVCGVFA-SSMVGFDLSFGLIEKIEVQLQRVLELESPRDHLIASLMYSCGLWTAGVIVRKYTLSNLLYYMDWMYESQTGPSMKTKAWMVLVTILGGGNPKLYSYQGXXXXXXXXXXXXTINKFLTSMEPLLSXXXXXXXXXXXXXXXXQHGFKIQFYLHLKYLWSSNYVSDWWEEFVYLSSRSSLMINSNYYGMDALMLRHEWIQAARAANLICASVQFMRELNTEELEPL-VIQGKVPLCSRQYERMFCTVRVPRNISRKNRSDQLVHYRESRYIVVICRGNYYKVNFMKGDQYLDPVDMEKQFQNILDTAVQPNDPSQYIGVLTAGERNQWAINRESFFKDGCNKESLEIIEKAAFMLVLEDEFQDYNP-NDESKLDAFGHSLLHGKGHDRWYDKSFNMVVFKNGRVGFNAEHSWADAPIMAHYWEYILLEDILSPKFGYTPDGHCRGVGKSNNISPQKLQWKLSKMIELEIEKCLLTTSKLIEDIDLHIVPFSEFGRGFMKTCKVSPDGFIQMALQLAYYRDSESFCLTYEACMTRLFREGRTETVRSCSNASCEFVRSMENKDLSNSDKINYLQLASNKHQKLYRDAMTGKGVDRHIFCMYVISKYLNIESEFLQKALSVPWKLSTSQTPHTQLTKFDMRRYPNFLSAGGGFGPVTSDGYGVSYMMAGEDIIFFHISSNISCQKTDSKRFANNLCQALLDIKKLFNPLDSSGDK 2501
            MAEAHQAVAF   V+ DGID  L  +A +++  SG+ +WKK   R +N    G+YP  P   L +V G  + +     D SFG++ K+   +     +      +   ++   GLW   + V +  L +LL +  WMY      S+ TK W+VLV +  G  P LYSYQ SLP LP+P + ST+ ++L S   L+ +E+Y  ++ LA +F+K  G ++Q+YL LK  W+SNYVSDWWEE+VYL  R  +M+NSNYY MD L +    +QAARA N I +++ + R+L+  +++P+ +++ KVPLCS Q+ERMF T R+P        +D + H  ES++IVV  +G ++KV      + L P ++E+Q + IL    +P      +  LTAGER  WA  R  FF  G NK +L+ +EKAAF + L+D  Q Y+P N    LD++  SLLHGK +DRW+DKSFN++VFKNG +G NAEH+WADAPI+ H WE +L  D ++   GY  DGHC+G    +   PQ+LQW + +  +  I   L   + L +D+D HI+PFS+FG+G +K CK SPD FIQ+ALQLA++RD   FCLTYEA MTRLF+EGRTETVRSC+  SC+FVR+M ++  +  +++  L++A++KHQ LYR AMTGKG+DRH+FC+YV+S+YL ++S FL++ LS PW+LSTSQTP  Q+  F++ + P ++++GGGFGPV  DGYGVSY++ GE++I FHISS  S  +TDS RF  ++ QA+ DI  LF  LD    K
Sbjct:    1 MAEAHQAVAFQFTVTPDGIDLQLCHEALRQVYLSGLHNWKKKFVRFKNGVMTGVYPGSPTGLLVVVSGYMSYAKYTKMDPSFGIVAKLATHIPISKYITEDGQRIAGGVLVGTGLWVTIIFVMRNVLKSLLSWHGWMYNRHGTVSIGTKMWLVLVKLFSGRKPMLYSYQSSLPNLPVPSVKSTVKRYLESARALMDDEDYKRMEGLAKDFEKNLGPRVQWYLKLKSWWTSNYVSDWWEEYVYLRGRGPIMVNSNYYAMDFLYVFPTHLQAARAGNAIHSAMLYRRKLDRAQIKPVYLLENKVPLCSAQWERMFNTSRIP-----GVETDVIQHVNESKHIVVYHKGRFFKVWMFYDGRLLFPREIEQQMERILADTSEPQPGEMTLAALTAGERVPWAKARTEFFSKGKNKHALDSVEKAAFFVTLDDTEQRYDPKNPVQSLDSYAKSLLHGKCYDRWFDKSFNLIVFKNGTMGLNAEHTWADAPIVGHLWEQVLAFDPVT--LGYAEDGHCKGKTHPSLPGPQRLQWDIPEECQSVIASSLKVANALADDVDSHIIPFSDFGKGLIKKCKTSPDAFIQLALQLAHFRDKGKFCLTYEASMTRLFKEGRTETVRSCTVQSCDFVRAMMDEKQTREERLRLLKVAADKHQDLYRMAMTGKGIDRHLFCLYVVSRYLGVDSPFLKEVLSEPWRLSTSQTPLQQVDLFNLAKNPEYVTSGGGFGPVADDGYGVSYIILGENLINFHISSKHSSPETDSHRFGQHIQQAMRDILSLFQ-LDKKATK 774          
BLAST of Carnitine O-palmitoyltransferase 1, liver isoform vs. Ensembl Cavefish
Match: cpt1ab (carnitine O-palmitoyltransferase 1, liver isoform-like [Source:NCBI gene;Acc:103025592])

HSP 1 Score: 700.664 bits (1807), Expect = 0.000e+0
Identity = 358/782 (45.78%), Postives = 509/782 (65.09%), Query Frame = 3
Query:  165 MAEAHQAVAFSIKVSDDGIDWSLNFKAFKEIAKSGVKSWKKGLYRIQNRFYNGLYPSQPGNWLGIVCGVFA-SSMVGFDLSFGLIEKIEVQLQRVLELESPRDHLIASLMYSCGLWTAGVIVRKYTLSNLLYYMDWMYESQTGPSMKTKAWMVLVTILGGGNPKLYSYQGXXXXXXXXXXXXTINKFLTSMEPLLSXXXXXXXXXXXXXXXXQHGFKIQFYLHLKYLWSSNYVSDWWEEFVYLSSRSSLMINSNYYGMDALMLRHEWIQAARAANLICASVQFMRELNTEELEPL-VIQGKVPLCSRQYERMFCTVRVPRNISRKNRSDQLVHYRESRYIVVICRGNYYKVNFMKGDQYLDPVDMEKQFQNILDTAVQPNDPSQYIGVLTAGERNQWAINRESFFKDGCNKESLEIIEKAAFMLVLEDEFQDYNP-NDESKLDAFGHSLLHGKGHDRWYDKSFNMVVFKNGRVGFNAEHSWADAPIMAHYWEYILLEDILSPKFGYTPDGHCRGVGKSNNISPQKLQWKLSKMIELEIEKCLLTTSKLIEDIDLHIVPFSEFGRGFMKTCKVSPDGFIQMALQLAYYRDSESFCLTYEACMTRLFREGRTETVRSCSNASCEFVRSMENKDLSNSDKINYLQLASNKHQKLYRDAMTGKGVDRHIFCMYVISKYLNIESEFLQKALSVPWKLSTSQTPHTQLTKFDMRRYPNFLSAGGGFGPVTSDGYGVSYMMAGEDIIFFHISSNISCQKTDSKRFANNLCQALLDIKKLFNPLDSSGDK 2501
            MAEAHQAVAF   V+ DGID  L  +A +++  SG+ +WKK   R +N    G+YP  P   L +V G  + +     D SFG++ K+   +     +      +   ++   GLW   + V +  L +LL +  WMY      S+ TK W+VLV +  G  P LYSYQ SLP LP+P + ST+ ++L S   L+ +E+Y  ++ LA +F+K  G ++Q+YL LK  W+SNYVSDWWEE+VYL  R  +M+NSNYY MD L +    +QAARA N I +++ + R+L+  +++P+ +++ KVPLCS Q+ERMF T R+P        +D + H  ES++IVV  +G ++KV      + L P ++E+Q + IL    +P      +  LTAGER  WA  R  FF  G NK +L+ +EKAAF + L+D  Q Y+P N    LD++  SLLHGK +DRW+DKSFN++VFKNG +G NAEH+WADAPI+ H WE +L  D ++   GY  DGHC+G    +   PQ+LQW + +  +  I   L   + L +D+D HI+PFS+FG+G +K CK SPD FIQ+ALQLA++RD   FCLTYEA MTRLF+EGRTETVRSC+  SC+FVR+M ++  +  +++  L++A++KHQ LYR AMTGKG+DRH+FC+YV+S+YL ++S FL++ LS PW+LSTSQTP  Q+  F++ + P ++++GGGFGPV  DGYGVSY++ GE++I FHISS  S  +TDS RF  ++ QA+ DI  LF  LD    K
Sbjct:    1 MAEAHQAVAFQFTVTPDGIDLQLCHEALRQVYLSGLHNWKKKFVRFKNGVMTGVYPGSPTGLLVVVSGYMSYAKYTKMDPSFGIVAKLATHIPISKYITEDGQRIAGGVLVGTGLWVTIIFVMRNVLKSLLSWHGWMYNRHGTVSIGTKMWLVLVKLFSGRKPMLYSYQSSLPNLPVPSVKSTVKRYLESARALMDDEDYKRMEGLAKDFEKNLGPRVQWYLKLKSWWTSNYVSDWWEEYVYLRGRGPIMVNSNYYAMDFLYVFPTHLQAARAGNAIHSAMLYRRKLDRAQIKPVYLLENKVPLCSAQWERMFNTSRIP-----GVETDVIQHVNESKHIVVYHKGRFFKVWMFYDGRLLFPREIEQQMERILADTSEPQPGEMTLAALTAGERVPWAKARTEFFSKGKNKHALDSVEKAAFFVTLDDTEQRYDPKNPVQSLDSYAKSLLHGKCYDRWFDKSFNLIVFKNGTMGLNAEHTWADAPIVGHLWEQVLAFDPVT--LGYAEDGHCKGKTHPSLPGPQRLQWDIPEECQSVIASSLKVANALADDVDSHIIPFSDFGKGLIKKCKTSPDAFIQLALQLAHFRDKGKFCLTYEASMTRLFKEGRTETVRSCTVQSCDFVRAMMDEKQTREERLRLLKVAADKHQDLYRMAMTGKGIDRHLFCLYVVSRYLGVDSPFLKEVLSEPWRLSTSQTPLQQVDLFNLAKNPEYVTSGGGFGPVADDGYGVSYIILGENLINFHISSKHSSPETDSHRFGQHIQQAMRDILSLFQ-LDKKATK 774          
BLAST of Carnitine O-palmitoyltransferase 1, liver isoform vs. Ensembl Cavefish
Match: cpt1cb (carnitine O-palmitoyltransferase 1, liver isoform-like [Source:NCBI gene;Acc:103024546])

HSP 1 Score: 689.493 bits (1778), Expect = 0.000e+0
Identity = 358/775 (46.19%), Postives = 496/775 (64.00%), Query Frame = 3
Query:  165 MAEAHQAVAFSIKVSDDGIDWSLNFKAFKEIAKSGVKSWKKGLYRIQNRFYNGLYPSQPGNWLGIVCGVFASSMVGFDLSFGLIEKIEVQLQRVLELESPRD--HLIASLMYSCGLWTAGVIVRKYTLSNLLYYMDWMYESQTGPSMKTKAWMVLVTILGGGNPKLYSYQGXXXXXXXXXXXXTINKFLTSMEPLLSXXXXXXXXXXXXXXXXQHGFKIQFYLHLKYLWSSNYVSDWWEEFVYLSSRSSLMINSNYYGMDALMLRHEWIQAARAANLICASVQFMRELNTEELEPLVIQGKV-PLCSRQYERMFCTVRVPRNISRKNRSDQLVHYRESRYIVVICRGNYYKVNFMKGDQYLDPVDMEKQFQNILDTAVQPNDPSQYIGVLTAGERNQWAINRESFFKDGCNKESLEIIEKAAFMLVLEDEFQDYNPNDES-KLDAFGHSLLHGKGHDRWYDKSFNMVVFKNGRVGFNAEHSWADAPIMAHYWEYILLEDILSPKFGYTPDGHCRGVGKSNNISPQKLQWKLSKMIELEIEKCLLTTSKLIEDIDLHIVPFSEFGRGFMKTCKVSPDGFIQMALQLAYYRDSESFCLTYEACMTRLFREGRTETVRSCSNASCEFVRSMENKDLSNSDKINYLQLASNKHQKLYRDAMTGKGVDRHIFCMYVISKYLNIESEFLQKALSVPWKLSTSQTPHTQLTKFDMRRYPNFLSAGGGFGPVTSDGYGVSYMMAGEDIIFFHISSNISCQKTDSKRFANNLCQALLDIKKLFN 2477
            MAEAHQAVAF   ++ DG+D  L+ +A  +I  SG++SWK    R++N    G+YP+ P +WL +V  + A+     D S GLI KI+  L   L L    +   ++++L++S  LW + +   ++ L  LL Y  WM+E     S  TK W+ LV +     P LYSYQ SLP LP+P +  T++++L S+ PL S  ++  + +LA EF+   G ++Q YL LK LW++NYVSDWWEE++YL  R+ +M+NSNYYGMD L +     QAARA N I A + + R++N EEL+P  I G V PLC+ Q ERMF T R P        +D L H+ +S Y+ V  +G +Y++      + L P +++ Q Q ILD    P    + +G LTAG R  WA  R+ +F  G NK SL++IEKAAF + L+DE +     D +  LD +  SLLHGK +DRW+DKSF++V+FKNG+ G NAEHSWADAP +AH WE+ L  D      GY  +G+C+G    +   PQ+L W +   +++++   L     L +D+D H+ PF EFG+G +K  K+SPD FIQ+ALQLAYYR+   FCLTYEA MTRLFR+GRTETVRSCSN SC+FV ++EN      +     + A+ KHQ LYR AMTG G+DRH+FC+YV+SKYL ++S FL++ LS PW+LSTSQTP  QL  FD+  +P F+S GGGFGPV  DGYGVSY++ GED+I FH+SS  SC++TDS +F   +  AL D+  L +
Sbjct:    1 MAEAHQAVAFQFTITPDGVDLQLSRQALGQICHSGLRSWKNRFSRMKNGVLRGVYPASPSSWLFVVIVILATLHAQSDPSMGLIAKIQDHLPLSLSLTLSANGQTMVSALVFSTLLWLSVISALRFCLKVLLSYHRWMFEQHGRISNITKVWVTLVRLFSSRKPLLYSYQTSLPHLPVPPIKDTLDRYLESIRPLRSPADFERVSRLAAEFESSLGNRLQRYLKLKALWATNYVSDWWEEYIYLRGRNPIMVNSNYYGMDYLYVTPTANQAARAGNTITALLLYRRKVNREELKPSRIPGTVIPLCAAQCERMFNTTRAP-----GEETDVLQHWEDSEYVAVYHKGRFYRLWVYLTGRLLSPREIQYQIQRILDDPSPPQPGEEKLGALTAGNRIPWARIRKQYFSSGVNKRSLDLIEKAAFFVTLDDEEEGMRGEDPAGNLDRYAKSLLHGKCYDRWFDKSFSVVIFKNGKTGLNAEHSWADAPTVAHLWEFTLATDAF--HLGYDTNGNCKGEVDCSLPPPQRLTWNIPSEVQVQVSDSLAVARALADDVDCHVFPFQEFGKGRIKKLKISPDAFIQLALQLAYYRNRGGFCLTYEASMTRLFRDGRTETVRSCSNESCDFVLALENGK-GREECCKLFRKAAEKHQNLYRLAMTGSGIDRHLFCLYVVSKYLGVDSPFLKEVLSEPWRLSTSQTPIQQLELFDLVNHPEFVSLGGGFGPVADDGYGVSYIIVGEDMINFHVSSKHSCKETDSHKFGFEISHALTDLMNLLS 767          
BLAST of Carnitine O-palmitoyltransferase 1, liver isoform vs. Ensembl Sea Lamprey
Match: cpt1aa (carnitine palmitoyltransferase 1Aa (liver) [Source:ZFIN;Acc:ZDB-GENE-060503-925])

HSP 1 Score: 724.931 bits (1870), Expect = 0.000e+0
Identity = 361/772 (46.76%), Postives = 509/772 (65.93%), Query Frame = 3
Query:  165 MAEAHQAVAFSIKVSDDGIDWSLNFKAFKEIAKSGVKSWKKGLYRIQNRFYNGLYPSQPGNWLGIVCGVFASSMVGFDLSFGLIEKIEVQLQRVLELESPRDHLIASLMYSCGLWTAGVIVRKYTLSNLLYYMDWMYESQTGPSMKTKAWMVLVTILGGGNPKLYSYQGXXXXXXXXXXXXTINKFLTSMEPLLSXXXXXXXXXXXXXXXXQHGFKIQFYLHLKYLWSSNYVSDWWEEFVYLSSRSSLMINSNYYGMDALMLRHEWIQAARAANLICASVQFMRELNTEELEPLVIQGKVPLCSRQYERMFCTVRVPRNISRKNRSDQLVHYRESRYIVVICRGNYYKVNFMKGDQYLDPVDMEKQFQNILDTAVQPNDPSQYIGVLTAGERNQWAINRESFFKDGCNKESLEIIEKAAFMLVLEDEFQDYNPNDESKLDAFGHSLLHGKGHDRWYDKSFNMVVFKNGRVGFNAEHSWADAPIMAHYWEYILLEDILSPKFGYTPDGHCRGVGKSNNISP-QKLQWKLSKMIELEIEKCLLTTSKLIEDIDLHIVPFSEFGRGFMKTCKVSPDGFIQMALQLAYYRDSESFCLTYEACMTRLFREGRTETVRSCSNASCEFVRSMENKDLSNSDKINYLQLASNKHQKLYRDAMTGKGVDRHIFCMYVISKYLNIESEFLQKALSVPWKLSTSQTPHTQLTKFDMRRYPNFLSAGGGFGPVTSDGYGVSYMMAGEDIIFFHISSNISCQKTDSKRFANNLCQALLDIKKLFN 2477
            MAEAHQAVAF   V+ DGID  L  +A K++  SG ++W++ +  I+N    GLYP  P +W+ +  G   S  +  D S GLI +I   L     +      ++++++++ GLW A ++  +YTL  LL Y  WM++     S  TK W+++V I  G NP+LYS+Q SLP+LP+P +  T++++L S++PLL E+++  ++ LA +F+K  G K+Q+YL LK  W+SNYVSDWWEE++YL  R  +M+NSNYY  D L ++   +QAARAAN+I A + + R L+ EE++P+++QG +P+CS QYERMF T R+P   +       L H  +S+++ V   G +YKV    G Q L P  +++  Q+ILD    P     ++  LTAGER  WA  R S+F +G N  +L+ +EKAAF + L+D  Q Y  +    LDA+  SLLHGK +DRW+DKSF ++VFKNGR+G NAEHSWADAPIM H WEY+L  D    K GYT +G+CRG  +   + P Q+LQW +    +  IE  L     L +D+D H+ PF EFG+G +K C+ SPD FIQ+ALQLA++RD   FCLTYEA MTRLF+EGRTETVRSC+  S +F R+M++   +  D++   +  S KHQ +YR AMTG G+DRH+FC+Y++SKYL  +S FL++ LS PW+LSTSQTP  Q+  FD+ ++P+ +S+GGGFGPV  DGYGVSY++ GE +I FHISS  S  +TDS RF   + QA+LDI  LF 
Sbjct:    1 MAEAHQAVAFQFTVTPDGIDLRLCHEALKQVWLSGARNWRRRVTSIKNTVLTGLYPVHPSSWMVVAVGTVGSVYLRVDPSMGLIARIRDALPNGGLISPHNKEMLSAVLFASGLWGAIILTMRYTLKGLLTYHGWMFQPHGRISHATKLWILMVKIFSGRNPQLYSFQSSLPRLPVPSVHDTMSRYLESVQPLLDEKKFQRMEGLARDFEKNLGPKLQWYLKLKSWWASNYVSDWWEEYIYLRGRGPIMVNSNYYATDFLYVKPTTVQAARAANVIHAMMLYRRMLDREEVKPMMVQGAIPMCSAQYERMFNTTRIPGIETLY----VLEHRNDSKHMCVYHAGRFYKVWLYLGGQLLGPRALQEMLQHILDDPSPPQPGEHHLAALTAGERIPWAKARSSYFSEGRNFTALQAVEKAAFFITLDDTEQGYRGDSTGSLDAYCKSLLHGKCYDRWFDKSFTVIVFKNGRIGLNAEHSWADAPIMGHLWEYVLATDTF--KLGYTDEGNCRG--EVGTLPPVQRLQWDIPAECQTVIENSLAVAQALADDVDFHMFPFHEFGKGLIKKCRTSPDAFIQLALQLAHFRDKGCFCLTYEASMTRLFKEGRTETVRSCTVESTKFARAMQDPSCTKEDRLALFRQGSEKHQSMYRLAMTGGGIDRHLFCLYLVSKYLGQDSPFLKEVLSEPWRLSTSQTPQQQMELFDLNKFPDHVSSGGGFGPVADDGYGVSYIILGEKLINFHISSKKSSPETDSHRFGGAIKQAMLDILALFG 764          
BLAST of Carnitine O-palmitoyltransferase 1, liver isoform vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008936.1 (pep scaffold:Pmarinus_7.0:GL476544:65876:98929:-1 gene:ENSPMAG00000008041.1 transcript:ENSPMAT00000008936.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 696.041 bits (1795), Expect = 0.000e+0
Identity = 343/772 (44.43%), Postives = 506/772 (65.54%), Query Frame = 3
Query:  165 MAEAHQAVAFSIKVSDDGIDWSLNFKAFKEIAKSGVKSWKKGLYRIQNRFYNGLYPSQPGNWLGIVCGVFASSMVGFDLSFGLIEKIEVQLQRVLELESPRDHLIASLMYSCGLWTAGVIVRKYTLSNLLYYMDWMYESQTGPSMKTKAWMVLVTILGGGNPKLYSYQGXXXXXXXXXXXXTINKFLTSMEPLLSXXXXXXXXXXXXXXXXQHGFKIQFYLHLKYLWSSNYVSDWWEEFVYLSSRSSLMINSNYYGMDALMLRHEWIQAARAANLICASVQFMRELNTEELEPLVIQGK-VPLCSRQYERMFCTVRVPRNISRKNRSDQLVHYRESRYIVVICRGNYYKVNFMKGDQYLDPVDMEKQFQNILDTAVQPNDPSQYIGVLTAGERNQWAINRESFFKDGCNKESLEIIEKAAFMLVLEDEFQDYNPND-ESKLDAFGHSLLHGKGHDRWYDKSFNMVVFKNGRVGFNAEHSWADAPIMAHYWEYILLEDILSPKFGYTPDGHCRGVGKSNNISPQKLQWKLSKMIELEIEKCLLTTSKLIEDIDLHIVPFSEFGRGFMKTCKVSPDGFIQMALQLAYYRDSESFCLTYEACMTRLFREGRTETVRSCSNASCEFVRSMENKDLSNSDKINYLQLASNKHQKLYRDAMTGKGVDRHIFCMYVISKYLNIESEFLQKALSVPWKLSTSQTPHTQLTKFDMRRYPNFLSAGGGFGPVTSDGYGVSYMMAGEDIIFFHISSNISCQKTDSKRFANNLCQALLDIKKLF 2474
            MAEAHQAVAF   V+ +GID  L+ +A  ++ KSGV+SWKK   R++N   +G+YP+ P +WL +V  + A+     + S G+I+ I+  L     L      +++ L+ + GLW   ++  +  L  LL Y  WM +     S+ TK WM LV +       LYS+Q SLP+L +P +  T+ ++L S+ PL+ +E++   + LA +F+     K+Q+YL LK  W+SNYVSDWWEE++YL  R  +M+NSNYYGMD L +    IQAARA N++ A + + ++L  EEL+PL +    +PLCS Q+ERMF T R+P        +D L H  +S+++VV  RG ++++    G++ L P +++KQFQ ILD    P    + +  LTAG+R  WA  R +FF+ G N+ S++ +E+AAF L L D+ Q Y P+D E  L+ +  SLLHGK +DRW+DKSF++VVFKNG+ G NAEHSWADAPI+AH +EY+++ D L    GYT +G+C G  +     P++LQW + +  +  +E  +     L +D+D      ++FG+GF+K  + SPD F+Q+ LQLA++RD   FCLTYEA MTRLFREGRTETVRSC++ +C FVRSM++ +++ ++++   + A +KHQ++Y  AMTG G+DRH+FC+YV+S+YL +ES FL++ LS PW+LSTSQTP  Q   FD  + P++++ GGGFGPV  DGYGVSY++ GE++I FHISS  SC  TDS RF  N+ + L ++K + 
Sbjct:    1 MAEAHQAVAFQFTVTPEGIDLRLSHEALNQVFKSGVRSWKKRALRLKNNIVSGMYPATPSSWLFVVVAIMATKYARMEPSLGMIDTIQQSLPTTEYLSRDSKDVLSGLLLATGLWLGLILALRQFLKLLLSYHSWMLQRHKKLSLTTKIWMGLVQLFCSRKAMLYSHQASLPRLFVPSIPDTMRRYLESVRPLMDDEKFERTQALATDFQNTLAPKLQWYLKLKSWWASNYVSDWWEEYIYLRGRGPIMVNSNYYGMDFLYVTPTSIQAARAGNVVYAILMYRKKLELEELQPLTLPNSCIPLCSAQWERMFNTTRIP-----GIETDTLQHLNDSKHLVVYHRGRFFRLWLYHGERLLGPRELQKQFQRILDDPSAPQTGEEKLAALTAGDRVPWAKARHAFFRSGVNRVSMDAVEQAAFFLTLSDDEQGYRPDDPERTLNDYSKSLLHGKCYDRWFDKSFSLVVFKNGKTGINAEHSWADAPIVAHMFEYVMVTDALV--MGYTAEGNCHGDTEMGLPPPRRLQWDIPEECQEVVEDSMRVAQALADDVDCCTFAITDFGKGFIKKFRTSPDAFVQVMLQLAHFRDMGKFCLTYEASMTRLFREGRTETVRSCTSEACAFVRSMQDPNVTAAERVALFRTAMDKHQRMYLLAMTGLGIDRHLFCLYVVSRYLGLESPFLKEVLSEPWRLSTSQTPLQQTKMFDPNQNPDYVTCGGGFGPVADDGYGVSYIIIGENMINFHISSKNSCPDTDSSRFGRNIRKVLQELKDMI 765          
BLAST of Carnitine O-palmitoyltransferase 1, liver isoform vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002015.1 (pep scaffold:Pmarinus_7.0:GL479138:18281:30704:1 gene:ENSPMAG00000001805.1 transcript:ENSPMAT00000002015.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 227.639 bits (579), Expect = 1.423e-64
Identity = 163/569 (28.65%), Postives = 270/569 (47.45%), Query Frame = 3
Query:  804 GFKIQFYLHLKYLWSSNYVSDWWEEFVYLSSRSSLMINSNYYGMDALMLRHEWIQAAR-----AANLICASVQFMRELNTEELEPLVIQGKVPLCSRQYERMFCTVRVPRNISRKNRSDQLVHYRESRYIVVICRGNYYKVNFMKGD-QYLDPVDMEKQFQNILDTAVQPNDPSQYIGVLTAGERNQWAINRESFFKDGCNKESLEIIEKAAFMLVLEDEFQDYNPNDESKLDAFGHSLLHGKGH-----DRWYDKSFNMVVFKNGRVGFNAEHSWADAPIMAHYWEYILL--EDILSPKFGYTPDGHCRGVGKSNNISPQKLQWKLSKMIELEIEKCLLTTSKLIEDIDLHIVPFSEFGRGFMKTCKVSPDGFIQMALQLAYYRDSESFCLTYEACMTRLFREGRTETVRSCSNASCEFVRSMENKDLSNSDKINYLQLASNKHQKLYRDAMTGKGVDRHIFCMYVISKYLNIESEFLQKALSVPWKLSTSQTPHTQLTKFDMRRYPNFLSAGGGFGPVTSDGYGVSYMMAGEDIIFFHISSNISCQKTDSKRFANNLCQALLDIKKL 2471
            G  +Q  L  +     N++SDWW    YL  R  ++++S+      ++L H+  + A      AA LI   + +   ++ E L P+   G  PLC  QY R+F + RVP  + R +  +        ++I V    ++Y +     D + LD  ++ +Q +NI   ++        +G+LTA +R+ WA   +    D  ++ S++ +E++AF L L+   Q      E  +      +LHG G      +RW+DK+   +V   G  G   EH+ A+ P +    ++++   E         T  G        +   P+ LQ+ LS  +     +  +   +L+ ++++    F  FG+GF K+ K+SPD FIQ+ LQLAYYR     C TYE+   R+FR GRTET+RS S  S  F R+M + +     K+  ++ A   H++    A+TG+GVDRH+         L ++ + L++ + +P   S          +    + P        FGPV  DGYGV Y    E+ I   +S+  SC  T + R A  L QALLD+++L
Sbjct:   85 GEVLQAGLERRARERENWLSDWWLLTAYLEYRLPVVVHSS----PGVVLPHQPYRDAHGQLWFAAQLIAGVLDYKAMVDNESL-PVEHLGGRPLCMDQYYRLFSSCRVP-GLPRDSVRNVARDAYPPKHITVASNAHFYHMEVYGADGKVLDVENLYEQLKNIRTHSL--GLAPGVVGLLTAQDRDSWAKIYQVLTADEKHRGSVDAVERSAFALCLDGPGQ----RPEWDMSLAAAQMLHGGGSALHSANRWFDKTLQFIVGDGGTCGLIYEHAPAEGPPIVALVDHVVAYCEKSRQQTAPTTSQG-----APVHGAEPRHLQFSLSPELLALAAEAKVGLDQLVANLEVECFVFKNFGKGFPKSQKLSPDAFIQIGLQLAYYRLYAQPCATYESASLRMFRLGRTETIRSTSRHSLAFSRAMGDPNCDRQTKVQLMKKAIQAHREYTTRAITGQGVDRHL---------LGLKLQALEEGVPLPEIYSDPTYQAAMHYRLSTSQVPARTDCVMCFGPVVEDGYGVCYNPM-ENHINLAVSAFRSCPDTSAARLAQALHQALLDMQEL 626          
BLAST of Carnitine O-palmitoyltransferase 1, liver isoform vs. Ensembl Sea Lamprey
Match: chata (choline O-acetyltransferase a [Source:NCBI gene;Acc:100170938])

HSP 1 Score: 181.03 bits (458), Expect = 3.046e-48
Identity = 159/583 (27.27%), Postives = 270/583 (46.31%), Query Frame = 3
Query:  801 HGFKIQFYLHLKYLWSSNYVSDWWEEFVYLSSRSSLMINSNYYGM--DALMLRHEWIQAARAANLICASVQFMRELNTEELEPLVIQGKV---PLCSRQYERMFCTVRV---PRNISRKNRSDQLVHYRESRYIVVICRGNYYKVNFMKGDQYLDPVDMEKQFQNILDTAVQPNDPSQYIGVLTAGERNQWAINRESFFKDGCNKESLEIIEKAAFMLVLEDEFQDYNPNDESKLDAFGHSLLHGKGH-----DRWYDKSFNMVVFKNGRVGFNAEHSWADAPIMAHYWEYILLEDILSPKFGYTPDGHCRGVGKSNNI----SPQKLQWKLSKMIELEIEKCLLTTSKLIEDIDLHIVPFSEFGRGFMKTCKVSPDGFIQMALQLAYYRDSESFCLTYEACMTRLFREGRTETVRSCSNASCEFVRSMENKD---LSNSD--KINYLQLASNKHQKLYRDAMTGKGVDRHIFCMYVISKYLNIESEFLQKAL----SVPWKLSTSQTPHTQLTKFDMRRYPNFLSAGGGFGPVTSDGYGVSYMMAGEDIIFFHISSNISCQKTDSKRFANNLCQALLDIKKL 2471
            HG ++Q  L  +   +   V +WW   +YL +R  L +NSN  GM     + R +  Q   AA LI   + +   ++   L     +G++   PLC  QY R+F + R+   PR+     RS  +    E  +I+V C  +   +  +   +    + +  +    L  +V  +   +   +    ++  W   +     D  N++SL+ IE+  F+L L+        N      A   ++LHG G      +RW+DK    +V ++G  G   EHS A+   +    E++L          Y  D   R + +++++    +P++L+WKLS  I   +         ++E++DL I  FS +G+ F+K  ++SPD ++Q+ALQLA+Y+       TYE+   R F++GR + +RS +  + +FVR+M +K    LSN D  ++  L  A          A+TG  +D H+  +  I++ L+ +   + K +    S  + LSTSQ P T             + A   +GPV  DGYGVSY       IF  ISS  S   T S+ F+  L  +L +++ L
Sbjct:   58 HGERLQRALVEQKNKTCVQVYEWWLNDMYLDNRVPLPVNSNP-GMVLPRQLFRDQADQLRFAARLISGILDYKVVIDARALPQDFARGQLSGHPLCMEQYYRLFSSYRLAGHPRDTLVAPRSTVMP---EPEHIIVACNNHSVFLYVLIFVRLFVSLQLFPRSTRTLSCSVNQDSRFEPRNIEKQKKKLTWRKTKTPNPTDSTNRDSLDAIERCIFLLCLDGAM-----NRPLTDVALAENMLHGGGARANSGNRWFDKPMQFIVGRDGACGLVYEHSPAEGIAVVQCVEHLL---------SYIKDTSQRKLLRADSVCELPAPRRLRWKLSPEIHEHLAFAARNLDSVVENLDLLIDRFSGYGKEFIKQQRMSPDAYVQVALQLAHYKCHGRLVSTYESASLRRFQQGRVDNIRSATREAWDFVRAMTSKHAGVLSNEDAERMELLWKAIQAQTDYTILAITGMAIDCHMLGLREIARELDHDLPEVFKDITYVQSNLFALSTSQIPTT-------------MDAFMCYGPVVPDGYGVSYNPKDNHFIFC-ISSFHSDPTTGSEHFSRALHDSLDEMRAL 608          
BLAST of Carnitine O-palmitoyltransferase 1, liver isoform vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010501.1 (pep scaffold:Pmarinus_7.0:GL477503:71677:77001:-1 gene:ENSPMAG00000009512.1 transcript:ENSPMAT00000010501.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 134.035 bits (336), Expect = 2.251e-35
Identity = 83/263 (31.56%), Postives = 138/263 (52.47%), Query Frame = 3
Query: 1722 PQKLQWKLSKMIELEIEKCLLTTSKLIEDIDLHIVPFSEFGRGFMKTCKVSPDGFIQMALQLAYYRDSESFCLTYEACMTRLFREGRTETVRSCSNASCEFVRSMENKDLSNSDKINYLQLASNKHQKLYRDAMTGKGVDRHIFCMYV--ISKYLNIESEFLQK--ALSVPWKLSTSQTPHTQLTKFDMRRYPNFLSAGGGFGPVTSDGYGVSYMMAGEDIIFFHISSNISCQKTDSKRFANNLCQALLDIKKLFNPLDSSGD 2498
            P KL + +++ ++  IE         + D+D+    + +FG  F K  ++SPDGFIQMA+QLAY+R      +  E+  TR+F  GRTE +R  S  S  FV + ++ ++SN +K+  +++A   H++  + A+ G+ +DRH+  + +  I    NI   F+    A++   KLSTSQ P +             + A   +GPV  DGYGV Y     D + F +++  SC +T +   A  + +AL D+ +L +    SGD
Sbjct:    4 PTKLYFNINEEVKRMIESAKFHHDIQVGDLDIQCFVYKKFGNAFPKFHRLSPDGFIQMAIQLAYFRLHRELSVATESATTRMFHLGRTEEIRCTSMESLRFVETFDDANVSNEEKMQTMKVAVEAHKEYTQWAVNGQAIDRHLLGLKLQAIEDQYNIPELFMDTSYAIASHLKLSTSQVPGS-------------MDAVMCYGPVVPDGYGVCY-NPQHDRLNFSVTALNSCSQTHADLMAAEIEKALTDMHELLS--SRSGD 250          
BLAST of Carnitine O-palmitoyltransferase 1, liver isoform vs. Ensembl Yeast
Match: CAT2 (Carnitine acetyl-CoA transferase; present in both mitochondria and peroxisomes; transfers activated acetyl groups to carnitine to form acetylcarnitine which can be shuttled across membranes [Source:SGD;Acc:S000004506])

HSP 1 Score: 188.734 bits (478), Expect = 7.295e-51
Identity = 148/521 (28.41%), Postives = 246/521 (47.22%), Query Frame = 3
Query:  852 NYVSDWWEEFVYLSSRSSLMINSNYYGMDALMLRH----EWIQAARAANLICASVQFMRELNTEELEPLVIQGKVPLCSRQYERMFCTVRVPRNISRKNRSDQLVHYRESRYIVVICRGNYYKVNFMKG-DQYLDPVDMEKQFQNILDTAVQPNDPSQYIGVLTAGERNQWAINRESFFKDGCNKESLEIIEKAAFMLVLEDEFQDYNPNDESKLDAFGHSLLHGKGHDRWYDKSFNMVVFKNGRVGFNAEHSWADAPIMAHYWEYILLE----DILSPKFGYTPDGHCRGV---GKSNNISPQKLQWKLSKMIELEIEKCLLTTSKLIEDIDLHIVPFSEFGRGFMKTCKVSPDGFIQMALQLAYYRDSESFCLTYEACMTRLFREGRTETVRSCSNASCEFVRSMENKDLSNSDKINYLQLASNKHQKLYRDAMTGKGVDRHIFCMYVISKYLNIESEFLQK----ALSVPWKLSTSQTPHTQLTKFDMRRYPNFLSAGGGFGPVTSDGYGVSYMMAGE 2366
            N+++ +W+E  YL     ++   +Y+     +  H    +     +A  +I   V+F+  +  E L   +I+G +P C   +  MF T R+P        ++      E+ ++ +  +G +YK+    G D+ L   ++ +Q  +++    Q +     IG LT+  R+QW        KD  +++SLE I K++FML L+    D +P     L+    +  HG G +R+YDKS   +V  NG  GF AEHS  D         Y+  +    D+         D   R V     +  + P +L + ++  I   IE   L   + I + DL +  ++++G+ F+K   +SPD FIQ  +QLA ++  +    TYEA  TR + +GRTET RS S AS EFV   +N D+  ++KI  L+ ++ +H    ++A  G GVDRH F +  + K  + +   L K      S  W +STSQ        FD          G G+  V  +G+G++YM+  E
Sbjct:  134 NWMAKFWDEQSYLQYNDPIVPYVSYFYSHMPLPNHLSKIDNDPLIKATAIISTVVKFIEAIKDESLPVEIIKG-MPFCMNSFSLMFNTSRLPGKPEDNQDTNIFYSVYENNFVTIAYKGKFYKLMTHDGNDKPLSENEIWRQLYSVVFQGSQSDPKLGGIGSLTSLPRDQWREVHLELMKDPISQDSLETIHKSSFMLCLD---LDQSP---VTLEEKSRNCWHGDGINRFYDKSLQFLVTGNGSSGFLAEHSKMDGTPTLFLNNYVCQQLNKLDV---------DDFMRKVITPSSTVAMKPMELPFIITPKIHKAIESAQLQFKETIGEHDLRVWHYNKYGKTFIKRHGMSPDAFIQQVIQLAVFKYLKRQLPTYEAASTRKYFKGRTETGRSVSTASLEFVSKWQNGDVPIAEKIQALKHSAKEHSTYLKNAANGNGVDRHFFGLKNMLKSNDDQIPPLFKDPLFNYSSTWLISTSQLSSEY---FD----------GYGWSQVNDNGFGLAYMLNNE 625          
BLAST of Carnitine O-palmitoyltransferase 1, liver isoform vs. Ensembl Yeast
Match: YAT1 (Outer mitochondrial carnitine acetyltransferase; minor ethanol-inducible enzyme involved in transport of activated acyl groups from the cytoplasm into the mitochondrial matrix; phosphorylated [Source:SGD;Acc:S000000080])

HSP 1 Score: 188.734 bits (478), Expect = 8.174e-51
Identity = 180/654 (27.52%), Postives = 288/654 (44.04%), Query Frame = 3
Query:  708 TINKFLTSMEPLLSXXXXXXXXXXXXXXXXQHGFKIQFYLHLKY---LWSSNYVSDWWEEF---VYLSSRSSLMINSNYYGM--DALMLRH------------EWIQAARAANLICASVQFMRELNTEELEPLVIQGKVPLCSRQYERMFCTVRVPRNISRKNRSDQLVHYRESRYIVVICRGNYYKVNFMKGDQ---YLDPVDMEKQFQNILDTAVQPNDPSQYIGVLTAGERNQWAINRESFF-KDGC-NKESLEIIEKAAFMLVLEDEFQDYNPNDE-----------SKLDAFGH----SLLHGKGHDRWYDKSFNMVVFKNGRVGFNAEHSWADAPIMAHYWEYILLEDILSPKFGYTP---DGHCRGVGKS------------NNIS-PQKLQWKLSKMIELEIEKCLLTTSKLIEDIDLHIVPFSEFGRGFMKTC-KVSPDGFIQMALQLAYYRDSESFCLTYEACMTRLFREGRTETVRSCSNASCEFVRSMENKDLSNSDKINYLQLASNKHQKLYRDAMTGKGVDRHIFCMYVI-----SKYLNIESEFLQKALSVPWK--LSTSQTPHTQLTKFDMRRYPNFLSAGGGFGPVTSDGYGVSYMMAGEDIIFFHISSNISCQK-TDSKRFANNLCQALLDIKKLF 2474
            T+N++L  +EPL  E +    ++  L  +            L+Y   L  SN  S + E+F    YL   +++++N N Y    D   ++               +Q  RAA L  + ++F+R++    L    ++GK PL   QYER+F + R+P        S  L     S ++V + RG +Y  + +       +  P  +E    +I+  A      S   GV T   R  W+  R+  F  D C N  +L++I+ A F++ L+D     +  DE             LD   H    ++  G   +RWYDK   ++V KNG+ G N EH+  D   +      I  + ILS   G T    D      GK             N I+ P+KL+W+    ++  +       S LI   +   + FS +G   +KT  K SPD F+Q   Q+AY+     F   YE  MT+ F+ GRTE +RS +  S  FV+S+ ++D S++ KI  L  A   H ++ R+   G G DRH++ +Y +        L +   F  K+ +      LSTS   +  L  F             GFGPVT++G+G+ Y      II  H  S +   +   + RFA+ + ++LL+I ++F
Sbjct:   15 TLNRYLARVEPLQDERQNRRTRRTVLSAENLDALNTLHERLLEYDARLAESNPESSYIEQFWYDAYLLYDATVVLNVNPYFQLQDDPTIKDTPETAAQGPYGAHTVQVRRAARLTTSILKFIRQIRHGTLRTDTVRGKTPLSMDQYERLFGSSRIPPGPGEP--SCHLQTDATSHHVVAMYRGQFYWFDVLDTRNEPIFATPEQLEWNLYSIIMDAESAGSGSAPFGVFTTESRRVWSNIRDYLFHADDCTNWRNLKLIDSALFVVCLDDVAFAADQQDELTRSMLCGTSTINLDPHQHQPPLNVQTGTCLNRWYDK-LQLIVTKNGKAGINFEHTGVDGHTVLRLATDIYTDSILSFARGVTKNVVDIFSDDDGKPSSSSLASAAHSANLITIPRKLEWRTDNFLQSSLHFAETRISDLISQYEFVNLDFSNYGASHIKTVFKCSPDAFVQQVFQVAYFALYGRFETVYEPAMTKAFQNGRTEAIRSVTGQSKLFVKSLLDQDASDATKIQLLHDACTAHSQITRECSQGLGQDRHLYALYCLWNQWYKDKLELPPIFRDKSWTTMQNNVLSTSNCGNPCLKSF-------------GFGPVTANGFGIGY------IIRDHSVSVVVSSRHRQTARFASLMEKSLLEIDRIF 646          
BLAST of Carnitine O-palmitoyltransferase 1, liver isoform vs. Ensembl Yeast
Match: YAT2 (Carnitine acetyltransferase; has similarity to Yat1p, which is a carnitine acetyltransferase associated with the mitochondrial outer membrane [Source:SGD;Acc:S000000826])

HSP 1 Score: 78.9518 bits (193), Expect = 2.012e-15
Identity = 118/587 (20.10%), Postives = 210/587 (35.78%), Query Frame = 3
Query:  966 QAARAANLICASVQFMRELNTEELEPLV--IQGKVPLCSRQYERMFCTVRVP-----------------------------------------RNISRKNRSD-------QLVHYRESRYIVVICRGNYYKVNFMKGDQYL--DPVDMEKQFQNILDTAVQPNDPSQYIGVLTAGERNQWAINRESFFKDGCNKESLEIIEKAAFMLVLEDEFQDYNPND-------------------------ESKLDAFGHSLLHGKGH------DRWYDKSFNMVVFKNGRVGFNAEHSWADAPIMAHYWEYILLEDIL---------SPKFGYTP-----DGHCRGV---------GKSNNISPQ----KLQWKLSKMIELEIEKCLLTTSKLIEDIDLHIVPFSEFGRGFMKTCKVSPDGFIQMALQLAYYRDSESFCLTYEACMTRLFREGRTETVRSCSNASCEFVRSMENKDLSNSDKINYLQLASNKHQKLYRDAMTGKGVDRHIFCMYVISKYLN--------IESEFLQKALSVPWKLSTSQTPHTQLTKFDMRRYPNFLSAGGGFGPVTSDGYGVSYMMAGEDI 2372
            QA R+A L+ ++ +F+  L  + L P +    GK PL    +  +F T R P                                          +  RK+  D        +  + +S++I++I RG YY +  +     +     ++   F +I+  +    + S  +G LT+     W   R+   K   N+  L  I+ A F+LVL DE Q+   ND                           K   +G S+++ KGH       RWYDK   +VV  + +     +    D  ++  +   I  E +L          P+F   P     D   + +         G  + I P+    K+ W  S ++   +       + LI   D+ +      GR   +   V PD  +Q+ALQ+A+Y          E   TR F+  R+  +   S A  E  +   +  +  +DK++        H  + + A +G G ++H   +  + K+ +         ES   +     P  L  SQ       +  +    N  +   G  P    G+G+ Y++  + +
Sbjct:  134 QADRSAVLVHSAARFISALKQDLLPPDINATNGK-PLSMAPFLNLFGTTRSPVFQRGEVENFDLNKPYTASDLEDPDYSSDEDDNDEPTQKDFDDRKRKHEEDIFTGNGITIKRHPDSKHILIISRGQYYTLEVLDSTNKIIYTAAELTTIFNHIIKDS-SGIEKSTALGSLTSHSFRNWKYARKRLQKRYPNE--LHRIDSALFVLVL-DESQEETTNDGDDTADISQMFNRTITERDKKCTSANCKRVFYGTSIINSKGHQVGSCVSRWYDK-LQLVVTADAKATVIWDSFTCDGSVVLRFTSEIYTESVLRLARDVNAGDPQFSLWPNVTQMDPETKKLMTATISADGGGPSEIDPKLVVNKIDWSFSNILNTHVHLSETKLADLISKYDI-VRASIPLGRRSAQRLGVKPDSMVQVALQIAHYALYGRMVFGLEPVSTRGFKNSRSSFINIQSQALLELCQLFISSSIDGTDKLDKFIQTCETHNNMVKHAKSGVGYEKHFNALKYLFKFHDHFGIHLSGDESSAAKDLFENPLVLPFSQ------PELIVANCGNAATTTFGITPAVPHGFGIGYIIKDDQV 707          
BLAST of Carnitine O-palmitoyltransferase 1, liver isoform vs. Ensembl Nematostella
Match: EDO38455 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCT1])

HSP 1 Score: 493.426 bits (1269), Expect = 2.897e-162
Identity = 315/837 (37.63%), Postives = 470/837 (56.15%), Query Frame = 3
Query:  165 MAEAHQAVAFS-IKVSDDGIDWSLNFKAFKEIAKSGVKSWKKGLYRIQNRFYNGLYPSQPGNWLGIVCGVFASSMVGFDLSFGLIEKIEV---QLQRVLELESPRDH----LIASLMYSCGLWTAGVIVRKYTLSNLLYYMDWMYESQTGPSMKTKAWMVLVTILGGGNPKLYSYQGXXXXXXXXXXXXTINKFLTSMEPLLSXXXXXXXXXXXXXXXXQHGFKIQFYLHLKYLWSSNYVSDWWEEFVYLSSRSSLMINSNYYGMDALMLRHEWI----QAARAANLICASVQFMRELNTEELEPLVIQGKVPLCSRQYERMFCTVRVPRNISRKNRSDQLVHYR--ESRYIVVICRGNYYKVNFMKGD-QYLDPVDMEKQFQNILDTA----VQPNDPSQYIGVLTAGERNQWAINRESFFKDGCNKESLEIIEKAAFMLVLEDEFQDYNPNDESKLDAFGHSLLHGKGHDRWYDKSFNMVVFKNGRVGFNAEHSWADAPIMAHYWEYILLEDILSPKFGYTPDGHCRGVG---KSNNIS------PQKLQWKLSKMIELEIEKCLLTTSKLIEDIDLHIVPFSEFGRGFMKTCKVSPDGFIQMALQLAYYRDSE-SFCLTYEACMTRLFREGRTETVRSCSNASCEFVRSMENKDLSNSDKINYLQLASNKHQKLYRDAMTGKGVDRHIFCMYVISKYLNIESEFLQKALSVPWKLSTSQTPHTQLTK--FDMR---------------------------RYPNFLSAGGGFGPVTSDGYGVSYMMAGEDIIFFHISSNISCQKTDSKRFANNLCQALLDIKKLF-NPLDSSGD 2498
            MAEA  A+    +++  +G       +A  E+ KS  +S KK  +R + +  NGL+P+   N LG V  + A         + L++ I      L  +L L+    +    ++ SL+   G +   + +R+Y L  LL Y  WMY+     S+ T  W ++V I  G +P LYSYQ SLP++P+P L ST  +FL+S++PLL  EEY ++++L+ +F+K  G K+QF L LK  W++NY +DWWE++VYL  RS L INSNYY +D       W     Q +RAA +    +++ +EL TE+L PL+I+  +P C  QYER F TVR+P     K   D+LVH+   E  +IVVIC GN Y V       + +  +D+E QF+ I+  A    V+   P   I  LT   R +WA  R+ +F DG N++S+E IE+A F+++LED+         S+L      ++HG G   W+DKSF +VVF +G+ G NAEHSWADAP++ H  EY L  + +     Y   G C  +G   +S+N+       P +L W ++  +   +E  +    K  +D+   ++   +FG+GF+K  KVSPD FIQ+ALQ+AYY+DSE    LTYE+ MTRL+  GRTETVRS ++ +  FV++  +K+ S  +KI  ++ A+ KH  +Y+D M GKG DRH+F ++V+ +    +SEFL+ AL++PW LSTSQ P  Q+T   F +                            + P       G    + DGYGVSYM+  E+ IFFH+SS IS  KT+S+RF  NL  +L ++K+LF +P  SS +
Sbjct:    1 MAEARAAITRPDVRLHAEGTS---TKEAEVELLKSTFRSLKKCAFRTRRQIQNGLWPTTWSNLLGAVLVIAAIIHFNHHYEYALLQPIIHAIWSLSDILYLDERYPYNFRLIVVSLVTGLGFFIVLLYLRQYMLRMLLAYRGWMYQPPRSQSIVTLLWGLMVRICSGHHPTLYSYQNSLPRMPVPPLKSTCQRFLSSVKPLLDSEEYNKMEELSKDFEKNLGPKLQFILQLKSWWATNYCTDWWEKYVYLMGRSPLPINSNYYCLD-----QGWYPTREQPSRAAVITYFFLKYHQELETEQLRPLLIRNTIPTCMAQYERTFKTVRIP-----KEDVDELVHFEHTEQEHIVVICGGNMYMVPVQDSHGKAISCLDLEGQFEWIIADAKHSDVKREHPEGSIPALTGLPRTEWATIRKEYFGDGLNRQSMETIEEALFVVLLEDK-------TFSELSDRAKYIMHGDGRSLWFDKSFCLVVFTDGKCGINAEHSWADAPVIGHMLEYALTYEFVYRT--YNDKGRCNPIGGAHRSHNVRTHNLQRPCRLYWDVTPQLAQIVENAVTFCKKNNDDLQHKVITHDDFGKGFIKKIKVSPDAFIQLALQIAYYKDSEGKHPLTYESSMTRLYLHGRTETVRSLTSEAKAFVQAFMSKEASREEKIRLMRAAAEKHAIMYKDCMNGKGCDRHLFALFVVCRGQGYDSEFLKSALTLPWTLSTSQQPQQQMTAEHFSVNEPELMHMLEPEALQVFPFTCSLTLYETQLPQISPPVVGLALFSDDGYGVSYMVPDENRIFFHVSSKISSNKTNSERFVKNLYSSLAELKELFDDPSHSSSN 815          
BLAST of Carnitine O-palmitoyltransferase 1, liver isoform vs. Ensembl Nematostella
Match: EDO28730 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T5N0])

HSP 1 Score: 349.362 bits (895), Expect = 4.041e-110
Identity = 205/550 (37.27%), Postives = 313/550 (56.91%), Query Frame = 3
Query:  165 MAEAHQAVAFSIKVSDDGIDWSLNFKAFKEIAKSGVKSWKKGLYRIQNRFYNGLYPSQPGNWLGIVCGVFASSMVGFDLSFGLIE----KIEVQLQRVLELESPRDHLIASLMYSCGL------------WTAGVIVRKYTLSNLLYYMDWMYESQTGPSMKTKAWMVLVTILGGGNPKLYSYQGXXXXXXXXXXXXTINKFLTSMEPLLSXXXXXXXXXXXXXXXXQHGFKIQFYLHLKYLWSSNYVSDWWEEFVYLSSRSSLMINSNYYGMDALMLRHEWIQAARAANLICASVQFMRELNTEELEPLVIQGKVPLCSRQYERMFCTVRVPRNISRKNRSDQLVHYRESRYIVVICRGNYYKVNFMKGDQYLDPVDMEKQFQNILDTAVQPNDPSQYIGVLTAGERNQWAINRESFFKDGCNKESLEIIEKAAFMLVLEDEFQDYNPNDESKLDAFGHSLLHGKGHDRWYDKSFNMVVFKNGRVGFNAEHSWADAPIMAHYWEYILLEDILSPKFGYTPDGHCRGVGKSNNI-SPQKLQWKLSKMIEL 1763
            MAEA  AVA   +V+D+GI    +  AFK + ++  K+ K+ L   +       YP+ P +W+ +V  + A+     + + G++E    +I  +++R + +    D  IA  M    +            W     + ++TL  LL Y  ++YE +   S+ TK W  +V + GG  P LYSYQ S+P +P+P L STI K+L S+EP++  ++   +K LA EFK   G K+Q YL LK  WSSN+VSDWWE++VYLSSR+ L+INSNYYG+D++    + +Q+ARAAN+I A + + +++  E LEP    G VPLCS Q+ R F T R+P         D++ H+R S ++ +  RG +YK+        L P D+E Q + IL+   +P    + +  LT   R  WA  R  +F    NK SLE IE+AAF + L+++  DY       +D FG + L G GH+ W+DKSF + ++KNGRVG+NAEH+WADAPIM+H  E++  +D  +   GY  DGHC+G  +   +  P +L+W +   + +
Sbjct:    1 MAEARLAVALQFQVTDEGIVLHFDSSAFKFVFRAITKTVKRKLKEFKTAILKRSYPATPVSWMVLVAALSAARYSEHETTLGVLENLGRRIPGRMKRCV-IVFAVDSRIAQRMSPSTVIAVVVLAVATVLWLLMGHILQFTLRQLLKYRRFLYEPRGKISLTTKCWWTMVRLFGGRTPLLYSYQNSIPYMPVPNLDSTIAKYLESVEPVMDRDQLSRMKTLAAEFKATIGEKLQRYLVLKSWWSSNWVSDWWEQYVYLSSRAPLLINSNYYGVDSINHPTK-LQSARAANMIFALIYYRKQIMKERLEPQFAMGIVPLCSEQFRRTFNTTRIP-----GKEQDKIEHHRSSSHVAIYHRGRFYKLELYFRGTLLKPADLECQIEKILEDKSEPVQGEELLPALTTANRTTWADTRSKYFGQSVNKASLEAIERAAFFMCLDEKEMDYQGESSENIDIFGKAALTGNGHNVWFDKSFCITIYKNGRVGYNAEHTWADAPIMSHLGEWVTSDD--AKYLGYREDGHCKGELQFEVLPQPTRLEWDIPAPVSI 541          
BLAST of Carnitine O-palmitoyltransferase 1, liver isoform vs. Ensembl Nematostella
Match: EDO40580 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6T0])

HSP 1 Score: 219.935 bits (559), Expect = 2.736e-61
Identity = 166/608 (27.30%), Postives = 287/608 (47.20%), Query Frame = 3
Query:  708 TINKFLTSMEPLLSXXXXXXXXXXXXXXXXQHGFKIQFYLHLKYLWS--SNYVSDWWEEFVYLSSRSSLMINSNYYGMDALMLRHEW-IQAARAANLICASVQFMRELNTEELEPLV-------------------IQGKV-----------PLCSRQYERMFCTVRVPRNISRKNRSDQLVHYRESRYIVVICRGNYYKVNFMKGDQYLDPVDMEKQFQNILDTAVQPNDPSQY-IGVLTAGERNQWAINRESFFKDGCNKESLEIIEKAAFMLVLEDEFQDYNPNDESKLDAFGHSLLHGKGHDRWYDKSFNMVVFKNGRVGFNAEHSWADAPIMAHYWEYILLEDILSPKFGYTPDGHCRGVGKSNNISPQKLQWKLSKMIELEIEKCLLTTSKLIEDIDLHIVPFSEFGRGFMKTCKVSPDGFIQMALQLAYYRDSESFCLTYEACMTRLFREGRTETVRSCSNASCEFVRSMENKDLSNSDK-INYLQLASNKHQKLYRDAMTGKGVDRHIFCMYVISKYLN-----IESEFLQKALSVPWKLSTSQTPHTQLTKFDMRRYPNFLSAGGGFGPVTSDGYGVSYMMAGEDIIFFHISSNISCQK 2411
            T  ++L S +PLL+ E+Y   K +  +F+KQ G  +   L  K   +  ++Y+++ W + +YL  R+S+++N N +       + E   Q  RA N+I ++++F   L+   LEP +                   + G +           PL   QY R+FC+ R+P         D+L  +  +R+++++ +G ++  + +  D  +  V     ++N+      P    ++ IG+LT  ER  WA  R++      N+E++ +I+ A F + L+DE     P+D   L      +LHG G +RW+DKSF +V+ K G    N EH+W D   +  ++  +  +    P    T D   RG+   + +  +KL   L+  IE  +       +K+  D+D+  +  ++FG+  +K+ KVSPD F+Q+A Q+A YR    F  TYE+C T  FR GRTET+R  SN +     +      +  D+ ++ ++ A+  H KL ++A  G+G DRH+F +  I+          E E   +   +    ST  +P   L               GGFGPV  +G GV Y +  +      +  N++C K
Sbjct:   72 TCRRYLDSQKPLLTPEQYQYTKNITEKFQKQEGPALHADLIKKDKMNKHTSYIAELWYD-MYLKERNSIVLNHNPFMCFIDDPKPEQNDQLIRATNIIYSAMRFKNALDDLTLEPDIFHLNPKKSDTDWFKNIIRFVPGSLSWYGAFLVKAFPLDMSQYGRLFCSTRIPHP-----GKDKLATHEGARHMLIMHKGKFFVFDTLTTDGNI--VSTSTIYENLKQILNDPEQSPEFPIGLLTTDERETWARLRQAITAIPANQEAMRLIDSAIFTICLDDEV----PSDPMHL---ARIMLHGDGGNRWFDKSFQLVICKQGTSAVNFEHAWGDGVAVLRFFNEVFKDTTTRPAL--TADA-ARGMTGESTL--RKLHITLTPEIERGVAAAQKRFNKVTGDLDMDTLEITDFGKNHLKSKKVSPDAFMQLAFQMAIYRQLGHFVPTYESCSTAAFRHGRTETIRPASNPTVACSEAFNTAHRAGVDEMMDRIRKATAWHAKLTKEAAMGQGFDRHLFALRTIATAAGQKPDIFEDEAYSRINRIYLSTSTLSSPAILL---------------GGFGPVIPEGLGVGYAIFDD-----RLGCNVTCYK 639          
BLAST of Carnitine O-palmitoyltransferase 1, liver isoform vs. Ensembl Nematostella
Match: EDO44258 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RW66])

HSP 1 Score: 218.394 bits (555), Expect = 2.912e-61
Identity = 171/608 (28.12%), Postives = 301/608 (49.51%), Query Frame = 3
Query:  708 TINKFLTSMEPLLSXXXXXXXXXXXXXXXXQHGF--KIQFYLHLKYLWSSNYVSDWWEEFVYLSSRSSLMIN-SNYYGMDALMLRHEWIQAARAANLICASVQFMRELNTEELEPLVIQGKVPLCSRQYERMFCTVRVPRNISRKNRSDQLVHYRESRYIVVICRGNYYKVNFMKGD-QYLDPVDMEKQFQNILDTAVQPNDPSQYIGVLTAGERNQWAINRESFFKDGCNKESLEIIEKAAFMLVLEDEFQD--YNPN-DESKLDAF-GHSLLHGKG-----HDRWYDKSFNMVVFKNGRVGFNAEHSWADAPIMAHYWEYILLEDILSPKFGYTPDGHCRGVGKSNNISPQKLQWKLSKMIELEIEKCLLTTSKLIEDIDLHIVPFSEFGRGFMKTCKVSPDGFIQMALQLAYYRDSESFCLTYEACMTRLFREGRTETVRSCSNASCEFVRSMENKDLSNSDKINYLQLASNKHQKLYRDAMTGKGVDRHIFCMYVISKYLNIESEFLQKALSVPW-------KLSTSQTPHTQLTKFDMRRYPNFLSAGGGFGPVTSDGYGVSYMMAGEDIIFFHISSNISCQKTDSKRFANNLCQALLDIKKL 2471
            T++K+L ++ PL+ +++Y   K L  EF+K  G   ++Q  L  +   + NYV++WW    +LS+R S++IN S  +        ++  Q   +A L+  +  F   ++ +EL  +   G  P+   QY+   C  R+PR    K     +    E++++VV+    +Y ++    D + L+  ++  Q   I+ ++     P   +GVLT+  R+ WA  RE   +D  NKE+L +++    +L L+         P+ DES +D+      LHG G      +RW++K     V +NG +G   EHS A+AP +   W+Y+L          +  D     +  SN  +P+K++W L       IEK      + I  +++ +  F  +G+ F+K+ K+SPD + Q++LQLA+YR        YE    R F+ GR++++RS S  + EFV++M     S +++ N ++ A + H KL ++AM G+G+DRH+F +   S+   ++   L    + P        KLSTSQ P                     FGP+ +DGYG+ Y     D + + ++++ +   TD+  FA  L ++L D++ L
Sbjct:   18 TMDKYLAAVRPLVDDKDYERTKSLVDEFRKSGGVGERLQAILKERERTTENYVTEWWSNN-FLSARDSVVINLSPGFTFPKEDFSNKLDQIRFSARLLHNTANFRDMIDNDELS-IDRVGDSPMSMYQYKLFLCGSRIPRP---KIDVYFVAPKGEAKHVVVVHNNQFYSLDVYGTDGKPLNEPEIAAQLLKIVQSSDAEEPP---VGVLTSENRSVWAKEREVLSQDPQNKENLYLLDSCIVVLCLDKPCPPPTQRPSVDESPIDSVTARQTLHGDGIQYNSLNRWFEKPNQFTVSENGHIGVCYEHSPAEAPTIGRLWDYVL---------AHKNDYKSIEIAASNLPAPKKIKWNLKASSLEAIEKAKQRLQRDINAVEVKLFEFQGYGKDFIKSQKLSPDAWFQISLQLAFYRLHGHVAAPYETATVRKFKLGRSDSIRSASIPTLEFVKAMSKSYTSQAERHNLMREAISYHSKLTKEAMNGQGIDRHLFALKCASQEAGMD---LPAVFADPTHKYFFDCKLSTSQVPMP-------------YRCWTLFGPMVTDGYGICYNQL-PDRVLYCLTTDDTNPITDAGHFAAVLKKSLNDMQLL 591          
BLAST of Carnitine O-palmitoyltransferase 1, liver isoform vs. Ensembl Nematostella
Match: EDO44211 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RW64])

HSP 1 Score: 193.356 bits (490), Expect = 2.594e-52
Identity = 165/613 (26.92%), Postives = 296/613 (48.29%), Query Frame = 3
Query:  708 TINKFLTSMEPLLSXXXXXXXXXXXXXXXXQHGFK--IQFYLHLKYLWSSNYVSDWWEEFVYLSSRSSLMINSN---YYGMDALMLRHEWIQAARAANLICASVQFMRELNTEELEPLVIQGKVPLCSRQYERMFCTVRVPRNISRKNRSDQLVHYR-ESRYIVVICRGNYYKVNFMKGD-QYLDPVDMEKQFQNILDTAVQPNDPSQYIGVLTAGERNQWAINRESFFKDGCNKESLEIIEKAAFMLVLEDEFQDYN--------PNDE----SKLDAFGHSLLHGKGHDRWYDKSFNMVVFKNGRVGFNAEHSWADAPIMAHYWEYILLE--DILSPKFGYTPDGHCRGVGKSNNISPQKLQWKLSKMIELEIEKCLLTTSKLIEDIDLHIVPFSEFGRGFMKTCKVSPDGFIQMALQLAYYRDSESFCLTYEACMTRLFREGRTETVRSCSNASCEFVRSMENKDLSNSDKINYLQLASNKHQKLYRDAMTGKGVDRHIFCMYV--ISKYLNIESEFLQKALS--VPWKLSTSQTPHTQLTKFDMRRYPNFLSAGGGFGPVTSDGYGVSYMMAGEDIIFFHISSNISCQKTDSKRFANNLCQALLDIKKL 2471
            T++K+L ++ PL++++++   + L  EF+K+ G    +Q  L  +   + N+++ WWE   YL  R  ++INSN    +  +    R ++I+ +    L+ A ++F + ++ ++L  +   G  PL   QY+  FC  RVP+     NR    V  + ++++IVV  R  +Y V+   G  Q L   ++  Q   I+    +P +P   +GV T+  R+ WA  R +  KD  N+ + ++IE +  +L L+               P+D       L A+G  + +    +RW+DK     V ++G  G   EH+ AD   +    + I+ E  D  S K             +S+  +PQK++W L       +E         ++D D  +  +  +G+ F+K+ K+SPD + Q++LQLA+YR        +EA  TR F+ GRTET+RS S A+ EFVR+M  K  S +++   ++ A N H    ++A+ GK VDRH+  + +  +   + + + F+  +      +KLST Q P    +   +R             P   DGYG+ Y     + + + +S+  S   T+   FA  + ++L +++ L
Sbjct:   40 TMDKYLNAIRPLINDDDFENTQVLVNEFRKKGGIGEILQGKLLERAKKTDNWMAGWWENVKYLDVRVPVVINSNPSWSFPKENFSDRFDFIRYS--TRLVRAVLKFRQMVDNDQLS-IDKMGNKPLNMYQYKLFFCGCRVPQ----LNRDKYYVAAKGQAKHIVVAHRNQFYSVDVYDGKGQPLGEPEIAAQLLKIVQN-TEPEEPP--VGVFTSENRDVWAKERYAMAKDRNNRANFKMIESSICVLCLDKPCPPSTQVPSITECPSDSVTGCQTLHAYGDGIEYN-SLNRWFDKPKQFTVSEDGNSGGCFEHTCADGSTVQRVSDPIMKERKDYKSIKVK----------DRSDLAAPQKMKWNLKPSTLQNMETAKDRLDSYVKDTDARLFAYQGYGKNFIKSLKLSPDAWFQISLQLAFYRLHGHVAPAHEAGSTRQFKLGRTETIRSASIATHEFVRAMTRKHASRAERYELMRRAINYHSTYTKEALDGKAVDRHLLGLKLTAVESGITLPAIFMDPSYHYFFHFKLSTRQVPLEHESWVVIR-------------PAVPDGYGICY-NPQPNKLMYSVSTFNSNPATNPGHFATAMQRSLDEMQLL 617          
BLAST of Carnitine O-palmitoyltransferase 1, liver isoform vs. Ensembl Medaka
Match: ENSORLT00000034659.1 (carnitine O-palmitoyltransferase 1, liver isoform [Source:NCBI gene;Acc:101155805])

HSP 1 Score: 726.472 bits (1874), Expect = 0.000e+0
Identity = 367/773 (47.48%), Postives = 513/773 (66.36%), Query Frame = 3
Query:  165 MAEAHQAVAFSIKVSDDGIDWSLNFKAFKEIAKSGVKSWKKGLYRIQNRFYNGLYPSQPGNWLGIVCGVFASSMVGFDLSFGLIEKIEVQLQRVLELESPRDHLIASLMYSCGLWTAGVIVRKYTLSNLLYYMDWMYESQTGPSMKTKAWMVLVTILGGGNPKLYSYQGXXXXXXXXXXXXTINKFLTSMEPLLSXXXXXXXXXXXXXXXXQHGFKIQFYLHLKYLWSSNYVSDWWEEFVYLSSRSSLMINSNYYGMDALMLRHEWIQAARAANLICASVQFMRELNTEELEPLVIQGKVPLCSRQYERMFCTVRVPRNISRKNRSDQLVHYRESRYIVVICRGNYYKVNFMKGDQYLDPVDMEKQFQNILDTAVQPNDPSQYIGVLTAGERNQWAINRESFFKDGCNKESLEIIEKAAFMLVLEDEFQDYNPNDE-SKLDAFGHSLLHGKGHDRWYDKSFNMVVFKNGRVGFNAEHSWADAPIMAHYWEYILLEDILSPKFGYTPDGHCRGVGKSNNISPQKLQWKLSKMIELEIEKCLLTTSKLIEDIDLHIVPFSEFGRGFMKTCKVSPDGFIQMALQLAYYRDSESFCLTYEACMTRLFREGRTETVRSCSNASCEFVRSMENKDLSNSDKINYLQLASNKHQKLYRDAMTGKGVDRHIFCMYVISKYLNIESEFLQKALSVPWKLSTSQTPHTQLTKFDMRRYPNFLSAGGGFGPVTSDGYGVSYMMAGEDIIFFHISSNISCQKTDSKRFANNLCQALLDIKKLFNP 2480
            MAEAHQAVAF   V+ +GID  L+ +A  EI  SGV+SWKK + RI+N    G+YP+ P +WL +V  + A+     D S G+I KI+  L     + S    +++++++S  LW   +   +  L  LL Y  WM+E     S  TK W+ LV I  G  P LYSYQGSLP LP+P +  T+ ++L S+ PL+++ EY  + KLA EF+   G ++Q+YL LK LW+SNYVSDWWEE+VYL  RS +M+NSNYYGMD L +    IQAARA N I A   + R+LN EE++PL+++  VP CS Q+ERMF + R+P +++     D + H+++S Y+ V  +G Y+++   +  + L P ++E Q Q ILD    P+     +G LTA +R  WA  R  +F  G NK SL++IE+AAF + L+DE Q    +D+ + LD +  SLLHGK +DRW+DKSF+++ +KNG+ G N EHSWADAP++AH WEY+L  D  S + GY  +GHC+G   ++   PQKL W++S   E +I + L     L +D+D H++ F +FG+G +K CKVSPD FIQM LQLAYYR+  +FCLTYEA MTRLFREGRTETVRSC+N S  FVR++EN + ++  +    + AS KHQ+LYR AMTG G+DRHIFC+YV+SKYL +ES FL++ L+ PW+LSTSQT   Q+  FD+  +P ++S GGGFGPV  DGYGVSY   GE++I FHIS   SC  TD+ +F + + +A+ D+ +L +P
Sbjct:    1 MAEAHQAVAFQFTVTPEGIDLRLSHQALSEIYLSGVRSWKKRIIRIKNSVITGVYPASPSSWLFVVIAILATMYTRSDPSMGIIAKIQEHLPVSQSMSSQCQAVVSAVLFSTMLWLLLIFTMRLCLKQLLSYHRWMFEQHGKMSTTTKIWVALVRIFSGRKPLLYSYQGSLPNLPVPAIKDTVKRYLESVRPLMNDGEYERMTKLATEFESSLGNRLQWYLKLKALWASNYVSDWWEEYVYLRGRSPIMVNSNYYGMDFLYVTPTPIQAARAGNSIHAFFLYRRKLNKEEIKPLLLRSTVPCCSYQFERMFDSCRIPGSLT-----DTVQHWKDSDYVAVYHKGRYFRLRVYQAGRLLSPREIEFQIQRILDDPAPPSKGEAKLGALTAADRVSWAEARVKYFSSGINKRSLDVIERAAFFVTLDDEEQGTMRDDQPASLDNYAKSLLHGKCYDRWFDKSFSVIYYKNGKSGINGEHSWADAPVVAHVWEYVLATD--SFQLGYNEEGHCKGEVDASLPQPQKLNWEISPECEEQISRSLAVAQALADDVDFHVLSFRDFGKGQIKKCKVSPDAFIQMTLQLAYYRERGTFCLTYEASMTRLFREGRTETVRSCTNESSAFVRALENGEPADVCR-RLFRGASEKHQQLYRMAMTGAGIDRHIFCLYVVSKYLGLESPFLKEVLAEPWRLSTSQTSIQQVELFDLANHPEYISCGGGFGPVADDGYGVSYNFIGENVINFHISCKHSCPSTDAHKFGDQIRKAVNDLLQLLSP 765          
BLAST of Carnitine O-palmitoyltransferase 1, liver isoform vs. Ensembl Medaka
Match: ENSORLT00000039265.1 (carnitine O-palmitoyltransferase 1, liver isoform [Source:NCBI gene;Acc:101155805])

HSP 1 Score: 719.924 bits (1857), Expect = 0.000e+0
Identity = 368/774 (47.55%), Postives = 509/774 (65.76%), Query Frame = 3
Query:  165 MAEAHQAVAFSIKVSDDGIDWSLNFKAFKEIAKSGVKSWKKGLYRIQNRFYNGLYPSQPGNWLGIVCGVFASSMVGFDLSFGLIEKIEVQLQRVLELESPRDHLIASLMYSCGLWTAGVIVRKYTLSNLLYYMDWMYESQTGPSMKTKAWMVLVTILGGGNPKLYSYQGXXXXXXXXXXXXTINKFLTSMEPLLSXXXXXXXXXXXXXXXXQHGFKIQFYLHLKYLWSSNYVSDWWEEFVYLSSRSSLMINSNYYGMDALMLRHEWIQAARAANLICASVQFMRELNTEELEPLVIQGKV-PLCSRQYERMFCTVRVPRNISRKNRSDQLVHYRESRYIVVICRGNYYKVNFMKGDQYLDPVDMEKQFQNILDTAVQPNDPSQYIGVLTAGERNQWAINRESFFKDGCNKESLEIIEKAAFMLVLEDEFQDYNPNDE-SKLDAFGHSLLHGKGHDRWYDKSFNMVVFKNGRVGFNAEHSWADAPIMAHYWEYILLEDILSPKFGYTPDGHCRGVGKSNNISPQKLQWKLSKMIELEIEKCLLTTSKLIEDIDLHIVPFSEFGRGFMKTCKVSPDGFIQMALQLAYYRDSESFCLTYEACMTRLFREGRTETVRSCSNASCEFVRSMENKDLSNSDKINYLQLASNKHQKLYRDAMTGKGVDRHIFCMYVISKYLNIESEFLQKALSVPWKLSTSQTPHTQLTKFDMRRYPNFLSAGGGFGPVTSDGYGVSYMMAGEDIIFFHISSNISCQKTDSKRFANNLCQALLDIKKLFNP 2480
            MAEAHQAVAF   V+ +GID  L+ +A  EI  SGV+SWKK + RI+N    G+YP+ P +WL +V  + A+     D S G+I KI+  L     + S    +++++++S  LW   +   +  L  LL Y  WM+E     S  TK W+ LV I  G  P LYSYQGSLP LP+P +  T+ ++L S+ PL+++ EY  + KLA EF+   G ++Q+YL LK LW+SNYVSDWWEE+VYL  RS +M+NSNYYGMD L +    IQAARA N I A   + R+LN EE++P  I G V PLC+ Q ER+F T R+P        +D + H+++S Y+ V  +G Y+++   +  + L P ++E Q Q ILD    P+     +G LTA +R  WA  R  +F  G NK SL++IE+AAF + L+DE Q    +D+ + LD +  SLLHGK +DRW+DKSF+++ +KNG+ G N EHSWADAP++AH WEY+L  D  S + GY  +GHC+G   ++   PQKL W++S   E +I + L     L +D+D H++ F +FG+G +K CKVSPD FIQM LQLAYYR+  +FCLTYEA MTRLFREGRTETVRSC+N S  FVR++EN + ++  +    + AS KHQ+LYR AMTG G+DRHIFC+YV+SKYL +ES FL++ L+ PW+LSTSQT   Q+  FD+  +P ++S GGGFGPV  DGYGVSY   GE++I FHIS   SC  TD+ +F + + +A+ D+ +L +P
Sbjct:    1 MAEAHQAVAFQFTVTPEGIDLRLSHQALSEIYLSGVRSWKKRIIRIKNSVITGVYPASPSSWLFVVIAILATMYTRSDPSMGIIAKIQEHLPVSQSMSSQCQAVVSAVLFSTMLWLLLIFTMRLCLKQLLSYHRWMFEQHGKMSTTTKIWVALVRIFSGRKPLLYSYQGSLPNLPVPAIKDTVKRYLESVRPLMNDGEYERMTKLATEFESSLGNRLQWYLKLKALWASNYVSDWWEEYVYLRGRSPIMVNSNYYGMDFLYVTPTPIQAARAGNSIHAFFLYRRKLNKEEIKPSRIPGTVIPLCAAQCERIFNTTRIP-----GEETDTVQHWKDSDYVAVYHKGRYFRLRVYQAGRLLSPREIEFQIQRILDDPAPPSKGEAKLGALTAADRVSWAEARVKYFSSGINKRSLDVIERAAFFVTLDDEEQGTMRDDQPASLDNYAKSLLHGKCYDRWFDKSFSVIYYKNGKSGINGEHSWADAPVVAHVWEYVLATD--SFQLGYNEEGHCKGEVDASLPQPQKLNWEISPECEEQISRSLAVAQALADDVDFHVLSFRDFGKGQIKKCKVSPDAFIQMTLQLAYYRERGTFCLTYEASMTRLFREGRTETVRSCTNESSAFVRALENGEPADVCR-RLFRGASEKHQQLYRMAMTGAGIDRHIFCLYVVSKYLGLESPFLKEVLAEPWRLSTSQTSIQQVELFDLANHPEYISCGGGFGPVADDGYGVSYNFIGENVINFHISCKHSCPSTDAHKFGDQIRKAVNDLLQLLSP 766          
BLAST of Carnitine O-palmitoyltransferase 1, liver isoform vs. Ensembl Medaka
Match: cpt1cb (carnitine O-palmitoyltransferase 1, liver isoform [Source:NCBI gene;Acc:101172168])

HSP 1 Score: 715.301 bits (1845), Expect = 0.000e+0
Identity = 372/783 (47.51%), Postives = 515/783 (65.77%), Query Frame = 3
Query:  165 MAEAHQAVAFSIKVSDDGIDWSLNFKAFKEIAKSGVKSWKKGLYRIQNRFYNGLYPSQPGNWLGIVCGVFASSMVGFDLSFGLIEKIEVQLQRVLE--LESPRDHLIASLMYSCGLWTAGVIVRKYTLSNLLYYMDWMYESQTGPSMKTKAWMVLVTILGGGNPKLYSYQGXXXXXXXXXXXXTINKFLTSMEPLLSXXXXXXXXXXXXXXXXQHGFKIQFYLHLKYLWSSNYVSDWWEEFVYLSSRSSLMINSNYYGMDALMLRHEWIQAARAANLICASVQFMRELNTEELEPLVIQGKV-PLCSRQYERMFCTVRVPRNISRKNRSDQLVHYRESRYIVVICRGNYYKVNFMKGDQYLDPVDMEKQFQNILDTAVQPNDPSQYIGVLTAGERNQWAINRESFFKDGCNKESLEIIEKAAFMLVLEDEFQDYNPNDES-KLDAFGHSLLHGKGHDRWYDKSFNMVVFKNGRVGFNAEHSWADAPIMAHYWEYILLEDILSPKFGYTPDGHCRGVGKSNNISPQKLQWKLSKMIELEIEKCLLTTSKLIEDIDLHIVPFSEFGRGFMKTCKVSPDGFIQMALQLAYYRDSESFCLTYEACMTRLFREGRTETVRSCSNASCEFVRSMENKDLSNSDKINYLQLASNKHQKLYRDAMTGKGVDRHIFCMYVISKYLNIESEFLQKALSVPWKLSTSQTPHTQLTKFDMRRYPNFLSAGGGFGPVTSDGYGVSYMMAGEDIIFFHISSNISCQKTDSKRFANNLCQALLDIKKLFNPLDSSGDK 2501
            MAEAHQAVAF   ++ +GID  L+++A  +I  SGV+SWKK + R++NR   G+YP+ P +WL +  G+ A+  +  D S GLI +I+ +L   L   L +    ++++L++S  LW + ++  ++ L  LL Y  WM+E     S  TK W+ L+ +L G  P LYSYQ SLP LP+P +  T+ ++L S+ PLL++ EY  +  LA EF+   G ++Q YL LK LW++NYVSDWWEE++YL  R  +M+NSNYYGMD L +    +QAARA N I A + + R +N EEL P  + G V PLC+ Q ERMF T R P        +D L H+++S ++ V  RG YY++   +  + L   ++E Q Q ILD    P    + +G LTAG+R  WA  R+  F  G NK SL+IIEKAAF + L+DE Q    +D +  LD +  SLLHGK +DRW+DKSF++V++KNG+ G NAEHSWADAP +AH WEY L  D    + GYT DGHC+G    +   P +L W++   ++ +I   L     L +D+D H+ PF +FG+G +K  +VSPD FIQ++LQLAY+RD  SFCLTYEA MTRLFREGRTETVRSCSN SC FV+++E  + ++  K  + Q AS KHQ LYR AMTG G+DRH+FC+YV+SKYL ++S FL++ LS PW+LSTSQTP  Q+  FD++ +P+F+S GGGFGPV  DGYGVSY++ GED+I FH+SS  SC +TDS RF   + +AL DI  + +   +S  K
Sbjct:    1 MAEAHQAVAFQFTITPEGIDLQLSYQALNQIYLSGVRSWKKRVSRMRNRVIKGVYPASPSSWLFVAIGILATIYMQSDPSMGLIAEIQQRLPLSLHVSLSAQGQTMVSALVFSTLLWLSLILALRFCLKLLLSYHQWMFEQHGRVSNTTKVWVTLLRLLSGRKPLLYSYQTSLPHLPVPAVRDTLTRYLESVRPLLTDPEYKRMTDLANEFESSLGNRLQRYLKLKALWATNYVSDWWEEYIYLRGRGPIMVNSNYYGMDFLYVTPTSVQAARAGNTITALLLYRRMVNREELTPSRVPGTVIPLCAAQCERMFNTTRTP-----GVETDVLQHWQDSEFVAVYSRGRYYRLWVYRAGRLLSAREIEHQIQWILDDPSPPLPGEEKLGALTAGDRVPWAQIRKEHFSSGVNKRSLDIIEKAAFFVTLDDEAQGMKGDDPTGNLDRYAKSLLHGKCYDRWFDKSFSIVIYKNGKSGLNAEHSWADAPTVAHLWEYTLATDAF--QLGYTEDGHCKGEVDRSLPPPHRLSWEIPSEVQDQIFSSLTLAKALADDVDCHVFPFRDFGKGKIKKLRVSPDAFIQISLQLAYFRDRGSFCLTYEASMTRLFREGRTETVRSCSNQSCAFVKALEGGEGADQCKRLFRQ-ASEKHQNLYRMAMTGAGIDRHLFCLYVVSKYLGVDSPFLKEVLSEPWRLSTSQTPVQQMELFDLKNHPDFVSLGGGFGPVADDGYGVSYIIVGEDMINFHVSSKHSCGETDSHRFGAQIAKALQDIMAVLSADTASSSK 775          
BLAST of Carnitine O-palmitoyltransferase 1, liver isoform vs. Ensembl Medaka
Match: cpt1b (carnitine O-palmitoyltransferase 1, liver isoform [Source:NCBI gene;Acc:101160160])

HSP 1 Score: 694.115 bits (1790), Expect = 0.000e+0
Identity = 349/776 (44.97%), Postives = 498/776 (64.18%), Query Frame = 3
Query:  150 TFNG*MAEAHQAVAFSIKVSDDGIDWSLNFKAFKEIAKSGVKSWKKGLYRIQNRFYNGLYPSQPGNWLGIVCGVFASSMVGFDLSFGLIEKIEVQLQRVLELESPRDHLIASLMYSCGLWTAGVIVRKYTLSNLLYYMDWMYESQTGPSMKTKAWMVLVTILGGGNPKLYSYQGXXXXXXXXXXXXTINKFLTSMEPLLSXXXXXXXXXXXXXXXXQHGFKIQFYLHLKYLWSSNYVSDWWEEFVYLSSRSSLMINSNYYGMDALMLRHEWIQAARAANLICASVQFMRELNTEELEPLVIQGKVPLCSRQYERMFCTVRVPRNISRKNRSDQLVHYRESRYIVVICRGNYYKVNFMKGDQYLDPVDMEKQFQNILDTAVQPNDPSQYIGVLTAGERNQWAINRESFFKDGCNKESLEIIEKAAFMLVLEDEFQDYNPNDESKLDAFGHSLLHGKGHDRWYDKSFNMVVFKNGRVGFNAEHSWADAPIMAHYWEYILLEDILSPKFGYTPDGHCRGVGKSNNISPQKLQWKLSKMIELEIEKCLLTTSKLIEDIDLHIVPFSEFGRGFMKTCKVSPDGFIQMALQLAYYRDSESFCLTYEACMTRLFREGRTETVRSCSNASCEFVRSMENKDLSNSDKINYLQLASNKHQKLYRDAMTGKGVDRHIFCMYVISKYLNIESEFLQKALSVPWKLSTSQTPHTQLTKFDMRRYPNFLSAGGGFGPVTSDGYGVSYMMAGEDIIFFHISSNISCQKTDSKRFANNLCQALLDIKKLFN 2477
            TF   MAEAHQAV F   V  DG++  L+ +  K I  SG+  WKK   + +N    G+YP+ P +WL +V  + +S     DLS G+I+ I+  L     + +    +++++++  GLW   + + +YTL  LL Y  W++ES    S  TK W+ LV +  G  P LYS+Q SLP+LP+PR+  TI ++L S+ PLL +E+Y +++ LA +FK+    ++Q YL LK  W++NYVSDWWEEF+YL  R  +M+NSN+Y MD L +     QAARA N++ A +Q+ R+L   E  PL   G VP+CS Q ERMF T R+P        +D + H  + ++++V  +G +++V    G ++L P ++E QFQ IL+   +P      +  LTAG R  WA  R   F  G NK SL+ IE AAF L L+DE Q Y+   ++ LD++  SLLHGK +DRW+DKSF ++ + NG++G N EHSWADAPI+ H WEY+L  D       Y+ +GHC+G        P +LQW++SK  +  IE   L+  K+ +D+D H   F+EFG+G +K C+ SPD FIQ+ALQLA +RD   FCLTYE+ MTR+FR+GRTETVRSC++ +  FVR+ME+   +N+ +++  Q A+ KHQ +YR AMTG G+DRH+FC+Y++SKYL  +S FL K LS PW+LSTSQTP  QL   D+ ++P ++ AGGGFGPV  DGYGVSY++ GE++I FHISS  S   TDS RF  N+ +A++DI+ LF 
Sbjct:    6 TFTTEMAEAHQAVGFQFTVRPDGVELKLSQEVIKNIYLSGLTVWKKKAIQFKNSVLTGVYPASPSSWLIVVIAMMSSLYTNTDLSLGMIDAIKENLPHRGYMSAQTRAVLSAILFGTGLWLFLIYLLRYTLKALLSYHGWIFESHGKMSSSTKLWLYLVKMFSGRRPLLYSFQASLPRLPVPRVDDTIRRYLESVRPLLDKEQYSQMETLANDFKESKASQLQRYLILKSWWATNYVSDWWEEFIYLRGRGPIMVNSNFYIMDLLYITPTHRQAARAGNIVHAMLQYRRKLERGEHAPLRALGTVPMCSTQMERMFNTTRIP-----GIETDVVQHLSDRKHLIVYHKGRFFQVWLYTGGRHLLPSELEMQFQRILNDTTEPQPGELKLAALTAGNRVPWAQARIKHFSHGVNKTSLDAIESAAFFLTLDDESQGYDGVKKNSLDSYAKSLLHGKCYDRWFDKSFTLISYPNGKMGVNVEHSWADAPIVGHMWEYVLATDCF--HLCYSEEGHCKGDANRGLPFPTRLQWQISKECQDVIEASYLSAKKIADDVDFHGHLFTEFGKGLIKKCRTSPDAFIQLALQLAQFRDQGVFCLTYESSMTRMFRDGRTETVRSCTSEAVAFVRAMEDVSATNAQRLSLFQKAAEKHQNMYRLAMTGSGIDRHLFCLYIVSKYLGADSPFLNKVLSEPWRLSTSQTPQQQLNLVDINKFPKYVGAGGGFGPVADDGYGVSYIIVGENLITFHISSKFSSPNTDSYRFGQNIQRAMIDIQTLFT 774          
BLAST of Carnitine O-palmitoyltransferase 1, liver isoform vs. Ensembl Medaka
Match: cpt1b (carnitine O-palmitoyltransferase 1, liver isoform [Source:NCBI gene;Acc:101160160])

HSP 1 Score: 691.419 bits (1783), Expect = 0.000e+0
Identity = 347/771 (45.01%), Postives = 496/771 (64.33%), Query Frame = 3
Query:  165 MAEAHQAVAFSIKVSDDGIDWSLNFKAFKEIAKSGVKSWKKGLYRIQNRFYNGLYPSQPGNWLGIVCGVFASSMVGFDLSFGLIEKIEVQLQRVLELESPRDHLIASLMYSCGLWTAGVIVRKYTLSNLLYYMDWMYESQTGPSMKTKAWMVLVTILGGGNPKLYSYQGXXXXXXXXXXXXTINKFLTSMEPLLSXXXXXXXXXXXXXXXXQHGFKIQFYLHLKYLWSSNYVSDWWEEFVYLSSRSSLMINSNYYGMDALMLRHEWIQAARAANLICASVQFMRELNTEELEPLVIQGKVPLCSRQYERMFCTVRVPRNISRKNRSDQLVHYRESRYIVVICRGNYYKVNFMKGDQYLDPVDMEKQFQNILDTAVQPNDPSQYIGVLTAGERNQWAINRESFFKDGCNKESLEIIEKAAFMLVLEDEFQDYNPNDESKLDAFGHSLLHGKGHDRWYDKSFNMVVFKNGRVGFNAEHSWADAPIMAHYWEYILLEDILSPKFGYTPDGHCRGVGKSNNISPQKLQWKLSKMIELEIEKCLLTTSKLIEDIDLHIVPFSEFGRGFMKTCKVSPDGFIQMALQLAYYRDSESFCLTYEACMTRLFREGRTETVRSCSNASCEFVRSMENKDLSNSDKINYLQLASNKHQKLYRDAMTGKGVDRHIFCMYVISKYLNIESEFLQKALSVPWKLSTSQTPHTQLTKFDMRRYPNFLSAGGGFGPVTSDGYGVSYMMAGEDIIFFHISSNISCQKTDSKRFANNLCQALLDIKKLFN 2477
            MAEAHQAV F   V  DG++  L+ +  K I  SG+  WKK   + +N    G+YP+ P +WL +V  + +S     DLS G+I+ I+  L     + +    +++++++  GLW   + + +YTL  LL Y  W++ES    S  TK W+ LV +  G  P LYS+Q SLP+LP+PR+  TI ++L S+ PLL +E+Y +++ LA +FK+    ++Q YL LK  W++NYVSDWWEEF+YL  R  +M+NSN+Y MD L +     QAARA N++ A +Q+ R+L   E  PL   G VP+CS Q ERMF T R+P        +D + H  + ++++V  +G +++V    G ++L P ++E QFQ IL+   +P      +  LTAG R  WA  R   F  G NK SL+ IE AAF L L+DE Q Y+   ++ LD++  SLLHGK +DRW+DKSF ++ + NG++G N EHSWADAPI+ H WEY+L  D       Y+ +GHC+G        P +LQW++SK  +  IE   L+  K+ +D+D H   F+EFG+G +K C+ SPD FIQ+ALQLA +RD   FCLTYE+ MTR+FR+GRTETVRSC++ +  FVR+ME+   +N+ +++  Q A+ KHQ +YR AMTG G+DRH+FC+Y++SKYL  +S FL K LS PW+LSTSQTP  QL   D+ ++P ++ AGGGFGPV  DGYGVSY++ GE++I FHISS  S   TDS RF  N+ +A++DI+ LF 
Sbjct:    1 MAEAHQAVGFQFTVRPDGVELKLSQEVIKNIYLSGLTVWKKKAIQFKNSVLTGVYPASPSSWLIVVIAMMSSLYTNTDLSLGMIDAIKENLPHRGYMSAQTRAVLSAILFGTGLWLFLIYLLRYTLKALLSYHGWIFESHGKMSSSTKLWLYLVKMFSGRRPLLYSFQASLPRLPVPRVDDTIRRYLESVRPLLDKEQYSQMETLANDFKESKASQLQRYLILKSWWATNYVSDWWEEFIYLRGRGPIMVNSNFYIMDLLYITPTHRQAARAGNIVHAMLQYRRKLERGEHAPLRALGTVPMCSTQMERMFNTTRIP-----GIETDVVQHLSDRKHLIVYHKGRFFQVWLYTGGRHLLPSELEMQFQRILNDTTEPQPGELKLAALTAGNRVPWAQARIKHFSHGVNKTSLDAIESAAFFLTLDDESQGYDGVKKNSLDSYAKSLLHGKCYDRWFDKSFTLISYPNGKMGVNVEHSWADAPIVGHMWEYVLATDCF--HLCYSEEGHCKGDANRGLPFPTRLQWQISKECQDVIEASYLSAKKIADDVDFHGHLFTEFGKGLIKKCRTSPDAFIQLALQLAQFRDQGVFCLTYESSMTRMFRDGRTETVRSCTSEAVAFVRAMEDVSATNAQRLSLFQKAAEKHQNMYRLAMTGSGIDRHLFCLYIVSKYLGADSPFLNKVLSEPWRLSTSQTPQQQLNLVDINKFPKYVGAGGGFGPVADDGYGVSYIIVGENLITFHISSKFSSPNTDSYRFGQNIQRAMIDIQTLFT 764          
BLAST of Carnitine O-palmitoyltransferase 1, liver isoform vs. Planmine SMEST
Match: SMESG000072494.1 (SMESG000072494.1)

HSP 1 Score: 875.159 bits (2260), Expect = 0.000e+0
Identity = 417/422 (98.82%), Postives = 418/422 (99.05%), Query Frame = 3
Query: 1236 LDPVDMEKQFQNILDTAVQPNDPSQYIGVLTAGERNQWAINRESFFKDGCNKESLEIIEKAAFMLVLEDEFQDYNPNDESKLDAFGHSLLHGKGHDRWYDKSFNMVVFKNGRVGFNAEHSWADAPIMAHYWEYILLEDILSPKFGYTPDGHCRGVGKSNNISPQKLQWKLSKMIELEIEKCLLTTSKLIEDIDLHIVPFSEFGRGFMKTCKVSPDGFIQMALQLAYYRDSESFCLTYEACMTRLFREGRTETVRSCSNASCEFVRSMENKDLSNSDKINYLQLASNKHQKLYRDAMTGKGVDRHIFCMYVISKYLNIESEFLQKALSVPWKLSTSQTPHTQLTKFDMRRYPNFLSAGGGFGPVTSDGYGVSYMMAGEDIIFFHISSNISCQKTDSKRFANNLCQALLDIKKLFNPLDSSGDK 2501
            LD V + KQFQNILDTAVQPNDPSQYIGVLTAGERNQWAINRESFFKDGCNKESLEIIEKAAFMLVLEDEFQDYNPNDESKLDAFGHSLLHGKGHDRWYDKSFNMVVFKNGRVGFNAEHSWADAPIMAHYWEYILLEDILSPKFGYTPDGHCRGVGKSNNISPQKLQWKLSK IELEIEKCLLTTSKLIEDIDLHIVPFSEFGRGFMKTCKVSPDGFIQMALQLAYYRDSESFCLTYEACMTRLFREGRTETVRSCSNASCEFVRSMENKDLSNSDKINYLQLASNKHQKLYRDAMTGKGVDRHIFCMYVISKYLNIESEFLQKALSVPWKLSTSQTPHTQLTKFDMRRYPNFLSAGGGFGPVTSDGYGVSYMMAGEDIIFFHISSNISCQKTDSKRFANNLCQALLDIKKLFNPLDSSGDK
Sbjct:  128 LDSV-IGKQFQNILDTAVQPNDPSQYIGVLTAGERNQWAINRESFFKDGCNKESLEIIEKAAFMLVLEDEFQDYNPNDESKLDAFGHSLLHGKGHDRWYDKSFNMVVFKNGRVGFNAEHSWADAPIMAHYWEYILLEDILSPKFGYTPDGHCRGVGKSNNISPQKLQWKLSKTIELEIEKCLLTTSKLIEDIDLHIVPFSEFGRGFMKTCKVSPDGFIQMALQLAYYRDSESFCLTYEACMTRLFREGRTETVRSCSNASCEFVRSMENKDLSNSDKINYLQLASNKHQKLYRDAMTGKGVDRHIFCMYVISKYLNIESEFLQKALSVPWKLSTSQTPHTQLTKFDMRRYPNFLSAGGGFGPVTSDGYGVSYMMAGEDIIFFHISSNISCQKTDSKRFANNLCQALLDIKKLFNPLDSSGDK 548          
BLAST of Carnitine O-palmitoyltransferase 1, liver isoform vs. Planmine SMEST
Match: SMESG000072486.1 (SMESG000072486.1)

HSP 1 Score: 692.189 bits (1785), Expect = 0.000e+0
Identity = 365/365 (100.00%), Postives = 365/365 (100.00%), Query Frame = 3
Query:  165 MAEAHQAVAFSIKVSDDGIDWSLNFKAFKEIAKSGVKSWKKGLYRIQNRFYNGLYPSQPGNWLGIVCGVFASSMVGFDLSFGLIEKIEVQLQRVLELESPRDHLIASLMYSCGLWTAGVIVRKYTLSNLLYYMDWMYESQTGPSMKTKAWMVLVTILGGGNPKLYSYQGXXXXXXXXXXXXTINKFLTSMEPLLSXXXXXXXXXXXXXXXXQHGFKIQFYLHLKYLWSSNYVSDWWEEFVYLSSRSSLMINSNYYGMDALMLRHEWIQAARAANLICASVQFMRELNTEELEPLVIQGKVPLCSRQYERMFCTVRVPRNISRKNRSDQLVHYRESRYIVVICRGNYYKVNFMKGDQYLDPVDMEK 1259
            MAEAHQAVAFSIKVSDDGIDWSLNFKAFKEIAKSGVKSWKKGLYRIQNRFYNGLYPSQPGNWLGIVCGVFASSMVGFDLSFGLIEKIEVQLQRVLELESPRDHLIASLMYSCGLWTAGVIVRKYTLSNLLYYMDWMYESQTGPSMKTKAWMVLVTILGGGNPKLYSYQGSLPKLPLPRLSSTINKFLTSMEPLLSEEEYFELKKLALEFKKQHGFKIQFYLHLKYLWSSNYVSDWWEEFVYLSSRSSLMINSNYYGMDALMLRHEWIQAARAANLICASVQFMRELNTEELEPLVIQGKVPLCSRQYERMFCTVRVPRNISRKNRSDQLVHYRESRYIVVICRGNYYKVNFMKGDQYLDPVDMEK
Sbjct:    1 MAEAHQAVAFSIKVSDDGIDWSLNFKAFKEIAKSGVKSWKKGLYRIQNRFYNGLYPSQPGNWLGIVCGVFASSMVGFDLSFGLIEKIEVQLQRVLELESPRDHLIASLMYSCGLWTAGVIVRKYTLSNLLYYMDWMYESQTGPSMKTKAWMVLVTILGGGNPKLYSYQGSLPKLPLPRLSSTINKFLTSMEPLLSEEEYFELKKLALEFKKQHGFKIQFYLHLKYLWSSNYVSDWWEEFVYLSSRSSLMINSNYYGMDALMLRHEWIQAARAANLICASVQFMRELNTEELEPLVIQGKVPLCSRQYERMFCTVRVPRNISRKNRSDQLVHYRESRYIVVICRGNYYKVNFMKGDQYLDPVDMEK 365          
BLAST of Carnitine O-palmitoyltransferase 1, liver isoform vs. Planmine SMEST
Match: SMESG000052523.1 (SMESG000052523.1)

HSP 1 Score: 657.136 bits (1694), Expect = 0.000e+0
Identity = 298/539 (55.29%), Postives = 399/539 (74.03%), Query Frame = 3
Query:  858 VSDWWEEFVYLSSRSSLMINSNYYGMDALMLRHEWIQAARAANLICASVQFMRELNTEELEPLVIQGKVPLCSRQYERMFCTVRVPRNISRKNRSDQLVHYRESRYIVVICRGNYYKVNFMKGDQYLDPVDMEKQFQNILDTAVQPNDPSQYIGVLTAGERNQWAINRESFFKDGCNKESLEIIEKAAFMLVLEDEFQDYNPNDESKLDAFGHSLLHGKGHDRWYDKSFNMVVFKNGRVGFNAEHSWADAPIMAHYWEYILLEDILSPKFGYTPDGHCRGVGKSNNISPQKLQWKLSKMIELEIEKCLLTTSKLIEDIDLHIVPFSEFGRGFMKTCKVSPDGFIQMALQLAYYRDSESFCLTYEACMTRLFREGRTETVRSCSNASCEFVRSMENKDLSNSDKINYLQLASNKHQKLYRDAMTGKGVDRHIFCMYVISKYLNIESEFLQKALSVPWKLSTSQTPHTQLTKFDMRRYPNFLSAGGGFGPVTSDGYGVSYMMAGEDIIFFHISSNISCQKTDSKRFANNLCQALLDIKKLF 2474
            VSDWWE+FVYLS R+ ++INSNYYGMDAL + H W+Q+ARAANL+CA+   M  +  E   P+++Q  +PLCS QY+RMF T R+P+ I  +  SD L    ++R+IVVI +G ++K      D+ L+PVD+E+  ++IL     P +    I +LTAGERN WA+ RE++F  G N+ SL  IE AAF+L+LED   +++P +E  LD   H+L+HGKG+DRW+DKSFN+VVF NGR GFNAEHSWADAPI+ H WEYILLED+LS  +GYTPDGHCRG+  S    P++L+W++S+ +  ++   +    ++I+D+D+HI   S +G+G MK CKVSPD FIQ++LQL YYR +  FC TYE+ MTRLFR+GRTETVRSCS   CE VRS+++K +  + K+   + A+  HQ+LYRDAMTGKGVDRH+FCMYV+ K+ N +SEFL+K L+ PWKLSTSQTP  Q  + ++ RYPNF+ AGGGFGPV  DGYGVSY++AGED IFFHISS  SC+KT+SK+FA+ L ++L DIK +F
Sbjct:  100 VSDWWEQFVYLSCRAPMIINSNYYGMDALFMPHHWLQSARAANLVCAAADVMDMIRLETWSPILLQDVIPLCSAQYDRMFGTTRIPKLIKNQKGSDHLKRNIDARHIVVIHKGRFFKCQMYFRDRKLEPVDIEEALKSILTNTDLPENNENIIPILTAGERNHWALARETYFSKGINEISLRCIETAAFILILEDASVEFDPENEKSLDDMAHALIHGKGYDRWFDKSFNIVVFNNGRAGFNAEHSWADAPIVGHMWEYILLEDLLSRNYGYTPDGHCRGIPASQLPQPERLKWEISRELLDDMNVSMKVVKEIIDDLDIHIFVHSNYGKGLMKKCKVSPDAFIQISLQLTYYRMNGKFCQTYESSMTRLFRDGRTETVRSCSAEVCEAVRSIDDKQIPRATKLLLFKKAAEYHQQLYRDAMTGKGVDRHLFCMYVVCKFFNFKSEFLEKVLTEPWKLSTSQTPLGQTKRLNLSRYPNFICAGGGFGPVADDGYGVSYIIAGEDRIFFHISSKFSCEKTNSKKFADTLMKSLSDIKGMF 638          
BLAST of Carnitine O-palmitoyltransferase 1, liver isoform vs. Planmine SMEST
Match: SMESG000052523.1 (SMESG000052523.1)

HSP 1 Score: 642.884 bits (1657), Expect = 0.000e+0
Identity = 291/524 (55.53%), Postives = 386/524 (73.66%), Query Frame = 3
Query:  858 VSDWWEEFVYLSSRSSLMINSNYYGMDALMLRHEWIQAARAANLICASVQFMRELNTEELEPLVIQGKVPLCSRQYERMFCTVRVPRNISRKNRSDQLVHYRESRYIVVICRGNYYKVNFMKGDQYLDPVDMEKQFQNILDTAVQPNDPSQYIGVLTAGERNQWAINRESFFKDGCNKESLEIIEKAAFMLVLEDEFQDYNPNDESKLDAFGHSLLHGKGHDRWYDKSFNMVVFKNGRVGFNAEHSWADAPIMAHYWEYILLEDILSPKFGYTPDGHCRGVGKSNNISPQKLQWKLSKMIELEIEKCLLTTSKLIEDIDLHIVPFSEFGRGFMKTCKVSPDGFIQMALQLAYYRDSESFCLTYEACMTRLFREGRTETVRSCSNASCEFVRSMENKDLSNSDKINYLQLASNKHQKLYRDAMTGKGVDRHIFCMYVISKYLNIESEFLQKALSVPWKLSTSQTPHTQLTKFDMRRYPNFLSAGGGFGPVTSDGYGVSYMMAGEDIIFFHISSNISCQKTDSKRF 2429
            VSDWWE+FVYLS R+ ++INSNYYGMDAL + H W+Q+ARAANL+CA+   M  +  E   P+++Q  +PLCS QY+RMF T R+P+ I  +  SD L    ++R+IVVI +G ++K      D+ L+PVD+E+  ++IL     P +    I +LTAGERN WA+ RE++F  G N+ SL  IE AAF+L+LED   +++P +E  LD   H+L+HGKG+DRW+DKSFN+VVF NGR GFNAEHSWADAPI+ H WEYILLED+LS  +GYTPDGHCRG+  S    P++L+W++S+ +  ++   +    ++I+D+D+HI   S +G+G MK CKVSPD FIQ++LQL YYR +  FC TYE+ MTRLFR+GRTETVRSCS   CE VRS+++K +  + K+   + A+  HQ+LYRDAMTGKGVDRH+FCMYV+ K+ N +SEFL+K L+ PWKLSTSQTP  Q  + ++ RYPNF+ AGGGFGPV  DGYGVSY++AGED IFFHISS  SC+KT SKR 
Sbjct:  100 VSDWWEQFVYLSCRAPMIINSNYYGMDALFMPHHWLQSARAANLVCAAADVMDMIRLETWSPILLQDVIPLCSAQYDRMFGTTRIPKLIKNQKGSDHLKRNIDARHIVVIHKGRFFKCQMYFRDRKLEPVDIEEALKSILTNTDLPENNENIIPILTAGERNHWALARETYFSKGINEISLRCIETAAFILILEDASVEFDPENEKSLDDMAHALIHGKGYDRWFDKSFNIVVFNNGRAGFNAEHSWADAPIVGHMWEYILLEDLLSRNYGYTPDGHCRGIPASQLPQPERLKWEISRELLDDMNVSMKVVKEIIDDLDIHIFVHSNYGKGLMKKCKVSPDAFIQISLQLTYYRMNGKFCQTYESSMTRLFRDGRTETVRSCSAEVCEAVRSIDDKQIPRATKLLLFKKAAEYHQQLYRDAMTGKGVDRHLFCMYVVCKFFNFKSEFLEKVLTEPWKLSTSQTPLGQTKRLNLSRYPNFICAGGGFGPVADDGYGVSYIIAGEDRIFFHISSKFSCEKTHSKRL 623          
BLAST of Carnitine O-palmitoyltransferase 1, liver isoform vs. Planmine SMEST
Match: SMESG000052523.1 (SMESG000052523.1)

HSP 1 Score: 607.446 bits (1565), Expect = 0.000e+0
Identity = 275/509 (54.03%), Postives = 372/509 (73.08%), Query Frame = 3
Query:  948 LRHEWIQAARAANLICASVQFMRELNTEELEPLVIQGKVPLCSRQYERMFCTVRVPRNISRKNRSDQLVHYRESRYIVVICRGNYYKVNFMKGDQYLDPVDMEKQFQNILDTAVQPNDPSQYIGVLTAGERNQWAINRESFFKDGCNKESLEIIEKAAFMLVLEDEFQDYNPNDESKLDAFGHSLLHGKGHDRWYDKSFNMVVFKNGRVGFNAEHSWADAPIMAHYWEYILLEDILSPKFGYTPDGHCRGVGKSNNISPQKLQWKLSKMIELEIEKCLLTTSKLIEDIDLHIVPFSEFGRGFMKTCKVSPDGFIQMALQLAYYRDSESFCLTYEACMTRLFREGRTETVRSCSNASCEFVRSMENKDLSNSDKINYLQLASNKHQKLYRDAMTGKGVDRHIFCMYVISKYLNIESEFLQKALSVPWKLSTSQTPHTQLTKFDMRRYPNFLSAGGGFGPVTSDGYGVSYMMAGEDIIFFHISSNISCQKTDSKRFANNLCQALLDIKKLF 2474
            + H W+Q+ARAANL+CA+   M  +  E   P+++Q  +PLCS QY+RMF T R+P+ I  +  SD L    ++R+IVVI +G ++K      D+ L+PVD+E+  ++IL     P +    I +LTAGERN WA+ RE++F  G N+ SL  IE AAF+L+LED   +++P +E  LD   H+L+HGKG+DRW+DKSFN+VVF NGR GFNAEHSWADAPI+ H WEYILLED+LS  +GYTPDGHCRG+  S    P++L+W++S+ +  ++   +    ++I+D+D+HI   S +G+G MK CKVSPD FIQ++LQL YYR +  FC TYE+ MTRLFR+GRTETVRSCS   CE VRS+++K +  + K+   + A+  HQ+LYRDAMTGKGVDRH+FCMYV+ K+ N +SEFL+K L+ PWKLSTSQTP  Q  + ++ RYPNF+ AGGGFGPV  DGYGVSY++AGED IFFHISS  SC+KT+SK+FA+ L ++L DIK +F
Sbjct:    1 MPHHWLQSARAANLVCAAADVMDMIRLETWSPILLQDVIPLCSAQYDRMFGTTRIPKLIKNQKGSDHLKRNIDARHIVVIHKGRFFKCQMYFRDRKLEPVDIEEALKSILTNTDLPENNENIIPILTAGERNHWALARETYFSKGINEISLRCIETAAFILILEDASVEFDPENEKSLDDMAHALIHGKGYDRWFDKSFNIVVFNNGRAGFNAEHSWADAPIVGHMWEYILLEDLLSRNYGYTPDGHCRGIPASQLPQPERLKWEISRELLDDMNVSMKVVKEIIDDLDIHIFVHSNYGKGLMKKCKVSPDAFIQISLQLTYYRMNGKFCQTYESSMTRLFRDGRTETVRSCSAEVCEAVRSIDDKQIPRATKLLLFKKAAEYHQQLYRDAMTGKGVDRHLFCMYVVCKFFNFKSEFLEKVLTEPWKLSTSQTPLGQTKRLNLSRYPNFICAGGGFGPVADDGYGVSYIIAGEDRIFFHISSKFSCEKTNSKKFADTLMKSLSDIKGMF 509          
The following BLAST results are available for this feature:
BLAST of Carnitine O-palmitoyltransferase 1, liver isoform vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CPT1A0.000e+047.74carnitine palmitoyltransferase 1A [Source:HGNC Sym... [more]
CPT1A0.000e+047.74carnitine palmitoyltransferase 1A [Source:HGNC Sym... [more]
CPT1A0.000e+047.74carnitine palmitoyltransferase 1A [Source:HGNC Sym... [more]
CPT1A0.000e+047.74carnitine palmitoyltransferase 1A [Source:HGNC Sym... [more]
CPT1B0.000e+046.83carnitine palmitoyltransferase 1B [Source:HGNC Sym... [more]
back to top
BLAST of Carnitine O-palmitoyltransferase 1, liver isoform vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cpt-10.000e+043.60Carnitine Palmitoyl Transferase [Source:UniProtKB... [more]
W03F9.43.130e-12537.29pep chromosome:WBcel235:V:147538:151388:-1 gene:WB... [more]
W03F9.41.227e-12436.65pep chromosome:WBcel235:V:147538:152104:-1 gene:WB... [more]
W03F9.41.227e-12436.65pep chromosome:WBcel235:V:147538:151388:-1 gene:WB... [more]
cpt-65.426e-9732.30Carnitine Palmitoyl Transferase [Source:UniProtKB... [more]
back to top
BLAST of Carnitine O-palmitoyltransferase 1, liver isoform vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
whd0.000e+045.87gene:FBgn0261862 transcript:FBtr0088308[more]
whd0.000e+045.87gene:FBgn0261862 transcript:FBtr0088307[more]
whd0.000e+045.48gene:FBgn0261862 transcript:FBtr0301281[more]
whd0.000e+045.48gene:FBgn0261862 transcript:FBtr0301282[more]
CRAT1.071e-6729.74gene:FBgn0037440 transcript:FBtr0347005[more]
back to top
BLAST of Carnitine O-palmitoyltransferase 1, liver isoform vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cpt1ab0.000e+046.96carnitine palmitoyltransferase 1Ab (liver) [Source... [more]
CR352222.10.000e+046.96carnitine palmitoyltransferase 1Ab (liver) [Source... [more]
cpt1cb0.000e+048.00carnitine palmitoyltransferase 1Cb [Source:ZFIN;Ac... [more]
cpt1ab0.000e+046.90carnitine palmitoyltransferase 1Ab (liver) [Source... [more]
cpt1b0.000e+046.82carnitine palmitoyltransferase 1B (muscle) [Source... [more]
back to top
BLAST of Carnitine O-palmitoyltransferase 1, liver isoform vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cpt1al0.000e+047.35carnitine palmitoyltransferase 1A (liver) like [So... [more]
cpt1al0.000e+046.78carnitine palmitoyltransferase 1A (liver) like [So... [more]
cpt1al0.000e+047.54carnitine palmitoyltransferase 1A (liver) like [So... [more]
rflcii0.000e+046.05relaxin family locus C type II [Source:Xenbase;Acc... [more]
rflcii0.000e+045.77relaxin family locus C type II [Source:Xenbase;Acc... [more]
back to top
BLAST of Carnitine O-palmitoyltransferase 1, liver isoform vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cpt1a0.000e+046.57carnitine palmitoyltransferase 1a, liver [Source:M... [more]
Cpt1b0.000e+046.83carnitine palmitoyltransferase 1b, muscle [Source:... [more]
Cpt1c0.000e+041.50carnitine palmitoyltransferase 1c [Source:MGI Symb... [more]
Cpt1c0.000e+041.50carnitine palmitoyltransferase 1c [Source:MGI Symb... [more]
Cpt1a1.330e-9440.59carnitine palmitoyltransferase 1a, liver [Source:M... [more]
back to top
BLAST of Carnitine O-palmitoyltransferase 1, liver isoform vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P50416|CPT1A_HUMAN0.000e+047.74Carnitine O-palmitoyltransferase 1, liver isoform ... [more]
sp|P97742|CPT1A_MOUSE0.000e+046.57Carnitine O-palmitoyltransferase 1, liver isoform ... [more]
sp|Q68Y62|CPT1A_HORSE0.000e+047.09Carnitine O-palmitoyltransferase 1, liver isoform ... [more]
sp|P32198|CPT1A_RAT0.000e+046.83Carnitine O-palmitoyltransferase 1, liver isoform ... [more]
sp|Q924X2|CPT1B_MOUSE0.000e+046.83Carnitine O-palmitoyltransferase 1, muscle isoform... [more]
back to top
BLAST of Carnitine O-palmitoyltransferase 1, liver isoform vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A210QUP70.000e+050.32Carnitine O-palmitoyltransferase 1, liver isoform ... [more]
A0A267DZG00.000e+050.00Uncharacterized protein OS=Macrostomum lignano OX=... [more]
R7T4M20.000e+051.04Uncharacterized protein OS=Capitella teleta OX=283... [more]
A0A267H3D60.000e+049.87Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267E4Y50.000e+049.74Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Carnitine O-palmitoyltransferase 1, liver isoform vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000012385.20.000e+046.77carnitine O-palmitoyltransferase 1, liver isoform ... [more]
cpt1ab0.000e+045.84carnitine O-palmitoyltransferase 1, liver isoform-... [more]
cpt1ab0.000e+045.78carnitine O-palmitoyltransferase 1, liver isoform-... [more]
cpt1ab0.000e+045.78carnitine O-palmitoyltransferase 1, liver isoform-... [more]
cpt1cb0.000e+046.19carnitine O-palmitoyltransferase 1, liver isoform-... [more]
back to top
BLAST of Carnitine O-palmitoyltransferase 1, liver isoform vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cpt1aa0.000e+046.76carnitine palmitoyltransferase 1Aa (liver) [Source... [more]
ENSPMAT00000008936.10.000e+044.43pep scaffold:Pmarinus_7.0:GL476544:65876:98929:-1 ... [more]
ENSPMAT00000002015.11.423e-6428.65pep scaffold:Pmarinus_7.0:GL479138:18281:30704:1 g... [more]
chata3.046e-4827.27choline O-acetyltransferase a [Source:NCBI gene;Ac... [more]
ENSPMAT00000010501.12.251e-3531.56pep scaffold:Pmarinus_7.0:GL477503:71677:77001:-1 ... [more]
back to top
BLAST of Carnitine O-palmitoyltransferase 1, liver isoform vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
CAT27.295e-5128.41Carnitine acetyl-CoA transferase; present in both ... [more]
YAT18.174e-5127.52Outer mitochondrial carnitine acetyltransferase; m... [more]
YAT22.012e-1520.10Carnitine acetyltransferase; has similarity to Yat... [more]
back to top
BLAST of Carnitine O-palmitoyltransferase 1, liver isoform vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO384552.897e-16237.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO287304.041e-11037.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO405802.736e-6127.30Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO442582.912e-6128.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO442112.594e-5226.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Carnitine O-palmitoyltransferase 1, liver isoform vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000034659.10.000e+047.48carnitine O-palmitoyltransferase 1, liver isoform ... [more]
ENSORLT00000039265.10.000e+047.55carnitine O-palmitoyltransferase 1, liver isoform ... [more]
cpt1cb0.000e+047.51carnitine O-palmitoyltransferase 1, liver isoform ... [more]
cpt1b0.000e+044.97carnitine O-palmitoyltransferase 1, liver isoform ... [more]
cpt1b0.000e+045.01carnitine O-palmitoyltransferase 1, liver isoform ... [more]
back to top
BLAST of Carnitine O-palmitoyltransferase 1, liver isoform vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000072494.10.000e+098.82SMESG000072494.1[more]
SMESG000072486.10.000e+0100.00SMESG000072486.1[more]
SMESG000052523.10.000e+055.29SMESG000052523.1[more]
SMESG000052523.10.000e+055.53SMESG000052523.1[more]
SMESG000052523.10.000e+054.03SMESG000052523.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027997 ID=SMED30027997|Name=Carnitine O-palmitoyltransferase 1, liver isoform|organism=Schmidtea mediterranea sexual|type=transcript|length=2652bp
TTACATTTACTTTGTCAAAATTATAATTAATCAATTTTCTAACATTATTC
GTATATTTTTTACTAAATTTTTCTTACACATTTTCTATAAAGTCGCATAT
TAAAAGTTTGATAGAGCTTTTTAAGTATATTCCAATTTATATCAAGTAAA
CATTTAACGGATAAATGGCAGAAGCTCATCAAGCTGTTGCATTTTCAATT
AAAGTTTCCGATGATGGAATTGACTGGTCCTTGAATTTTAAAGCATTTAA
AGAAATAGCAAAATCAGGTGTAAAATCGTGGAAAAAAGGCTTATACAGAA
TACAAAATCGATTTTATAATGGATTGTATCCATCACAGCCAGGAAATTGG
CTTGGGATAGTTTGTGGAGTTTTTGCATCATCAATGGTTGGATTTGATTT
GAGTTTTGGTTTAATTGAAAAAATCGAAGTTCAATTGCAGAGAGTTTTGG
AATTGGAATCTCCAAGAGATCATTTAATAGCTTCATTAATGTACTCTTGT
GGACTTTGGACTGCTGGTGTAATAGTTAGAAAATATACACTTTCTAATTT
ACTCTATTACATGGATTGGATGTATGAAAGTCAAACTGGACCGTCAATGA
AAACTAAAGCTTGGATGGTTTTAGTCACAATTCTCGGAGGTGGTAATCCA
AAATTGTACAGCTACCAAGGTTCATTACCGAAATTGCCTTTACCAAGATT
ATCTAGCACTATCAATAAATTTCTTACTTCCATGGAGCCTTTGTTATCAG
AAGAAGAATATTTTGAACTCAAAAAGTTGGCTTTAGAATTTAAAAAACAA
CACGGATTTAAAATTCAATTTTATCTTCATCTCAAATACTTGTGGTCTTC
CAATTATGTTTCCGACTGGTGGGAAGAATTCGTCTATTTGAGTAGTAGAT
CATCTCTGATGATTAATTCTAATTATTATGGCATGGATGCTTTAATGTTA
CGGCATGAATGGATTCAAGCAGCACGAGCTGCAAATCTTATTTGCGCATC
CGTTCAATTTATGAGAGAGCTTAACACTGAGGAACTTGAGCCATTAGTAA
TTCAAGGGAAAGTTCCTTTGTGCTCTAGACAATATGAAAGAATGTTTTGT
ACTGTAAGAGTTCCCCGTAATATTAGTCGTAAAAATCGTTCTGATCAATT
GGTTCATTATCGAGAATCAAGATATATTGTCGTTATTTGTCGTGGAAATT
ATTATAAAGTTAATTTTATGAAAGGAGATCAGTATCTGGATCCAGTTGAT
ATGGAAAAGCAATTTCAGAATATTCTTGATACTGCTGTACAACCTAATGA
CCCATCACAATATATTGGTGTTTTAACCGCTGGAGAACGCAACCAGTGGG
CTATTAATAGGGAATCGTTTTTCAAAGATGGTTGTAATAAAGAATCTTTA
GAAATAATAGAAAAAGCTGCTTTCATGTTAGTTCTTGAAGACGAATTTCA
AGATTATAACCCAAACGATGAATCGAAATTGGATGCTTTTGGTCATAGTC
TTCTTCATGGAAAAGGTCATGATAGATGGTATGACAAGTCATTCAATATG
GTTGTTTTTAAAAATGGAAGAGTAGGTTTCAATGCCGAACATTCATGGGC
TGATGCACCAATAATGGCACATTATTGGGAATATATTTTATTGGAAGATA
TTTTGAGTCCAAAATTTGGTTATACTCCGGATGGGCATTGTAGAGGAGTC
GGTAAATCGAATAATATTTCCCCTCAAAAACTACAATGGAAATTGTCGAA
AATGATTGAATTAGAAATCGAAAAATGTCTGCTTACTACATCCAAGTTAA
TAGAGGACATCGATCTGCACATTGTTCCATTTTCAGAATTTGGACGAGGT
TTCATGAAGACATGTAAAGTTTCTCCGGATGGTTTTATTCAAATGGCGCT
TCAATTAGCGTATTATAGAGACAGTGAAAGTTTTTGCTTAACCTACGAAG
CTTGTATGACTCGTCTGTTTCGAGAAGGTCGAACTGAGACAGTTCGATCT
TGTTCTAATGCGTCTTGCGAATTCGTTCGTTCAATGGAAAACAAAGATCT
CTCTAATAGTGACAAAATTAATTACCTCCAGTTGGCCAGTAATAAACATC
AGAAACTTTACAGAGATGCGATGACTGGTAAAGGTGTCGATCGCCATATA
TTCTGTATGTATGTTATCAGTAAATACTTGAATATCGAATCAGAGTTCTT
GCAAAAAGCTCTGAGTGTTCCTTGGAAACTAAGTACTTCTCAAACCCCTC
ATACCCAATTAACCAAATTCGATATGAGACGATATCCCAACTTTTTATCT
GCTGGTGGCGGGTTTGGGCCTGTCACAAGTGATGGTTATGGAGTTAGTTA
TATGATGGCAGGGGAGGATATAATATTTTTTCATATTTCTTCAAACATTT
CTTGCCAGAAAACGGATTCCAAAAGGTTTGCAAATAACTTATGCCAAGCT
TTACTGGATATTAAAAAATTATTTAATCCACTCGATTCAAGTGGTGATAA
ATGAATGGAGATCTTTGGAATATTATTCATTTCTAGCACTAGCCTGTCAT
TTGTGTTTTAGTTATATAAAATTTAGTGTTTAAATGTTTGGTTTATTTGA
TTTTATTTATAGAAGTGTGTTATTATAGATCCATTCGAGTTGAAGAAAGT
AT
back to top

protein sequence of SMED30027997-orf-1

>SMED30027997-orf-1 ID=SMED30027997-orf-1|Name=SMED30027997-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=780bp
MAEAHQAVAFSIKVSDDGIDWSLNFKAFKEIAKSGVKSWKKGLYRIQNRF
YNGLYPSQPGNWLGIVCGVFASSMVGFDLSFGLIEKIEVQLQRVLELESP
RDHLIASLMYSCGLWTAGVIVRKYTLSNLLYYMDWMYESQTGPSMKTKAW
MVLVTILGGGNPKLYSYQGSLPKLPLPRLSSTINKFLTSMEPLLSEEEYF
ELKKLALEFKKQHGFKIQFYLHLKYLWSSNYVSDWWEEFVYLSSRSSLMI
NSNYYGMDALMLRHEWIQAARAANLICASVQFMRELNTEELEPLVIQGKV
PLCSRQYERMFCTVRVPRNISRKNRSDQLVHYRESRYIVVICRGNYYKVN
FMKGDQYLDPVDMEKQFQNILDTAVQPNDPSQYIGVLTAGERNQWAINRE
SFFKDGCNKESLEIIEKAAFMLVLEDEFQDYNPNDESKLDAFGHSLLHGK
GHDRWYDKSFNMVVFKNGRVGFNAEHSWADAPIMAHYWEYILLEDILSPK
FGYTPDGHCRGVGKSNNISPQKLQWKLSKMIELEIEKCLLTTSKLIEDID
LHIVPFSEFGRGFMKTCKVSPDGFIQMALQLAYYRDSESFCLTYEACMTR
LFREGRTETVRSCSNASCEFVRSMENKDLSNSDKINYLQLASNKHQKLYR
DAMTGKGVDRHIFCMYVISKYLNIESEFLQKALSVPWKLSTSQTPHTQLT
KFDMRRYPNFLSAGGGFGPVTSDGYGVSYMMAGEDIIFFHISSNISCQKT
DSKRFANNLCQALLDIKKLFNPLDSSGDK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR039551Cho/carn_acyl_trans
IPR042231Cho/carn_acyl_trans_2
IPR042232Cho/carn_acyl_trans_1
IPR000542Carn_acyl_trans
IPR032476CPT_N
Vocabulary: molecular function
TermDefinition
GO:0016746transferase activity, transferring acyl groups
GO:0004095carnitine O-palmitoyltransferase activity
GO:0016740transferase activity
GO:0042802identical protein binding
GO:1990698palmitoleoyltransferase activity
Vocabulary: biological process
TermDefinition
GO:0001676long-chain fatty acid metabolic process
GO:0006006glucose metabolic process
GO:0006629lipid metabolic process
GO:0006631fatty acid metabolic process
GO:0006635fatty acid beta-oxidation
GO:0006641triglyceride metabolic process
GO:0006810transport
GO:0006853carnitine shuttle
GO:0007623circadian rhythm
GO:0009437carnitine metabolic process
GO:0014070response to organic cyclic compound
GO:0030855epithelial cell differentiation
GO:0032000positive regulation of fatty acid beta-oxidation
GO:0042493response to drug
GO:0042755eating behavior
GO:0046320regulation of fatty acid oxidation
GO:0050796regulation of insulin secretion
GO:0051260protein homooligomerization
GO:0071398cellular response to fatty acid
Vocabulary: cellular component
TermDefinition
GO:0005739mitochondrion
GO:0005741mitochondrial outer membrane
GO:0005743mitochondrial inner membrane
GO:0016020membrane
GO:0016021integral component of membrane
GO:0031307integral component of mitochondrial outer membrane
GO:0043231intracellular membrane-bounded organelle
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR032476Carnitine O-palmitoyltransferase, N-terminalPFAMPF16484CPT_Ncoord: 1..46
e-value: 5.6E-18
score: 64.7
IPR039551Choline/carnitine acyltransferase domainPFAMPF00755Carn_acyltransfcoord: 171..767
e-value: 1.4E-191
score: 638.2
IPR042231Choline/Carnitine o-acyltransferase, domain 2GENE3DG3DSA:3.30.559.70coord: 230..552
e-value: 3.5E-195
score: 651.6
IPR042232Choline/Carnitine o-acyltransferase, domain 1GENE3DG3DSA:3.30.559.40coord: 170..767
e-value: 3.5E-195
score: 651.6
IPR000542Acyltransferase ChoActase/COT/CPTPANTHERPTHR22589CARNITINE O-ACYLTRANSFERASEcoord: 87..770
IPR000542Acyltransferase ChoActase/COT/CPTPROSITEPS00440ACYLTRANSF_C_2coord: 454..481
NoneNo IPR availablePANTHERPTHR22589:SF31CARNITINE PALMITOYLTRANSFERASE Icoord: 87..770
NoneNo IPR availableSUPERFAMILYSSF52777CoA-dependent acyltransferasescoord: 548..771
NoneNo IPR availableSUPERFAMILYSSF52777CoA-dependent acyltransferasescoord: 163..546