L-2-hydroxyglutarate dehydrogenase, mitochondrial

Overview
NameL-2-hydroxyglutarate dehydrogenase, mitochondrial
Smed IDSMED30027991
Length (bp)1661
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of L-2-hydroxyglutarate dehydrogenase, mitochondrial (SMED30027991) t-SNE clustered cells

Violin plots show distribution of expression levels for L-2-hydroxyglutarate dehydrogenase, mitochondrial (SMED30027991) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of L-2-hydroxyglutarate dehydrogenase, mitochondrial (SMED30027991) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for L-2-hydroxyglutarate dehydrogenase, mitochondrial (SMED30027991) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027991

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30027991h1SMcG0008033 Contig5679GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
protonephridiaSMED30027991h1SMcG0008033 dd_Smed_v4_1758_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30027991h1SMcG0008033 dd_Smed_v4_1758_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30027991h1SMcG0008033 dd_Smed_v4_1758_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30027991h1SMcG0008033 dd_Smed_v4_1758_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of L-2-hydroxyglutarate dehydrogenase, mitochondrial vs. Ensembl Human
Match: L2HGDH (L-2-hydroxyglutarate dehydrogenase [Source:HGNC Symbol;Acc:HGNC:20499])

HSP 1 Score: 474.552 bits (1220), Expect = 1.413e-163
Identity = 224/403 (55.58%), Postives = 297/403 (73.70%), Query Frame = 2
Query:  197 LATARELKIRHPKLKMCVLEKEKLLSMHQSGHNSGVIHAGIYYTPGSLKAKLCVEGLKSSYVYLDKKKIPYKKCGKLIVATNPLEVSRLDELLKKGQANEVPDLKVVDASGIKEIEPNCAGLKALHSPHTGIVDWRLVALSYANDFKKSGGEIFLNFEVSEFNEAKES-------LDYPVELVAKNSKRVQSKYAIICGGLHADKLAVKSGCSDVPKIVPFRGDYLILKPDKKNMVRGNIYPVPDPRFPFLGVHFTPRMDGNVWLGPNAILAFKREGYGLLDFNLADTIDAIVFPGMLKIGAKHFTVGLKEMIGVAFISQQVKALKKFIPILTVNDVCRGPSGVRAQALNKDGGLVDDFVFHQGIGSIGSRLLHVRNAPSPAATSSMAIARMIVDKVDVDFKL 1384
            LA+AR L +RHP L + VLEKEK L++HQ+GHNSGVIH+GIYY P SLKAKLCV+G    Y Y  +K I YK+CGKLIVA    E+ RL  L +KG  N VP L+++    IK+ EP C GL A+  PHTGIVD+R VALS+A DF+++GG +  NFEV     AKES       + YP+ +     + ++ +Y + C GL++D+++  SGC+  P+IVPFRGDYL+LKP+K  +V+GNIYPVPD RFPFLGVHFTPRMDG++WLGPNA+LAFKREGY   DF+  D +D I+  G++K+ +++F+ G+ EM    F+   VK L+KFIP +T++D+ RGP+GVRAQAL++DG LV+DFVF  G+G IG+R+LHVRNAPSPAATSS+AI+ MI D+V   F+L
Sbjct:   61 LASARALILRHPSLSIGVLEKEKDLAVHQTGHNSGVIHSGIYYKPESLKAKLCVQGAALLYEYCQQKGISYKQCGKLIVAVEQEEIPRLQALYEKGLQNGVPGLRLIQQEDIKKKEPYCRGLMAIDCPHTGIVDYRQVALSFAQDFQEAGGSVLTNFEVKGIEMAKESPSRSIDGMQYPIVIKNTKGEEIRCQYVVTCAGLYSDRISELSGCTPDPRIVPFRGDYLLLKPEKCYLVKGNIYPVPDSRFPFLGVHFTPRMDGSIWLGPNAVLAFKREGYRPFDFSATDVMDIIINSGLIKLASQNFSYGVTEMYKACFLGATVKYLQKFIPEITISDILRGPAGVRAQALDRDGNLVEDFVFDAGVGDIGNRILHVRNAPSPAATSSIAISGMIADEVQQRFEL 463          
BLAST of L-2-hydroxyglutarate dehydrogenase, mitochondrial vs. Ensembl Human
Match: L2HGDH (L-2-hydroxyglutarate dehydrogenase [Source:HGNC Symbol;Acc:HGNC:20499])

HSP 1 Score: 474.552 bits (1220), Expect = 1.413e-163
Identity = 224/403 (55.58%), Postives = 297/403 (73.70%), Query Frame = 2
Query:  197 LATARELKIRHPKLKMCVLEKEKLLSMHQSGHNSGVIHAGIYYTPGSLKAKLCVEGLKSSYVYLDKKKIPYKKCGKLIVATNPLEVSRLDELLKKGQANEVPDLKVVDASGIKEIEPNCAGLKALHSPHTGIVDWRLVALSYANDFKKSGGEIFLNFEVSEFNEAKES-------LDYPVELVAKNSKRVQSKYAIICGGLHADKLAVKSGCSDVPKIVPFRGDYLILKPDKKNMVRGNIYPVPDPRFPFLGVHFTPRMDGNVWLGPNAILAFKREGYGLLDFNLADTIDAIVFPGMLKIGAKHFTVGLKEMIGVAFISQQVKALKKFIPILTVNDVCRGPSGVRAQALNKDGGLVDDFVFHQGIGSIGSRLLHVRNAPSPAATSSMAIARMIVDKVDVDFKL 1384
            LA+AR L +RHP L + VLEKEK L++HQ+GHNSGVIH+GIYY P SLKAKLCV+G    Y Y  +K I YK+CGKLIVA    E+ RL  L +KG  N VP L+++    IK+ EP C GL A+  PHTGIVD+R VALS+A DF+++GG +  NFEV     AKES       + YP+ +     + ++ +Y + C GL++D+++  SGC+  P+IVPFRGDYL+LKP+K  +V+GNIYPVPD RFPFLGVHFTPRMDG++WLGPNA+LAFKREGY   DF+  D +D I+  G++K+ +++F+ G+ EM    F+   VK L+KFIP +T++D+ RGP+GVRAQAL++DG LV+DFVF  G+G IG+R+LHVRNAPSPAATSS+AI+ MI D+V   F+L
Sbjct:   61 LASARALILRHPSLSIGVLEKEKDLAVHQTGHNSGVIHSGIYYKPESLKAKLCVQGAALLYEYCQQKGISYKQCGKLIVAVEQEEIPRLQALYEKGLQNGVPGLRLIQQEDIKKKEPYCRGLMAIDCPHTGIVDYRQVALSFAQDFQEAGGSVLTNFEVKGIEMAKESPSRSIDGMQYPIVIKNTKGEEIRCQYVVTCAGLYSDRISELSGCTPDPRIVPFRGDYLLLKPEKCYLVKGNIYPVPDSRFPFLGVHFTPRMDGSIWLGPNAVLAFKREGYRPFDFSATDVMDIIINSGLIKLASQNFSYGVTEMYKACFLGATVKYLQKFIPEITISDILRGPAGVRAQALDRDGNLVEDFVFDAGVGDIGNRILHVRNAPSPAATSSIAISGMIADEVQQRFEL 463          
BLAST of L-2-hydroxyglutarate dehydrogenase, mitochondrial vs. Ensembl Human
Match: L2HGDH (L-2-hydroxyglutarate dehydrogenase [Source:HGNC Symbol;Acc:HGNC:20499])

HSP 1 Score: 384.415 bits (986), Expect = 1.660e-128
Identity = 184/354 (51.98%), Postives = 248/354 (70.06%), Query Frame = 2
Query:  197 LATARELKIRHPKLKMCVLEKEKLLSMHQSGHNSGVIHAGIYYTPGSLKAKLCVEGLKSSYVYLDKKKIPYKKCGKLIVATNPLEVSRLDELLKKGQANEVPDLKVVDASGIKEIEPNCAGLKALHSPHTGIVDWRLVALSYANDFKKSGGEIFLNFEVSEFNEAKES-------LDYPVELVAKNSKRVQSKYAIICGGLHADKLAVKSGCSDVPKIVPFRGDYLILKPDKKNMVRGNIYPVPDPRFPFLGVHFTPRMDGNVWLGPNAILAFKREGYGLLDFNLADTIDAIVFPGMLKIGAKHFTVGLKEMIGVAFISQQVKALKKFIPILTVNDV-----CRGPSGVRAQAL 1222
            LA+AR L +RHP L + VLEKEK L++HQ+GHNSGVIH+GIYY P SLKAKLCV+G    Y Y  +K I YK+CGKLIVA    E+ RL  L +KG  N VP L+++    IK+ EP C GL A+  PHTGIVD+R VALS+A DF+++GG +  NFEV     AKES       + YP+ +     + ++ +Y + C GL++D+++  SGC+  P+IVPFRGDYL+LKP+K  +V+GNIYPVPD RFPFLGVHFTPRMDG++WLGPNA+LAFKREGY   DF+  D +D I+  G++K+ +++F+ G+ EM    F+   VK L+KFIP +T++D+      RGPS +  Q +
Sbjct:   61 LASARALILRHPSLSIGVLEKEKDLAVHQTGHNSGVIHSGIYYKPESLKAKLCVQGAALLYEYCQQKGISYKQCGKLIVAVEQEEIPRLQALYEKGLQNGVPGLRLIQQEDIKKKEPYCRGLMAIDCPHTGIVDYRQVALSFAQDFQEAGGSVLTNFEVKGIEMAKESPSRSIDGMQYPIVIKNTKGEEIRCQYVVTCAGLYSDRISELSGCTPDPRIVPFRGDYLLLKPEKCYLVKGNIYPVPDSRFPFLGVHFTPRMDGSIWLGPNAVLAFKREGYRPFDFSATDVMDIIINSGLIKLASQNFSYGVTEMYKACFLGATVKYLQKFIPEITISDILRQVAVRGPSWLWQQPM 414          
BLAST of L-2-hydroxyglutarate dehydrogenase, mitochondrial vs. Ensembl Human
Match: L2HGDH (L-2-hydroxyglutarate dehydrogenase [Source:HGNC Symbol;Acc:HGNC:20499])

HSP 1 Score: 193.356 bits (490), Expect = 2.094e-57
Identity = 96/168 (57.14%), Postives = 119/168 (70.83%), Query Frame = 2
Query:  197 LATARELKIRHPKLKMCVLEKEKLLSMHQSGHNSGVIHAGIYYTPGSLKAKLCVEGLKSSYVYLDKKKIPYKKCGKLIVATNPLEVSRLDELLKKGQANEVPDLKVVDASGIKEIEPNCAGLKALHSPHTGIVDWRLVALSYANDFKKSGGEIFLNFEVSEFNEAKES 700
            LA+AR L +RHP L + VLEKEK L++HQ+GHNSGVIH+GIYY P SLKAKLCV+G    Y Y  +K I YK+CGKLIVA    E+ RL  L +KG  N VP L+++    IK+ EP C GL A+  PHTGIVD+R VALS+A DF+++GG +  NFEV     AKES
Sbjct:   61 LASARALILRHPSLSIGVLEKEKDLAVHQTGHNSGVIHSGIYYKPESLKAKLCVQGAALLYEYCQQKGISYKQCGKLIVAVEQEEIPRLQALYEKGLQNGVPGLRLIQQEDIKKKEPYCRGLMAIDCPHTGIVDYRQVALSFAQDFQEAGGSVLTNFEVKGIEMAKES 228          
BLAST of L-2-hydroxyglutarate dehydrogenase, mitochondrial vs. Ensembl Human
Match: L2HGDH (L-2-hydroxyglutarate dehydrogenase [Source:HGNC Symbol;Acc:HGNC:20499])

HSP 1 Score: 135.191 bits (339), Expect = 5.797e-36
Identity = 68/119 (57.14%), Postives = 84/119 (70.59%), Query Frame = 2
Query:  197 LATARELKIRHPKLKMCVLEKEKLLSMHQSGHNSGVIHAGIYYTPGSLKAKLCVEGLKSSYVYLDKKKIPYKKCGKLIVATNPLEVSRLDELLKKGQANEVPDLKVVDASGIKEIEPNC 553
            LA+AR L +RHP L + VLEKEK L++HQ+GHNSGVIH+GIYY P SLKAKLCV+G    Y Y  +K I YK+CGKLIVA    E+ RL  L +KG  N VP L+++    IK+ EP C
Sbjct:   61 LASARALILRHPSLSIGVLEKEKDLAVHQTGHNSGVIHSGIYYKPESLKAKLCVQGAALLYEYCQQKGISYKQCGKLIVAVEQEEIPRLQALYEKGLQNGVPGLRLIQQEDIKKKEPYC 179          
BLAST of L-2-hydroxyglutarate dehydrogenase, mitochondrial vs. Ensembl Celegans
Match: Y45G12B.3 (L-2-hydroxyglutarate dehydrogenase, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:Q9N4Z0])

HSP 1 Score: 472.241 bits (1214), Expect = 1.588e-163
Identity = 233/410 (56.83%), Postives = 309/410 (75.37%), Query Frame = 2
Query:  158 EYDIAXXXXXXXXLATARELKIRHPKLKMCVLEKEKLLSMHQSGHNSGVIHAGIYYTPGSLKAKLCVEGLKSSYVYLDKKKIPYKKCGKLIVATNPLEVSRLDELLKKGQANEVPDLKVVDASGIKEIEPNCAGLKALHSPHTGIVDWRLVALSYANDFKKSGGEIFLNFEVSEFNEAKESLDYPVELVAKNS-KRVQSKYAIICGGLHADKLAVKSGCSDVPKIVPFRGDYLILKPDKKNMVRGNIYPVPDPRFPFLGVHFTPRMDGNVWLGPNAILAFKREGYGLLDFNLADTIDAIVFPGMLKIGAKHFTVGLKEMIGVAFISQQVKALKKFIPILTVNDVCRGPSGVRAQALNKDGGLVDDFVFHQGIGSIGSRLLHVRNAPSPAATSSMAIARMIVDKVDVDFKL 1384
            +YD+ IVGGGIVG ATAR+L I  P+LK+ ++EKEK L++HQSGHNSGVIHAGIYYTPGSLKAKLCVEGL  SY + DK+K+PYKK GKLIVA  P EV RLD L  + Q N   D++++D+S I E+EP+C GLKAL SPHTGIVDW  V   +  DF+K GG+I+ ++ + + ++  +   YP+ + +  +    ++K  I C GL +D++A  SGCS  PKIVPFRG+YL+LKP+K+++V+ NIYPVPDPRFPFLGVHFTPRM+G++WLGPNA+LA+KREGY     + +D ++++ + GM K+  KHFT G+KE+    +I+ QVK L++FIP L ++DV RGP+GVRAQA++  G LVDDFVF  G G +   L+HVRNAPSPAATSS+AIA+MI  +    FKL
Sbjct:   25 KYDLVIVGGGIVGCATARQLLIEKPQLKVALIEKEKELAVHQSGHNSGVIHAGIYYTPGSLKAKLCVEGLDLSYEFFDKEKVPYKKTGKLIVAVEPEEVPRLDALFSRAQTNGCRDIEMIDSSKITELEPHCRGLKALWSPHTGIVDWGYVTKRFGEDFEKRGGKIYTSYPLEKISDNHDP-GYPIRVSSGPALAEFETKNLITCAGLQSDRVAALSGCSTDPKIVPFRGEYLLLKPEKRHLVKTNIYPVPDPRFPFLGVHFTPRMNGDIWLGPNAVLAYKREGYSYFSISPSDLLESLSYSGMQKLVKKHFTFGIKELYRGVWIAAQVKQLQRFIPELKLSDVTRGPAGVRAQAMDSAGNLVDDFVFDSGTGKLSPLLMHVRNAPSPAATSSLAIAKMITSEAINRFKL 433          
BLAST of L-2-hydroxyglutarate dehydrogenase, mitochondrial vs. Ensembl Celegans
Match: Y45G12B.3 (L-2-hydroxyglutarate dehydrogenase, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:Q9N4Z0])

HSP 1 Score: 472.241 bits (1214), Expect = 1.588e-163
Identity = 233/410 (56.83%), Postives = 309/410 (75.37%), Query Frame = 2
Query:  158 EYDIAXXXXXXXXLATARELKIRHPKLKMCVLEKEKLLSMHQSGHNSGVIHAGIYYTPGSLKAKLCVEGLKSSYVYLDKKKIPYKKCGKLIVATNPLEVSRLDELLKKGQANEVPDLKVVDASGIKEIEPNCAGLKALHSPHTGIVDWRLVALSYANDFKKSGGEIFLNFEVSEFNEAKESLDYPVELVAKNS-KRVQSKYAIICGGLHADKLAVKSGCSDVPKIVPFRGDYLILKPDKKNMVRGNIYPVPDPRFPFLGVHFTPRMDGNVWLGPNAILAFKREGYGLLDFNLADTIDAIVFPGMLKIGAKHFTVGLKEMIGVAFISQQVKALKKFIPILTVNDVCRGPSGVRAQALNKDGGLVDDFVFHQGIGSIGSRLLHVRNAPSPAATSSMAIARMIVDKVDVDFKL 1384
            +YD+ IVGGGIVG ATAR+L I  P+LK+ ++EKEK L++HQSGHNSGVIHAGIYYTPGSLKAKLCVEGL  SY + DK+K+PYKK GKLIVA  P EV RLD L  + Q N   D++++D+S I E+EP+C GLKAL SPHTGIVDW  V   +  DF+K GG+I+ ++ + + ++  +   YP+ + +  +    ++K  I C GL +D++A  SGCS  PKIVPFRG+YL+LKP+K+++V+ NIYPVPDPRFPFLGVHFTPRM+G++WLGPNA+LA+KREGY     + +D ++++ + GM K+  KHFT G+KE+    +I+ QVK L++FIP L ++DV RGP+GVRAQA++  G LVDDFVF  G G +   L+HVRNAPSPAATSS+AIA+MI  +    FKL
Sbjct:   25 KYDLVIVGGGIVGCATARQLLIEKPQLKVALIEKEKELAVHQSGHNSGVIHAGIYYTPGSLKAKLCVEGLDLSYEFFDKEKVPYKKTGKLIVAVEPEEVPRLDALFSRAQTNGCRDIEMIDSSKITELEPHCRGLKALWSPHTGIVDWGYVTKRFGEDFEKRGGKIYTSYPLEKISDNHDP-GYPIRVSSGPALAEFETKNLITCAGLQSDRVAALSGCSTDPKIVPFRGEYLLLKPEKRHLVKTNIYPVPDPRFPFLGVHFTPRMNGDIWLGPNAVLAYKREGYSYFSISPSDLLESLSYSGMQKLVKKHFTFGIKELYRGVWIAAQVKQLQRFIPELKLSDVTRGPAGVRAQAMDSAGNLVDDFVFDSGTGKLSPLLMHVRNAPSPAATSSLAIAKMITSEAINRFKL 433          
BLAST of L-2-hydroxyglutarate dehydrogenase, mitochondrial vs. Ensembl Celegans
Match: Y45G12B.3 (L-2-hydroxyglutarate dehydrogenase, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:Q9N4Z0])

HSP 1 Score: 332.798 bits (852), Expect = 5.165e-111
Identity = 154/292 (52.74%), Postives = 215/292 (73.63%), Query Frame = 2
Query:  512 VVDASGIKEIEPNCAGLKALHSPHTGIVDWRLVALSYANDFKKSGGEIFLNFEVSEFNEAKESLDYPVELVAKNS-KRVQSKYAIICGGLHADKLAVKSGCSDVPKIVPFRGDYLILKPDKKNMVRGNIYPVPDPRFPFLGVHFTPRMDGNVWLGPNAILAFKREGYGLLDFNLADTIDAIVFPGMLKIGAKHFTVGLKEMIGVAFISQQVKALKKFIPILTVNDVCRGPSGVRAQALNKDGGLVDDFVFHQGIGSIGSRLLHVRNAPSPAATSSMAIARMIVDKVDVDFKL 1384
            ++D+S I E+EP+C GLKAL SPHTGIVDW  V   +  DF+K GG+I+ ++ + + ++  +   YP+ + +  +    ++K  I C GL +D++A  SGCS  PKIVPFRG+YL+LKP+K+++V+ NIYPVPDPRFPFLGVHFTPRM+G++WLGPNA+LA+KREGY     + +D ++++ + GM K+  KHFT G+KE+    +I+ QVK L++FIP L ++DV RGP+GVRAQA++  G LVDDFVF  G G +   L+HVRNAPSPAATSS+AIA+MI  +    FKL
Sbjct:    1 MIDSSKITELEPHCRGLKALWSPHTGIVDWGYVTKRFGEDFEKRGGKIYTSYPLEKISDNHDP-GYPIRVSSGPALAEFETKNLITCAGLQSDRVAALSGCSTDPKIVPFRGEYLLLKPEKRHLVKTNIYPVPDPRFPFLGVHFTPRMNGDIWLGPNAVLAYKREGYSYFSISPSDLLESLSYSGMQKLVKKHFTFGIKELYRGVWIAAQVKQLQRFIPELKLSDVTRGPAGVRAQAMDSAGNLVDDFVFDSGTGKLSPLLMHVRNAPSPAATSSLAIAKMITSEAINRFKL 291          
BLAST of L-2-hydroxyglutarate dehydrogenase, mitochondrial vs. Ensembl Fly
Match: L2HGDH (gene:FBgn0032729 transcript:FBtr0340324)

HSP 1 Score: 509.22 bits (1310), Expect = 1.455e-177
Identity = 251/412 (60.92%), Postives = 320/412 (77.67%), Query Frame = 2
Query:  158 EYDIAXXXXXXXXLATARELKIRHPKLKMCVLEKEKLLSMHQSGHNSGVIHAGIYYTPGSLKAKLCVEGLKSSYVYLDKKKIPYKKCGKLIVATNPLEVSRLDELLKKGQANEVPDLKVVDASGIKEIEPNCAGLKALHSPHTGIVDWRLVALSYANDFKKSGGEIFLNFEVSEFNEAKESLDYPVEL-VAKNSKRVQSKYAIICGGLHADKLAVKSGCSDVPKIVPFRGDYLILKPDKKNMVRGNIYPVPDPRFPFLGVHFTPRMDGNVWLGPNAILAFKREGYGLLDFNLADTIDAIVFPGMLKIGAKHFTVGLKEMIGVAFISQQVKALKKFIPILTVNDVCRGPSGVRAQALNKDGGLVDDFVFH--QGIGSIGSRLLHVRNAPSPAATSSMAIARMIVDKVDVDFKL 1384
            +YD+ +VGGGIVG A+ARE+ +RHP LK+ VLEKE  L+ HQSGHNSGVIHAGIYY PG+LKA+LCVEG+  +Y YLD+KKIPYKK GKLIVAT+  EV  L +L K+G AN VPDL++++ S I+EIEP C G+ ALHSPHTGIVDW LV   Y  DFK+ GG+I+L+F VS+F E KE  DYPV +  AK  + V++K  + CGGL +D LA K+GC   P+IVPFRG+YL+L  +K++MV+GNIYPVPDPRFPFLGVHFTPRMDG++WLGPNA+LA KREGY   D NL +  DA+ +PG +K+ +K+   GL EM    FI+ Q+KAL+K+IP +T  D+ RGP+GVRAQA++ DG LVDDFVF   QG G++  R+LH RNAPSP ATSS+AIA+MI DK++ +F +
Sbjct:   42 DYDLVVVGGGIVGAASAREIVLRHPSLKVAVLEKECKLAKHQSGHNSGVIHAGIYYKPGTLKARLCVEGMHLAYAYLDEKKIPYKKTGKLIVATDEKEVKLLKDLEKRGIANNVPDLRMIEGSEIQEIEPYCQGVMALHSPHTGIVDWGLVTEHYGQDFKQCGGDIYLDFNVSKFTETKEGTDYPVTIHGAKPGQTVRTKNVLTCGGLQSDLLAEKTGCPRDPRIVPFRGEYLLLTKEKQHMVKGNIYPVPDPRFPFLGVHFTPRMDGSIWLGPNAVLALKREGYTWGDINLFELFDALRYPGFVKMASKYIGFGLSEMSKSWFINLQIKALQKYIPDITEYDIQRGPAGVRAQAMDLDGNLVDDFVFDRGQGSGALAKRVLHCRNAPSPGATSSLAIAKMIADKIENEFSI 453          
BLAST of L-2-hydroxyglutarate dehydrogenase, mitochondrial vs. Ensembl Fly
Match: L2HGDH (gene:FBgn0032729 transcript:FBtr0081186)

HSP 1 Score: 509.22 bits (1310), Expect = 1.455e-177
Identity = 251/412 (60.92%), Postives = 320/412 (77.67%), Query Frame = 2
Query:  158 EYDIAXXXXXXXXLATARELKIRHPKLKMCVLEKEKLLSMHQSGHNSGVIHAGIYYTPGSLKAKLCVEGLKSSYVYLDKKKIPYKKCGKLIVATNPLEVSRLDELLKKGQANEVPDLKVVDASGIKEIEPNCAGLKALHSPHTGIVDWRLVALSYANDFKKSGGEIFLNFEVSEFNEAKESLDYPVEL-VAKNSKRVQSKYAIICGGLHADKLAVKSGCSDVPKIVPFRGDYLILKPDKKNMVRGNIYPVPDPRFPFLGVHFTPRMDGNVWLGPNAILAFKREGYGLLDFNLADTIDAIVFPGMLKIGAKHFTVGLKEMIGVAFISQQVKALKKFIPILTVNDVCRGPSGVRAQALNKDGGLVDDFVFH--QGIGSIGSRLLHVRNAPSPAATSSMAIARMIVDKVDVDFKL 1384
            +YD+ +VGGGIVG A+ARE+ +RHP LK+ VLEKE  L+ HQSGHNSGVIHAGIYY PG+LKA+LCVEG+  +Y YLD+KKIPYKK GKLIVAT+  EV  L +L K+G AN VPDL++++ S I+EIEP C G+ ALHSPHTGIVDW LV   Y  DFK+ GG+I+L+F VS+F E KE  DYPV +  AK  + V++K  + CGGL +D LA K+GC   P+IVPFRG+YL+L  +K++MV+GNIYPVPDPRFPFLGVHFTPRMDG++WLGPNA+LA KREGY   D NL +  DA+ +PG +K+ +K+   GL EM    FI+ Q+KAL+K+IP +T  D+ RGP+GVRAQA++ DG LVDDFVF   QG G++  R+LH RNAPSP ATSS+AIA+MI DK++ +F +
Sbjct:   42 DYDLVVVGGGIVGAASAREIVLRHPSLKVAVLEKECKLAKHQSGHNSGVIHAGIYYKPGTLKARLCVEGMHLAYAYLDEKKIPYKKTGKLIVATDEKEVKLLKDLEKRGIANNVPDLRMIEGSEIQEIEPYCQGVMALHSPHTGIVDWGLVTEHYGQDFKQCGGDIYLDFNVSKFTETKEGTDYPVTIHGAKPGQTVRTKNVLTCGGLQSDLLAEKTGCPRDPRIVPFRGEYLLLTKEKQHMVKGNIYPVPDPRFPFLGVHFTPRMDGSIWLGPNAVLALKREGYTWGDINLFELFDALRYPGFVKMASKYIGFGLSEMSKSWFINLQIKALQKYIPDITEYDIQRGPAGVRAQAMDLDGNLVDDFVFDRGQGSGALAKRVLHCRNAPSPGATSSLAIAKMIADKIENEFSI 453          
BLAST of L-2-hydroxyglutarate dehydrogenase, mitochondrial vs. Ensembl Fly
Match: L2HGDH (gene:FBgn0032729 transcript:FBtr0340323)

HSP 1 Score: 509.22 bits (1310), Expect = 1.455e-177
Identity = 251/412 (60.92%), Postives = 320/412 (77.67%), Query Frame = 2
Query:  158 EYDIAXXXXXXXXLATARELKIRHPKLKMCVLEKEKLLSMHQSGHNSGVIHAGIYYTPGSLKAKLCVEGLKSSYVYLDKKKIPYKKCGKLIVATNPLEVSRLDELLKKGQANEVPDLKVVDASGIKEIEPNCAGLKALHSPHTGIVDWRLVALSYANDFKKSGGEIFLNFEVSEFNEAKESLDYPVEL-VAKNSKRVQSKYAIICGGLHADKLAVKSGCSDVPKIVPFRGDYLILKPDKKNMVRGNIYPVPDPRFPFLGVHFTPRMDGNVWLGPNAILAFKREGYGLLDFNLADTIDAIVFPGMLKIGAKHFTVGLKEMIGVAFISQQVKALKKFIPILTVNDVCRGPSGVRAQALNKDGGLVDDFVFH--QGIGSIGSRLLHVRNAPSPAATSSMAIARMIVDKVDVDFKL 1384
            +YD+ +VGGGIVG A+ARE+ +RHP LK+ VLEKE  L+ HQSGHNSGVIHAGIYY PG+LKA+LCVEG+  +Y YLD+KKIPYKK GKLIVAT+  EV  L +L K+G AN VPDL++++ S I+EIEP C G+ ALHSPHTGIVDW LV   Y  DFK+ GG+I+L+F VS+F E KE  DYPV +  AK  + V++K  + CGGL +D LA K+GC   P+IVPFRG+YL+L  +K++MV+GNIYPVPDPRFPFLGVHFTPRMDG++WLGPNA+LA KREGY   D NL +  DA+ +PG +K+ +K+   GL EM    FI+ Q+KAL+K+IP +T  D+ RGP+GVRAQA++ DG LVDDFVF   QG G++  R+LH RNAPSP ATSS+AIA+MI DK++ +F +
Sbjct:   42 DYDLVVVGGGIVGAASAREIVLRHPSLKVAVLEKECKLAKHQSGHNSGVIHAGIYYKPGTLKARLCVEGMHLAYAYLDEKKIPYKKTGKLIVATDEKEVKLLKDLEKRGIANNVPDLRMIEGSEIQEIEPYCQGVMALHSPHTGIVDWGLVTEHYGQDFKQCGGDIYLDFNVSKFTETKEGTDYPVTIHGAKPGQTVRTKNVLTCGGLQSDLLAEKTGCPRDPRIVPFRGEYLLLTKEKQHMVKGNIYPVPDPRFPFLGVHFTPRMDGSIWLGPNAVLALKREGYTWGDINLFELFDALRYPGFVKMASKYIGFGLSEMSKSWFINLQIKALQKYIPDITEYDIQRGPAGVRAQAMDLDGNLVDDFVFDRGQGSGALAKRVLHCRNAPSPGATSSLAIAKMIADKIENEFSI 453          
BLAST of L-2-hydroxyglutarate dehydrogenase, mitochondrial vs. Ensembl Zebrafish
Match: l2hgdh (L-2-hydroxyglutarate dehydrogenase [Source:ZFIN;Acc:ZDB-GENE-090319-6])

HSP 1 Score: 491.115 bits (1263), Expect = 2.012e-170
Identity = 240/415 (57.83%), Postives = 312/415 (75.18%), Query Frame = 2
Query:  161 YDIAXXXXXXXXLATARELKIRHPKLKMCVLEKEKLLSMHQSGHNSGVIHAGIYYTPGSLKAKLCVEGLKSSYVYLDKKKIPYKKCGKLIVATNPLEVSRLDELLKKGQANEVPDLKVVDASGIKEIEPNCAGLKALHSPHTGIVDWRLVALSYANDFKKSGGEIFLNFEVSEFNEAKESL-------DYPVELVAKNSKRVQSKYAIICGGLHADKLAVKSGCSDVPKIVPFRGDYLILKPDKKNMVRGNIYPVPDPRFPFLGVHFTPRMDGNVWLGPNAILAFKREGYGLLDFNLADTIDAIVFPGMLKIGAKHFTVGLKEMIGVAFISQQVKALKKFIPILTVNDVCRGPSGVRAQALNKDGGLVDDFVFHQGIGSIGSRLLHVRNAPSPAATSSMAIARMIVDKVDVDFKL 1384
            +D+AI+GGGIVGLA+AREL +RHP L   +LEKEK L++HQ+GHNSGVIH GIYYTPGSLKA+LCV G   +Y Y  KK +PY +CGKLIVA +  E+ RL  L ++GQ N V DL+++DA  I+E EP C G+ AL SP+TGIVDWR VAL+Y  DF+++GG +  ++E S+ + A ES         YP+ + +   K V+  + + CGGL++D+L+  SGCS  P+IVPFRGDYL+LKP+K  +VRGNIYPVP+PRFPFLGVHFTPRMDG+VWLGPNA+LAFKREGY L DF+  D ++A+ F G+ ++  K+   G+ E+    F   QVK L+KFIP L+ +DV RGPSGVRAQAL+ +G LVDDFVF  G G +GSR+LHVRNAPSPAA+SS+AIA MI D+++  F+L
Sbjct:   38 FDVAIIGGGIVGLASARELILRHPNLSFALLEKEKELALHQTGHNSGVIHTGIYYTPGSLKAQLCVRGATLAYEYCQKKGVPYNRCGKLIVAVDREEIPRLKALYERGQKNNVRDLRLIDAKAIREKEPYCRGIMALDSPYTGIVDWREVALAYGKDFQEAGGTVMTDYEASDMSVAAESQADSTNGQKYPIIIRSSQGKEVRCAFVLACGGLYSDRLSEMSGCSSEPRIVPFRGDYLVLKPEKNYLVRGNIYPVPNPRFPFLGVHFTPRMDGSVWLGPNAVLAFKREGYKLFDFDAQDFVNALSFSGLQRLVMKNVVYGVGEIYRGVFPGAQVKILQKFIPELSPSDVIRGPSGVRAQALDAEGNLVDDFVFDGGKGELGSRVLHVRNAPSPAASSSLAIAEMIADELEKRFQL 452          
BLAST of L-2-hydroxyglutarate dehydrogenase, mitochondrial vs. Ensembl Xenopus
Match: L2HGDH (L-2-hydroxyglutarate dehydrogenase [Source:NCBI gene;Acc:100145085])

HSP 1 Score: 474.552 bits (1220), Expect = 9.709e-164
Identity = 237/415 (57.11%), Postives = 306/415 (73.73%), Query Frame = 2
Query:  161 YDIAXXXXXXXXLATARELKIRHPKLKMCVLEKEKLLSMHQSGHNSGVIHAGIYYTPGSLKAKLCVEGLKSSYVYLDKKKIPYKKCGKLIVATNPLEVSRLDELLKKGQANEVPDLKVVDASGIKEIEPNCAGLKALHSPHTGIVDWRLVALSYANDFKKSGGEIFLNFEVSEFNEAKES-------LDYPVELVAKNSKRVQSKYAIICGGLHADKLAVKSGCSDVPKIVPFRGDYLILKPDKKNMVRGNIYPVPDPRFPFLGVHFTPRMDGNVWLGPNAILAFKREGYGLLDFNLADTIDAIVFPGMLKIGAKHFTVGLKEMIGVAFISQQVKALKKFIPILTVNDVCRGPSGVRAQALNKDGGLVDDFVFHQGIGSIGSRLLHVRNAPSPAATSSMAIARMIVDKVDVDFKL 1384
            YD+ +VGGGIVGLA+AR+L +RHP L+  VLEKEK +++HQSGHNSGVIH+GIYYTPGSLKA+LCV G    Y Y D+K IPYK+CGKLIVA    E+ RL  L ++G  N VP L+++ A  IKE EP C G+ AL SP+TGIV+++ VA SY +DF  +GG +  +FEV++     ES       ++YPV +     + V  KY + C GL +D+++  SGCS  P+IVPFRGDYL+LKP+K  +V+GNIYPVP+PRFPFLGVHFTPRMDG+VWLGPNAILAFKREGY L DFN  D  +A+ + G+ K+  K+ + G+ EM    F++ Q+K L+KFIP L+ ND+ RGPSGVRAQAL++DG LVDDFVF  G G + + +LHVRNAPSPAATSS+AI+ MI  +V+  F L
Sbjct:   39 YDVVVVGGGIVGLASARQLILRHPALRFAVLEKEKEIALHQSGHNSGVIHSGIYYTPGSLKARLCVRGAALIYEYCDQKGIPYKQCGKLIVAVKQPEIPRLQALYERGLQNNVPGLRLIGAKDIKEKEPYCRGVMALESPYTGIVNYKQVAQSYKDDFCDAGGSVLTDFEVTDIKMVNESPAGSVQGIEYPVAIKNNKGEEVHCKYVLTCAGLFSDRVSQVSGCSAEPRIVPFRGDYLVLKPEKCYLVKGNIYPVPNPRFPFLGVHFTPRMDGSVWLGPNAILAFKREGYRLCDFNARDFKEAVTYSGLHKLVLKNLSYGMGEMYRAFFLNAQLKELQKFIPELSFNDIARGPSGVRAQALDRDGNLVDDFVFDGGSGDLANCILHVRNAPSPAATSSLAISEMIASEVEERFGL 453          
BLAST of L-2-hydroxyglutarate dehydrogenase, mitochondrial vs. Ensembl Xenopus
Match: L2HGDH (L-2-hydroxyglutarate dehydrogenase [Source:NCBI gene;Acc:100145085])

HSP 1 Score: 445.277 bits (1144), Expect = 1.725e-152
Identity = 218/397 (54.91%), Postives = 283/397 (71.28%), Query Frame = 2
Query:  215 LKIRHPKLKMCVLEKEKLLSMHQSGHNSGVIHAGIYYTPGSLKAKLCVEGLKSSYVYLDKKKIPYKKCGKLIVATNPLEVSRLDELLKKGQANEVPDLKVVDASGIKEIEPNCAGLKALHSPHTGIVDWRLVALSYANDFKKSGGEIFLNFEVSEFNEAKES-------LDYPVELVAKNSKRVQSKYAIICGGLHADKLAVKSGCSDVPKIVPFRGDYLILKPDKKNMVRGNIYPVPDPRFPFLGVHFTPRMDGNVWLGPNAILAFKREGYGLLDFNLADTIDAIVFPGMLKIGAKHFTVGLKEMIGVAFISQQVKALKKFIPILTVNDVCRGPSGVRAQALNKDGGLVDDFVFHQGIGSIGSRLLHVRNAPSPAATSSMAIARMIVDKVDVDFKL 1384
            L+I  P L   ++  +   S+HQSGHNSGVIH+GIYYTPGSLKA+LCV G    Y Y D+K IPYK+CGKLIVA    E+ RL  L ++G  N VP L+++ A  IKE EP C G+ AL SP+TGIV+++ VA SY +DF  +GG +  +FEV++     ES       ++YPV +     + V  KY + C GL +D+++  SGCS  P+IVPFRGDYL+LKP+K  +V+GNIYPVP+PRFPFLGVHFTPRMDG+VWLGPNAILAFKREGY L DFN  D  +A+ + G+ K+  K+ + G+ EM    F++ Q+K L+KFIP L+ ND+ RGPSGVRAQAL++DG LVDDFVF  G G + + +LHVRNAPSPAATSS+AI+ MI  +V+  F L
Sbjct:   43 LQIFTPHLFYVLIHYD---SLHQSGHNSGVIHSGIYYTPGSLKARLCVRGAALIYEYCDQKGIPYKQCGKLIVAVKQPEIPRLQALYERGLQNNVPGLRLIGAKDIKEKEPYCRGVMALESPYTGIVNYKQVAQSYKDDFCDAGGSVLTDFEVTDIKMVNESPAGSVQGIEYPVAIKNNKGEEVHCKYVLTCAGLFSDRVSQVSGCSAEPRIVPFRGDYLVLKPEKCYLVKGNIYPVPNPRFPFLGVHFTPRMDGSVWLGPNAILAFKREGYRLCDFNARDFKEAVTYSGLHKLVLKNLSYGMGEMYRAFFLNAQLKELQKFIPELSFNDIARGPSGVRAQALDRDGNLVDDFVFDGGSGDLANCILHVRNAPSPAATSSLAISEMIASEVEERFGL 436          
BLAST of L-2-hydroxyglutarate dehydrogenase, mitochondrial vs. Ensembl Xenopus
Match: L2HGDH (L-2-hydroxyglutarate dehydrogenase [Source:NCBI gene;Acc:100145085])

HSP 1 Score: 390.193 bits (1001), Expect = 8.280e-132
Identity = 195/351 (55.56%), Postives = 255/351 (72.65%), Query Frame = 2
Query:  161 YDIAXXXXXXXXLATARELKIRHPKLKMCVLEKEKLLSMHQSGHNSGVIHAGIYYTPGSLKAKLCVEGLKSSYVYLDKKKIPYKKCGKLIVATNPLEVSRLDELLKKGQANEVPDLKVVDASGIKEIEPNCAGLKALHSPHTGIVDWRLVALSYANDFKKSGGEIFLNFEVSEFNEAKES-------LDYPVELVAKNSKRVQSKYAIICGGLHADKLAVKSGCSDVPKIVPFRGDYLILKPDKKNMVRGNIYPVPDPRFPFLGVHFTPRMDGNVWLGPNAILAFKREGYGLLDFNLADTIDAIVFPGMLKIGAKHFTVGLKEMIGVAFISQQVKALKKFIPILTVNDVCR 1192
            YD+ +VGGGIVGLA+AR+L +RHP L+  VLEKEK +++HQSGHNSGVIH+GIYYTPGSLKA+LCV G    Y Y D+K IPYK+CGKLIVA    E+ RL  L ++G  N VP L+++ A  IKE EP C G+ AL SP+TGIV+++ VA SY +DF  +GG +  +FEV++     ES       ++YPV +     + V  KY + C GL +D+++  SGCS  P+IVPFRGDYL+LKP+K  +V+GNIYPVP+PRFPFLGVHFTPRMDG+VWLGPNAILAFKREGY L DFN  D  +A+ + G+ K+  K+ + G+ EM    F++ Q+K L+KFIP L+ ND+ R
Sbjct:   11 YDVVVVGGGIVGLASARQLILRHPALRFAVLEKEKEIALHQSGHNSGVIHSGIYYTPGSLKARLCVRGAALIYEYCDQKGIPYKQCGKLIVAVKQPEIPRLQALYERGLQNNVPGLRLIGAKDIKEKEPYCRGVMALESPYTGIVNYKQVAQSYKDDFCDAGGSVLTDFEVTDIKMVNESPAGSVQGIEYPVAIKNNKGEEVHCKYVLTCAGLFSDRVSQVSGCSAEPRIVPFRGDYLVLKPEKCYLVKGNIYPVPNPRFPFLGVHFTPRMDGSVWLGPNAILAFKREGYRLCDFNARDFKEAVTYSGLHKLVLKNLSYGMGEMYRAFFLNAQLKELQKFIPELSFNDIAR 361          
BLAST of L-2-hydroxyglutarate dehydrogenase, mitochondrial vs. Ensembl Mouse
Match: L2hgdh (L-2-hydroxyglutarate dehydrogenase [Source:MGI Symbol;Acc:MGI:2384968])

HSP 1 Score: 457.218 bits (1175), Expect = 8.338e-157
Identity = 217/403 (53.85%), Postives = 293/403 (72.70%), Query Frame = 2
Query:  197 LATARELKIRHPKLKMCVLEKEKLLSMHQSGHNSGVIHAGIYYTPGSLKAKLCVEGLKSSYVYLDKKKIPYKKCGKLIVATNPLEVSRLDELLKKGQANEVPDLKVVDASGIKEIEPNCAGLKALHSPHTGIVDWRLVALSYANDFKKSGGEIFLNFEVSEFNEAKES-------LDYPVELVAKNSKRVQSKYAIICGGLHADKLAVKSGCSDVPKIVPFRGDYLILKPDKKNMVRGNIYPVPDPRFPFLGVHFTPRMDGNVWLGPNAILAFKREGYGLLDFNLADTIDAIVFPGMLKIGAKHFTVGLKEMIGVAFISQQVKALKKFIPILTVNDVCRGPSGVRAQALNKDGGLVDDFVFHQGIGSIGSRLLHVRNAPSPAATSSMAIARMIVDKVDVDFKL 1384
            LA+AR L ++HP L + V+EKEK L++HQ+GHNSGVIH+GIYY P SLKAKLCVEG    Y Y + K IPY++CGKLIVA    E+ RL  L ++G  N V  L+++    IK+ EP C GL A+  P+TGIV+++ VALS+A DF+++GG I  +FEV     AKE+       ++YP+ +     K ++ +Y + C GL++D+++  SGC+  P+IVPFRGDYL+LKP+K  +V+GNIYPVPD RFPFLGVHFTPR+DG +WLGPNA+LAFKREGY   DF+  D ++ I+  G + +  +HF+ G+ EM    F+S+ VK L+KFIP +T++DV RGP+GVRAQAL++DG LV+DFVF  G G I  R+LHVRNAPSPAATSS+AI+RMI ++    FKL
Sbjct:   62 LASARTLILKHPGLSIGVVEKEKDLALHQTGHNSGVIHSGIYYKPESLKAKLCVEGAALIYEYCNLKGIPYRQCGKLIVAVEQEEIPRLQALYERGLQNGVEGLRLIQQEDIKKKEPYCRGLMAIDCPYTGIVNYQQVALSFAQDFQEAGGSILRDFEVKGIEIAKENSSRSKDGMNYPIAVKNSKGKEIRCRYVVTCAGLYSDRISELSGCNPDPQIVPFRGDYLVLKPEKGYLVKGNIYPVPDSRFPFLGVHFTPRLDGTIWLGPNAVLAFKREGYRPFDFDARDVMEVILKSGFINLVFQHFSYGVNEMYKACFLSETVKHLQKFIPEITISDVLRGPAGVRAQALDRDGNLVEDFVFDGGTGEIADRVLHVRNAPSPAATSSLAISRMIAEEAQQRFKL 464          
BLAST of L-2-hydroxyglutarate dehydrogenase, mitochondrial vs. UniProt/SwissProt
Match: sp|A7SMW7|L2HDH_NEMVE (L-2-hydroxyglutarate dehydrogenase, mitochondrial OS=Nematostella vectensis OX=45351 GN=v1g172254 PE=3 SV=1)

HSP 1 Score: 527.709 bits (1358), Expect = 0.000e+0
Identity = 264/422 (62.56%), Postives = 323/422 (76.54%), Query Frame = 2
Query:  146 QPKLEYDIAXXXXXXXXLATARELKIRHPKLKMCVLEKEKLLSMHQSGHNSGVIHAGIYYTPGSLKAKLCVEGLKSSYVYLDKKKIPYKKCGKLIVATNPLEVSRLDELLKKGQANEVPDLKVVDASGIKEIEPNCAGLKALHSPHTGIVDWRLVALSYANDFKKSGGEIFLNFEVSEFNEAKES---------LDYPVELVAKNSKRVQSKYAIICGGLHADKLAVKSGCSDVPKIVPFRGDYLILKPDKKNMVRGNIYPVPDPRFPFLGVHFTPRMDGNVWLGPNAILAFKREGYGLLDFNLADTIDAIVFPGMLKIGAKHFTVGLKEMIGVAFISQQVKALKKFIPILTVNDVCRGPSGVRAQALNKDGGLVDDFVFHQGIGSIGSRLLHVRNAPSPAATSSMAIARMIVDKVDVDFKL 1384
            QP   YD+AIVGGGIVGLATAREL +RHPKL  CVLEKEK LSMHQSGHNSGVIH GIYYTPGSLKAKLCV+GL  +Y Y D+  IPYKKCGKLIVA    E+  L+ L ++G+ N V DL +VD  GIKEIEP+C G+ A+ SP+TGIVDW  VAL+Y +DF+K GG+IF  +EV++F  A ES         L +PV + + N + ++ +Y I CGGL++D+LA KSGC+  P+IVPFRGDYL+LKP+K ++V+GNIYPVPDP FPFLGVHFTPRMDG+VWLGPNA+LAF REGY LLD NL D  DA+ F G+ ++  K+F+ G+ E       + QVK L+K+IP +T +DV  GPSGVRAQAL++DG LVDDFVF  G+G IGSR+LHVRNAPSPAATSS+AIARM+ DK    F L
Sbjct:   35 QPSEHYDVAIVGGGIVGLATARELILRHPKLTFCVLEKEKELSMHQSGHNSGVIHCGIYYTPGSLKAKLCVQGLDLTYQYCDEHNIPYKKCGKLIVAVEDKEIPLLNNLYERGKKNGVKDLTMVDKRGIKEIEPHCEGMFAIVSPNTGIVDWAQVALAYGDDFRKGGGDIFTGYEVTDFKCASESGKSQEKEAGLTHPVTVFSNNKQTIKCRYVITCGGLYSDRLAEKSGCNREPRIVPFRGDYLVLKPEKCHLVKGNIYPVPDPNFPFLGVHFTPRMDGSVWLGPNAVLAFAREGYNLLDINLRDLADALAFRGLRQLMFKYFSFGVGEYYRGLNHAAQVKQLQKYIPSVTADDVVSGPSGVRAQALDRDGNLVDDFVFDGGVGEIGSRVLHVRNAPSPAATSSLAIARMVADKAAERFTL 456          
BLAST of L-2-hydroxyglutarate dehydrogenase, mitochondrial vs. UniProt/SwissProt
Match: sp|A8X2R1|L2HDH_CAEBR (L-2-hydroxyglutarate dehydrogenase, mitochondrial OS=Caenorhabditis briggsae OX=6238 GN=CBG06643 PE=3 SV=2)

HSP 1 Score: 473.781 bits (1218), Expect = 5.482e-163
Identity = 234/410 (57.07%), Postives = 306/410 (74.63%), Query Frame = 2
Query:  158 EYDIAXXXXXXXXLATARELKIRHPKLKMCVLEKEKLLSMHQSGHNSGVIHAGIYYTPGSLKAKLCVEGLKSSYVYLDKKKIPYKKCGKLIVATNPLEVSRLDELLKKGQANEVPDLKVVDASGIKEIEPNCAGLKALHSPHTGIVDWRLVALSYANDFKKSGGEIFLNFEVSEFNEAKESLDYPVELVAKNS-KRVQSKYAIICGGLHADKLAVKSGCSDVPKIVPFRGDYLILKPDKKNMVRGNIYPVPDPRFPFLGVHFTPRMDGNVWLGPNAILAFKREGYGLLDFNLADTIDAIVFPGMLKIGAKHFTVGLKEMIGVAFISQQVKALKKFIPILTVNDVCRGPSGVRAQALNKDGGLVDDFVFHQGIGSIGSRLLHVRNAPSPAATSSMAIARMIVDKVDVDFKL 1384
            +YD+ IVGGGIVG ATAR+L I  P LK+ ++EKEK L++HQSGHNSGVIHAGIYYTPGSLKAKLCVEGL  SY + DK+KIPYKK GKLIVA    EV RLD L  + Q N   D++++D+  I +IEP+C GLKAL SPHTGIVDW  V   +  DF+K GG+I+ ++ + +  +  +  +YP+ + +  S    ++K  I C GL +D++A  SGCS  PKIVPFRG+YL+LKP+K+++V+ NIYPVPDPRFPFLGVHFTPRM+G++WLGPNA+LA+KREGY     + +D ++++ + GM K+  KHFT G+KE+    +I+ QVK L++FIP L  +DV RGPSGVRAQA++  G LVDDFVF  G G + S ++HVRNAPSPAATSS+AIA+MI  +    FKL
Sbjct:   25 KYDLVIVGGGIVGCATARQLLIEKPNLKIALVEKEKELAVHQSGHNSGVIHAGIYYTPGSLKAKLCVEGLDLSYEFFDKEKIPYKKTGKLIVAVEQEEVPRLDALFARAQTNGCRDIEMIDSKRITDIEPHCKGLKALWSPHTGIVDWGYVTKKFGEDFEKRGGKIYTSYPLEKIEDNLKDSNYPIRVSSDPSYADFETKNLITCAGLQSDRVAALSGCSTDPKIVPFRGEYLLLKPEKRHLVKTNIYPVPDPRFPFLGVHFTPRMNGDIWLGPNAVLAYKREGYSYFSISPSDLLESLSYSGMQKLVKKHFTFGIKELYRGIWIAAQVKQLQRFIPELKYSDVTRGPSGVRAQAMDSAGNLVDDFVFDSGTGKLSSLIMHVRNAPSPAATSSLAIAKMITSEAITRFKL 434          
BLAST of L-2-hydroxyglutarate dehydrogenase, mitochondrial vs. UniProt/SwissProt
Match: sp|Q9H9P8|L2HDH_HUMAN (L-2-hydroxyglutarate dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=L2HGDH PE=1 SV=3)

HSP 1 Score: 474.552 bits (1220), Expect = 6.787e-163
Identity = 224/403 (55.58%), Postives = 297/403 (73.70%), Query Frame = 2
Query:  197 LATARELKIRHPKLKMCVLEKEKLLSMHQSGHNSGVIHAGIYYTPGSLKAKLCVEGLKSSYVYLDKKKIPYKKCGKLIVATNPLEVSRLDELLKKGQANEVPDLKVVDASGIKEIEPNCAGLKALHSPHTGIVDWRLVALSYANDFKKSGGEIFLNFEVSEFNEAKES-------LDYPVELVAKNSKRVQSKYAIICGGLHADKLAVKSGCSDVPKIVPFRGDYLILKPDKKNMVRGNIYPVPDPRFPFLGVHFTPRMDGNVWLGPNAILAFKREGYGLLDFNLADTIDAIVFPGMLKIGAKHFTVGLKEMIGVAFISQQVKALKKFIPILTVNDVCRGPSGVRAQALNKDGGLVDDFVFHQGIGSIGSRLLHVRNAPSPAATSSMAIARMIVDKVDVDFKL 1384
            LA+AR L +RHP L + VLEKEK L++HQ+GHNSGVIH+GIYY P SLKAKLCV+G    Y Y  +K I YK+CGKLIVA    E+ RL  L +KG  N VP L+++    IK+ EP C GL A+  PHTGIVD+R VALS+A DF+++GG +  NFEV     AKES       + YP+ +     + ++ +Y + C GL++D+++  SGC+  P+IVPFRGDYL+LKP+K  +V+GNIYPVPD RFPFLGVHFTPRMDG++WLGPNA+LAFKREGY   DF+  D +D I+  G++K+ +++F+ G+ EM    F+   VK L+KFIP +T++D+ RGP+GVRAQAL++DG LV+DFVF  G+G IG+R+LHVRNAPSPAATSS+AI+ MI D+V   F+L
Sbjct:   61 LASARALILRHPSLSIGVLEKEKDLAVHQTGHNSGVIHSGIYYKPESLKAKLCVQGAALLYEYCQQKGISYKQCGKLIVAVEQEEIPRLQALYEKGLQNGVPGLRLIQQEDIKKKEPYCRGLMAIDCPHTGIVDYRQVALSFAQDFQEAGGSVLTNFEVKGIEMAKESPSRSIDGMQYPIVIKNTKGEEIRCQYVVTCAGLYSDRISELSGCTPDPRIVPFRGDYLLLKPEKCYLVKGNIYPVPDSRFPFLGVHFTPRMDGSIWLGPNAVLAFKREGYRPFDFSATDVMDIIINSGLIKLASQNFSYGVTEMYKACFLGATVKYLQKFIPEITISDILRGPAGVRAQALDRDGNLVEDFVFDAGVGDIGNRILHVRNAPSPAATSSIAISGMIADEVQQRFEL 463          
BLAST of L-2-hydroxyglutarate dehydrogenase, mitochondrial vs. UniProt/SwissProt
Match: sp|Q9N4Z0|L2HDH_CAEEL (L-2-hydroxyglutarate dehydrogenase, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=Y45G12B.3 PE=3 SV=2)

HSP 1 Score: 472.241 bits (1214), Expect = 2.020e-162
Identity = 233/410 (56.83%), Postives = 309/410 (75.37%), Query Frame = 2
Query:  158 EYDIAXXXXXXXXLATARELKIRHPKLKMCVLEKEKLLSMHQSGHNSGVIHAGIYYTPGSLKAKLCVEGLKSSYVYLDKKKIPYKKCGKLIVATNPLEVSRLDELLKKGQANEVPDLKVVDASGIKEIEPNCAGLKALHSPHTGIVDWRLVALSYANDFKKSGGEIFLNFEVSEFNEAKESLDYPVELVAKNS-KRVQSKYAIICGGLHADKLAVKSGCSDVPKIVPFRGDYLILKPDKKNMVRGNIYPVPDPRFPFLGVHFTPRMDGNVWLGPNAILAFKREGYGLLDFNLADTIDAIVFPGMLKIGAKHFTVGLKEMIGVAFISQQVKALKKFIPILTVNDVCRGPSGVRAQALNKDGGLVDDFVFHQGIGSIGSRLLHVRNAPSPAATSSMAIARMIVDKVDVDFKL 1384
            +YD+ IVGGGIVG ATAR+L I  P+LK+ ++EKEK L++HQSGHNSGVIHAGIYYTPGSLKAKLCVEGL  SY + DK+K+PYKK GKLIVA  P EV RLD L  + Q N   D++++D+S I E+EP+C GLKAL SPHTGIVDW  V   +  DF+K GG+I+ ++ + + ++  +   YP+ + +  +    ++K  I C GL +D++A  SGCS  PKIVPFRG+YL+LKP+K+++V+ NIYPVPDPRFPFLGVHFTPRM+G++WLGPNA+LA+KREGY     + +D ++++ + GM K+  KHFT G+KE+    +I+ QVK L++FIP L ++DV RGP+GVRAQA++  G LVDDFVF  G G +   L+HVRNAPSPAATSS+AIA+MI  +    FKL
Sbjct:   25 KYDLVIVGGGIVGCATARQLLIEKPQLKVALIEKEKELAVHQSGHNSGVIHAGIYYTPGSLKAKLCVEGLDLSYEFFDKEKVPYKKTGKLIVAVEPEEVPRLDALFSRAQTNGCRDIEMIDSSKITELEPHCRGLKALWSPHTGIVDWGYVTKRFGEDFEKRGGKIYTSYPLEKISDNHDP-GYPIRVSSGPALAEFETKNLITCAGLQSDRVAALSGCSTDPKIVPFRGEYLLLKPEKRHLVKTNIYPVPDPRFPFLGVHFTPRMNGDIWLGPNAVLAYKREGYSYFSISPSDLLESLSYSGMQKLVKKHFTFGIKELYRGVWIAAQVKQLQRFIPELKLSDVTRGPAGVRAQAMDSAGNLVDDFVFDSGTGKLSPLLMHVRNAPSPAATSSLAIAKMITSEAINRFKL 433          
BLAST of L-2-hydroxyglutarate dehydrogenase, mitochondrial vs. UniProt/SwissProt
Match: sp|A7MBI3|L2HDH_BOVIN (L-2-hydroxyglutarate dehydrogenase, mitochondrial OS=Bos taurus OX=9913 GN=L2HGDH PE=2 SV=1)

HSP 1 Score: 471.855 bits (1213), Expect = 8.287e-162
Identity = 224/403 (55.58%), Postives = 298/403 (73.95%), Query Frame = 2
Query:  197 LATARELKIRHPKLKMCVLEKEKLLSMHQSGHNSGVIHAGIYYTPGSLKAKLCVEGLKSSYVYLDKKKIPYKKCGKLIVATNPLEVSRLDELLKKGQANEVPDLKVVDASGIKEIEPNCAGLKALHSPHTGIVDWRLVALSYANDFKKSGGEIFLNFEVSEFNEAKES-------LDYPVELVAKNSKRVQSKYAIICGGLHADKLAVKSGCSDVPKIVPFRGDYLILKPDKKNMVRGNIYPVPDPRFPFLGVHFTPRMDGNVWLGPNAILAFKREGYGLLDFNLADTIDAIVFPGMLKIGAKHFTVGLKEMIGVAFISQQVKALKKFIPILTVNDVCRGPSGVRAQALNKDGGLVDDFVFHQGIGSIGSRLLHVRNAPSPAATSSMAIARMIVDKVDVDFKL 1384
            LA+AR L +RHP L + VLEKEK L++HQ+GHNSGVIH+GIYY P SLKAKLCV+G    Y Y ++K I YK+CGKLIVA    E+ RL  L ++G  N V  L+++    IK+ EP C GL A+  P+TGIVD+R VA S+A DF+++GG +  NFEV +   A+ES       + YP+ +     + V+ +Y + C GL++D+++  SGC+  P+IVPFRGDYL+LKP+K+ +V+GNIYPVPD RFPFLGVHFTPRMDGN+WLGPNAILAFKREGY   DF+  D +D I+  G++K+  ++F+ G+ EM    F+S  VK L+KFIP +T++DV RGP+GVRAQAL++DG L++DFVF  G+G IG+R+LHVRNAPSPAATSS+AI+ MI D+V   FKL
Sbjct:   61 LASARALILRHPALSIGVLEKEKNLAVHQTGHNSGVIHSGIYYKPESLKAKLCVQGAALIYEYCNQKGISYKQCGKLIVAVEQEEIPRLQALYERGLQNGVQGLRLIQQEDIKKKEPYCRGLMAIDCPYTGIVDYRQVAFSFAKDFQEAGGSVLTNFEVEDIEMARESPSRSKDGMKYPIVIRNTKGEEVRCQYVVTCAGLYSDRISELSGCNPNPRIVPFRGDYLVLKPEKRYLVKGNIYPVPDSRFPFLGVHFTPRMDGNIWLGPNAILAFKREGYRPFDFSARDIMDIIIKSGLIKLVFQNFSYGVNEMYKACFLSATVKHLQKFIPEITISDVLRGPAGVRAQALDRDGNLIEDFVFDGGVGDIGNRILHVRNAPSPAATSSLAISGMIADEVQQRFKL 463          
BLAST of L-2-hydroxyglutarate dehydrogenase, mitochondrial vs. TrEMBL
Match: A0A0L8IEP4 (DAO domain-containing protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22010252mg PE=4 SV=1)

HSP 1 Score: 542.732 bits (1397), Expect = 0.000e+0
Identity = 266/410 (64.88%), Postives = 321/410 (78.29%), Query Frame = 2
Query:  146 QPKLEYDIAXXXXXXXXLATARELKIRHPKLKMCVLEKEKLLSMHQSGHNSGVIHAGIYYTPGSLKAKLCVEGLKSSYVYLDKKKIPYKKCGKLIVATNPLEVSRLDELLKKGQANEVPDLKVVDASGIKEIEPNCAGLKALHSPHTGIVDWRLVALSYANDFKKSGGEIFLNFEVSEFNEAKESLDYPVELVA--KNSKRVQSKYAIICGGLHADKLAVKSGCSDVPKIVPFRGDYLILKPDKKNMVRGNIYPVPDPRFPFLGVHFTPRMDGNVWLGPNAILAFKREGYGLLDFNLADTIDAIVFPGMLKIGAKHFTVGLKEMIGVAFISQQVKALKKFIPILTVNDVCRGPSGVRAQALNKDGGLVDDFVFHQGIGSIGSRLLHVRNAPSPAATSSMAIARMIVDKVD 1369
             PK EYDI IVGGGI+GLATAREL +RHP L   VLEKEK L+ HQSG+NSGVIHAGIYYTPGSLKAKLCVEG   +Y Y D+  IPYK+CGKLIVATNP E+SRLD L ++GQ N V  +++V    IK+IEPNC GL+A+HSPHTGIVDWR VALSY  +FKK GG IF +F  ++F+ + E+L YPV ++   K  + +Q +Y I CGGL++D+LA K+GC   P+IVPFRGDYL+LKP K +MVRGNIYPVPDPRFPFLGVHFTPR+DG+VWLGPNA+LAFKREGY    F+  D IDA+ + G+ KI  K+ + GL EM    FIS QVK L++FIP L + DV RGPSGVRAQAL+KDG LVDDFVF  G G +  R+LHVRNAPSPAATSS+AI+R++ D+VD
Sbjct:   41 NPKKEYDIVIVGGGIIGLATARELILRHPNLSFAVLEKEKELAKHQSGNNSGVIHAGIYYTPGSLKAKLCVEGFHKAYKYCDENNIPYKECGKLIVATNPEELSRLDNLYERGQKNNVKGMRMVGPKEIKDIEPNCVGLRAIHSPHTGIVDWRQVALSYGENFKKCGGHIFTDFAANKFSMSTENLKYPVTVMGDVKKGQAIQCQYLITCGGLYSDRLAEKTGCDRKPRIVPFRGDYLLLKPHKSDMVRGNIYPVPDPRFPFLGVHFTPRVDGSVWLGPNAVLAFKREGYTFFSFSAKDMIDALSYSGLRKIAMKNLSFGLNEMYRGLFISAQVKQLQRFIPSLKLEDVIRGPSGVRAQALDKDGNLVDDFVFDSGTGDMSKRILHVRNAPSPAATSSLAISRIVADQVD 450          
BLAST of L-2-hydroxyglutarate dehydrogenase, mitochondrial vs. TrEMBL
Match: A0A1S3J4V7 (L-2-hydroxyglutarate dehydrogenase, mitochondrial-like OS=Lingula unguis OX=7574 GN=LOC106169805 PE=4 SV=2)

HSP 1 Score: 534.258 bits (1375), Expect = 0.000e+0
Identity = 265/412 (64.32%), Postives = 319/412 (77.43%), Query Frame = 2
Query:  161 YDIAXXXXXXXXLATARELKIRHPKLKMCVLEKEKLLSMHQSGHNSGVIHAGIYYTPGSLKAKLCVEGLKSSYVYLDKKKIPYKKCGKLIVATNPLEVSRLDELLKKGQANEVPDLKVVDASGIKEIEPNCAGLKALHSPHTGIVDWRLVALSYANDFKKSGGEIFLNFEVSEFNEAKESLD---YPVELVAKN-SKRVQSKYAIICGGLHADKLAVKSGCSDVPKIVPFRGDYLILKPDKKNMVRGNIYPVPDPRFPFLGVHFTPRMDGNVWLGPNAILAFKREGYGLLDFNLADTIDAIVFPGMLKIGAKHFTVGLKEMIGVAFISQQVKALKKFIPILTVNDVCRGPSGVRAQALNKDGGLVDDFVFHQGIGSIGSRLLHVRNAPSPAATSSMAIARMIVDKVDVDFKL 1384
            YDI IVGGG+VGL TAR+L + HP+LK+ V+EKE +L+ HQSG NSGVIHAGIYYTPGSLKAKLCV+GL  +Y Y D+  IPYKKCGKLIVAT P EVSRLD L  +GQ N V DLK+V    I+EIEPNC GL+ALHSPHTGIVDW LV  SY   F+  GG+I+ NFEV EF   KE  D   YPV ++ K  S  +QSK+ I+CGGL++D+LA  SGC+  PKIVPFRGDYL+LKP+K+++VRGNIYPVP+P FPFLGVHFTPR+DG+VWLGPNA+LAFKREGY LLDFN  D +DA  + G+ K+  KH   G+ EM     I   VK L+KF+P +T+ DV RGPSGVRAQAL++DG LVDDFVF  G G + SR+LHVRNAPSPAATSS+AIA+M+ DK   +F+L
Sbjct:   50 YDIVIVGGGVVGLGTARQLALNHPQLKLAVVEKENILAAHQSGKNSGVIHAGIYYTPGSLKAKLCVDGLNLTYKYCDENNIPYKKCGKLIVATTPEEVSRLDNLYDRGQKNNVKDLKIVGPEEIREIEPNCRGLRALHSPHTGIVDWGLVTRSYGKTFENLGGQIYTNFEVKEFTATKEDGDGIQYPVTILGKEKSTPLQSKFVIVCGGLYSDRLAKMSGCNPEPKIVPFRGDYLLLKPEKRDLVRGNIYPVPNPLFPFLGVHFTPRIDGDVWLGPNAVLAFKREGYKLLDFNFKDFVDAASYRGLRKLAMKHLAYGIGEMYRGFNIRATVKQLQKFVPSITIKDVTRGPSGVRAQALDRDGQLVDDFVFDSGEGELASRMLHVRNAPSPAATSSLAIAKMVADKAKENFEL 461          
BLAST of L-2-hydroxyglutarate dehydrogenase, mitochondrial vs. TrEMBL
Match: T1FEW0 (DAO domain-containing protein OS=Helobdella robusta OX=6412 GN=20207359 PE=4 SV=1)

HSP 1 Score: 534.258 bits (1375), Expect = 0.000e+0
Identity = 277/460 (60.22%), Postives = 336/460 (73.04%), Query Frame = 2
Query:   38 MLKSLLNKKPLNCVKS----VVLFERYFSDNFELDLFKPHQPKL-EYDIAXXXXXXXXLATARELKIRHPKLKMCVLEKEKLLSMHQSGHNSGVIHAGIYYTPGSLKAKLCVEGLKSSYVYLDKKKIPYKKCGKLIVATNPLEVSRLDELLKKGQANEVPDLKVVDASGIKEIEPNCAGLKALHSPHTGIVDWRLVALSYANDFKKSGGEIFLNFEVSEFNEAKESLDYPVELVAKN------SKRVQSKYAIICGGLHADKLAVKSGCSDVPKIVPFRGDYLILKPDKKNMVRGNIYPVPDPRFPFLGVHFTPRMDGNVWLGPNAILAFKREGYGLLDFNLADTIDAIVFPGMLKIGAKHFTVGLKEMIGVAFISQQVKALKKFIPILTVNDVCRGPSGVRAQALNKDGGLVDDFVFHQGIGSIGSRLLHVRNAPSPAATSSMAIARMIVDKVDVDFKL 1384
            M++++     LNC  S     ++  +  S++F     K     + EYD+ IVG GIVG+ATA+EL  R+P LK   ++KE +++ HQSGHNSGVIHAGIYYTPGSLKAKLCVEGLK SY YLD   IPY+KCGKLIVATNP EV RLD L  +G  NEVPDLKVV    IK+IEPNC GLKALHSPHTGIVDW  V   Y  +F+KSGG I LNFEV+ F EAK+S DYPV +   +      S  V++KY I CGGL+ADKLA KSGC  VPKIVPFRG+YL+LKP+K+N+V GNIYP PDP+FPFLGVHFTPR++G+VWLGPNA+LAFKREGY LLDF+  +  DAI F G+ K+   +      E+    + + QVK L++F+P L V DV +GPSGVRAQAL+  G LVDDFVF  G GSIGSR+LHVRNAPSPAATSS+AIA+++ DK    FKL
Sbjct:    1 MIRNVSKLTALNCKHSGPICKLILGKDASNDFTSTQCKQFSTNIPEYDVCIVGTGIVGMATAQELIKRYPSLKFISVDKESVIAAHQSGHNSGVIHAGIYYTPGSLKAKLCVEGLKLSYKYLDANNIPYRKCGKLIVATNPEEVKRLDVLHDRGIKNEVPDLKVVGPDEIKQIEPNCVGLKALHSPHTGIVDWGYVTTIYGKNFEKSGGTIKLNFEVTNFEEAKDSPDYPVLVTGHSTSVVGLSSSVRAKYVITCGGLYADKLAQKSGCDPVPKIVPFRGEYLLLKPEKRNLVNGNIYPCPDPKFPFLGVHFTPRINGDVWLGPNAVLAFKREGYKLLDFSPTEFFDAIAFSGLRKLVFSNLNYAFGELYRGVYTAAQVKVLQRFVPSLRVEDVVKGPSGVRAQALDTSGKLVDDFVFDSGTGSIGSRMLHVRNAPSPAATSSLAIAKVVADKAKEVFKL 460          
BLAST of L-2-hydroxyglutarate dehydrogenase, mitochondrial vs. TrEMBL
Match: A0A3S1H4X7 (DAO domain-containing protein (Fragment) OS=Elysia chlorotica OX=188477 GN=EGW08_019960 PE=4 SV=1)

HSP 1 Score: 531.176 bits (1367), Expect = 0.000e+0
Identity = 263/418 (62.92%), Postives = 323/418 (77.27%), Query Frame = 2
Query:  158 EYDIAXXXXXXXXLATARELKIRHPKLKMCVLEKEKLLSMHQSGHNSGVIHAGIYYTPGSLKAKLCVEGLKSSYVYLDKKKIPYKKCGKLIVATNPLEVSRLDELLKKGQANEVPDLKVVDASGIKEIEPNCAGLKALHSPHTGIVDWRLVALSYANDFKKSGGEIFLNFEVSEFN---EAKES----LDYPVELVA--KNSKRVQSKYAIICGGLHADKLAVKSGCSDVPKIVPFRGDYLILKPDKKNMVRGNIYPVPDPRFPFLGVHFTPRMDGNVWLGPNAILAFKREGYGLLDFNLADTIDAIVFPGMLKIGAKHFTVGLKEMIGVAFISQQVKALKKFIPILTVNDVCRGPSGVRAQALNKDGGLVDDFVFHQGIGSIGSRLLHVRNAPSPAATSSMAIARMIVDKVDVDFKL 1384
            +YD+ IVGGGIVG ATA+EL  RHP+L++ VLEKE  L+ HQSGHNSGVIHAGIYYTPGSLKAKLCV+GLK +Y Y DK  IPYKKCGKLIVA +P E+ RLD LL++GQ N VPDL++V   GIK+IEPNC GLKA+HSPHTGI+DW LV   Y   F+  GG+++ NF VS+F    E+KE+    L +PVE+++  K S  + S+Y + CGGLH+D+LA KSGC   P+IVPFRG+YL+L P+K ++VRGNIYPVPDPRFPFLGVHFTPR DG+VWLGPNA+LAFKREGYG L F++ D  DA+ F G+ K+  +HF  GLKEM    +I  QVK L++++P L   DV RGPSGVRAQAL++DG LVDDFVF  G   +G R+LHVRNAPSPAATSS+AIA M+ D V+  F L
Sbjct:   86 QYDLVIVGGGIVGTATAQELITRHPQLRLAVLEKESELAAHQSGHNSGVIHAGIYYTPGSLKAKLCVKGLKMTYAYCDKHNIPYKKCGKLIVALDPEELPRLDGLLERGQQNGVPDLRMVGPDGIKDIEPNCVGLKAIHSPHTGIIDWGLVTKHYGKQFEAQGGKVYTNFNVSKFGLKAESKENSSDGLTHPVEIISSSKESPVISSRYVVTCGGLHSDRLAEKSGCDPEPRIVPFRGEYLLLSPEKSDLVRGNIYPVPDPRFPFLGVHFTPRTDGSVWLGPNAVLAFKREGYGYLQFSVKDLADALSFRGLRKLAFQHFFYGLKEMYKGIYIKAQVKQLQRYVPSLQPEDVVRGPSGVRAQALDRDGKLVDDFVFDCGTTDLGRRVLHVRNAPSPAATSSLAIAEMVADHVENQFDL 503          
BLAST of L-2-hydroxyglutarate dehydrogenase, mitochondrial vs. TrEMBL
Match: A0A0P6IW68 (Putative fad-dependent oxidoreductase (Fragment) OS=Aedes aegypti OX=7159 PE=2 SV=1)

HSP 1 Score: 519.62 bits (1337), Expect = 9.146e-179
Identity = 259/413 (62.71%), Postives = 321/413 (77.72%), Query Frame = 2
Query:  152 KLEYDIAXXXXXXXXLATARELKIRHPKLKMCVLEKEKLLSMHQSGHNSGVIHAGIYYTPGSLKAKLCVEGLKSSYVYLDKKKIPYKKCGKLIVATNPLEVSRLDELLKKGQANEVPDLKVVDASGIKEIEPNCAGLKALHSPHTGIVDWRLVALSYANDFKKSGGEIFLNFEVSEFNEAKESLDYPVELVAKNSKRVQSKYAIICGGLHADKLAVKSGCSDVPKIVPFRGDYLILKPDKKNMVRGNIYPVPDPRFPFLGVHFTPRMDGNVWLGPNAILAFKREGYGLLDFNLADTIDAIVFPGMLKIGAKHFTVGLKEMIGVAFISQQVKALKKFIPILTVNDVCRGPSGVRAQALNKDGGLVDDFVFHQGIG--SIGSRLLHVRNAPSPAATSSMAIARMIVDKVDVDFKL 1384
            K +YD+ +VGGGIVG A+ARE+ +RHP LK+ V+EKE  L+ HQSGHNSGVIHAGIYY PGSLKAKLCVEGL  SY Y D+K +PYKK GKLIVATN  EV RL++L ++  AN+VPD+++VDA  IKEIEP C GLKA+ SPHTGIVDW LV   YA DFK++GG+I LNFEVS+F E K+  +YP+ + +  +  VQSKY + CGGL +DK+A  +GCS +PKIVPFRG+YL+L P K +MV+GNIYPVPDPRFPFLGVHFTPRMDG+VWLGPNA+LAFKREGY   D N+ + IDA+ +PG +K+  K+   G++EM   AFI  QVK L+KFIP +   DV RGP+GVRAQAL+ DG LVDDFVF  G G  ++   +LH RNAPSP ATSS+AIA+MI DK++  F +
Sbjct:   10 KRQYDLVVVGGGIVGTASAREILLRHPSLKVAVVEKEHKLAFHQSGHNSGVIHAGIYYKPGSLKAKLCVEGLHLSYKYFDEKNVPYKKVGKLIVATNEDEVGRLNDLYQRSLANKVPDVELVDAKRIKEIEPYCEGLKAIWSPHTGIVDWELVTQYYAKDFKQAGGDIHLNFEVSKFEETKDP-NYPIAVRSNKNNTVQSKYILTCGGLQSDKVAELTGCSPLPKIVPFRGEYLLLNPAKCHMVKGNIYPVPDPRFPFLGVHFTPRMDGSVWLGPNAVLAFKREGYKWSDINVVELIDALKYPGFIKMALKYVGAGMQEMARSAFIPLQVKELQKFIPDVQEYDVQRGPAGVRAQALDIDGNLVDDFVFDHGKGDNALAQNILHCRNAPSPGATSSLAIAKMIADKLETQFNI 421          
BLAST of L-2-hydroxyglutarate dehydrogenase, mitochondrial vs. Ensembl Cavefish
Match: l2hgdh (L-2-hydroxyglutarate dehydrogenase [Source:ZFIN;Acc:ZDB-GENE-090319-6])

HSP 1 Score: 375.555 bits (963), Expect = 1.165e-125
Identity = 173/294 (58.84%), Postives = 221/294 (75.17%), Query Frame = 2
Query:  197 LATARELKIRHPKLKMCVLEKEKLLSMHQSGHNSGVIHAGIYYTPGSLKAKLCVEGLKSSYVYLDKKKIPYKKCGKLIVATNPLEVSRLDELLKKGQANEVPDLKVVDASGIKEIEPNCAGLKALHSPHTGIVDWRLVALSYANDFKKSGGEIFLNFEVSEFNEAKES-------LDYPVELVAKNSKRVQSKYAIICGGLHADKLAVKSGCSDVPKIVPFRGDYLILKPDKKNMVRGNIYPVPDPRFPFLGVHFTPRMDGNVWLGPNAILAFKREGYGLLDFNLADTIDAIVF 1057
            LA+AREL +RHP L   +LEKEK L++HQ+GHNSGVIH+GIYYTPGSLKA+LCV G   +Y Y D+K IPY+KCGKLIVA    E+ RL  L ++G  N V +L ++DA  I+E EP C G+ AL SPHTGIVDWRLV+L+YA DF+++GG +   FE S+   A ES       L +P+ + +   + V+ ++ + CGGL++D+L+  SGCS  P+IVPFRGDYL+LKP+K  +++GNIYPVPDPRFPFLGVHFTPRMDG+VWLGPNA+LAFKREGY L DFN  D  DA+ F
Sbjct:  102 LASARELILRHPNLTFTLLEKEKELALHQTGHNSGVIHSGIYYTPGSLKARLCVRGASLAYSYCDQKNIPYRKCGKLIVAVEREEIPRLKALYERGLKNNVKELSIIDARAIREREPYCRGIMALDSPHTGIVDWRLVSLTYAKDFQEAGGSVGTGFEASDIAMATESPASSTEGLKFPLVIRSSKGEEVRCRFVLTCGGLYSDRLSEISGCSPEPRIVPFRGDYLVLKPEKNYLIKGNIYPVPDPRFPFLGVHFTPRMDGSVWLGPNAVLAFKREGYKLYDFNAKDFTDALSF 395          
BLAST of L-2-hydroxyglutarate dehydrogenase, mitochondrial vs. Ensembl Sea Lamprey
Match: l2hgdh (L-2-hydroxyglutarate dehydrogenase [Source:ZFIN;Acc:ZDB-GENE-090319-6])

HSP 1 Score: 499.59 bits (1285), Expect = 6.041e-175
Identity = 250/415 (60.24%), Postives = 315/415 (75.90%), Query Frame = 2
Query:  161 YDIAXXXXXXXXLATARELKIRHPKLKMCVLEKEKLLSMHQSGHNSGVIHAGIYYTPGSLKAKLCVEGLKSSYVYLDKKKIPYKKCGKLIVATNPLEVSRLDELLKKGQANEVPDLKVVDASGIKEIEPNCAGLKALHSPHTGIVDWRLVALSYANDFKKSGGEIFLNFEVSEFNEAKESLD-------YPVELVAKNSKRVQSKYAIICGGLHADKLAVKSGCSDVPKIVPFRGDYLILKPDKKNMVRGNIYPVPDPRFPFLGVHFTPRMDGNVWLGPNAILAFKREGYGLLDFNLADTIDAIVFPGMLKIGAKHFTVGLKEMIGVAFISQQVKALKKFIPILTVNDVCRGPSGVRAQALNKDGGLVDDFVFHQGIGSIGSRLLHVRNAPSPAATSSMAIARMIVDKVDVDFKL 1384
            YD+A+VGGGIVGLA+AREL +RHP L   +LEKE+ ++ HQSGHNSGVIH+GIYY PGSLKAKLCV+G   +Y Y DKK IPYK+CGKLIVA +  E+ RLD+L  +G  N V DL++V    I+E EP+C G+KAL SP+TGIVDW  VA SY  DF + GGEI + F VS F E  E          YP+ +  K  + V+ ++ + CGGL++D+L+  SGCS  P+IVPFRGDYL+LKP+K  +V+GNIYPVPDPRFPFLGVHFTPRMDG +WLGPNA+LAFKREGY LLDF+  D +DAI+F G+ K+  ++ + G+ EM    FI  QVK L+++IP +T+ DV RGPSGVRAQAL++DG LVDDFVF  G GS+GSR++HVRNAPSPAATSS++IARMI D+V   F+L
Sbjct:    7 YDVAVVGGGIVGLASARELLLRHPSLSFVILEKERAIASHQSGHNSGVIHSGIYYKPGSLKAKLCVQGADLAYEYCDKKGIPYKRCGKLIVAVDREELPRLDDLYARGLQNNVRDLRLVGEQEIREREPHCKGIKALDSPYTGIVDWAEVARSYGRDFVEMGGEIHMGFCVSGFRETAEGAAGGAEGMEYPITVTGKKGEEVRCRFVLTCGGLYSDRLSRLSGCSSEPRIVPFRGDYLVLKPNKTYLVKGNIYPVPDPRFPFLGVHFTPRMDGTIWLGPNAVLAFKREGYRLLDFSARDFLDAILFRGLQKLVLRNISKGMSEMYRSIFIGSQVKLLQRYIPEITLADVTRGPSGVRAQALDRDGNLVDDFVFDGGQGSLGSRVMHVRNAPSPAATSSLSIARMIADEVKQRFQL 421          
BLAST of L-2-hydroxyglutarate dehydrogenase, mitochondrial vs. Ensembl Nematostella
Match: EDO34943 (L-2-hydroxyglutarate dehydrogenase, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:A7SMW7])

HSP 1 Score: 527.709 bits (1358), Expect = 0.000e+0
Identity = 264/422 (62.56%), Postives = 323/422 (76.54%), Query Frame = 2
Query:  146 QPKLEYDIAXXXXXXXXLATARELKIRHPKLKMCVLEKEKLLSMHQSGHNSGVIHAGIYYTPGSLKAKLCVEGLKSSYVYLDKKKIPYKKCGKLIVATNPLEVSRLDELLKKGQANEVPDLKVVDASGIKEIEPNCAGLKALHSPHTGIVDWRLVALSYANDFKKSGGEIFLNFEVSEFNEAKES---------LDYPVELVAKNSKRVQSKYAIICGGLHADKLAVKSGCSDVPKIVPFRGDYLILKPDKKNMVRGNIYPVPDPRFPFLGVHFTPRMDGNVWLGPNAILAFKREGYGLLDFNLADTIDAIVFPGMLKIGAKHFTVGLKEMIGVAFISQQVKALKKFIPILTVNDVCRGPSGVRAQALNKDGGLVDDFVFHQGIGSIGSRLLHVRNAPSPAATSSMAIARMIVDKVDVDFKL 1384
            QP   YD+AIVGGGIVGLATAREL +RHPKL  CVLEKEK LSMHQSGHNSGVIH GIYYTPGSLKAKLCV+GL  +Y Y D+  IPYKKCGKLIVA    E+  L+ L ++G+ N V DL +VD  GIKEIEP+C G+ A+ SP+TGIVDW  VAL+Y +DF+K GG+IF  +EV++F  A ES         L +PV + + N + ++ +Y I CGGL++D+LA KSGC+  P+IVPFRGDYL+LKP+K ++V+GNIYPVPDP FPFLGVHFTPRMDG+VWLGPNA+LAF REGY LLD NL D  DA+ F G+ ++  K+F+ G+ E       + QVK L+K+IP +T +DV  GPSGVRAQAL++DG LVDDFVF  G+G IGSR+LHVRNAPSPAATSS+AIARM+ DK    F L
Sbjct:   35 QPSEHYDVAIVGGGIVGLATARELILRHPKLTFCVLEKEKELSMHQSGHNSGVIHCGIYYTPGSLKAKLCVQGLDLTYQYCDEHNIPYKKCGKLIVAVEDKEIPLLNNLYERGKKNGVKDLTMVDKRGIKEIEPHCEGMFAIVSPNTGIVDWAQVALAYGDDFRKGGGDIFTGYEVTDFKCASESGKSQEKEAGLTHPVTVFSNNKQTIKCRYVITCGGLYSDRLAEKSGCNREPRIVPFRGDYLVLKPEKCHLVKGNIYPVPDPNFPFLGVHFTPRMDGSVWLGPNAVLAFAREGYNLLDINLRDLADALAFRGLRQLMFKYFSFGVGEYYRGLNHAAQVKQLQKYIPSVTADDVVSGPSGVRAQALDRDGNLVDDFVFDGGVGEIGSRVLHVRNAPSPAATSSLAIARMVADKAAERFTL 456          
BLAST of L-2-hydroxyglutarate dehydrogenase, mitochondrial vs. Ensembl Nematostella
Match: EDO29279 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T434])

HSP 1 Score: 126.331 bits (316), Expect = 3.050e-33
Identity = 75/210 (35.71%), Postives = 114/210 (54.29%), Query Frame = 2
Query:  248 VLEKEKLLSMHQSGHNSGVIHAGIYYTPGSLKAKLCVEGLKSSYVYLDKKKIPYKKCGKLIVATNPLEVSRLDELLKKGQANEVPDLKVVDASGIKEIEPNCAGLKALHSPHTGIVDWRLVALSYANDFKKSGGEIFLNFEVSEFNEAKESLDYP--VELVAKNSKRVQSKYAIICGGLHADKLAVK-SGCSD--VPKIVPFRGDYLILK 862
            VLE  + +    S  NS VIHAGIYY  GSLKA+LCVEG +  Y Y  ++ I +++CGKLIVAT+  +  +L  + +K +AN V DL+ ++ +  + +EP      ALHSP TGI+D   + L+   D + +GG +  + EV      +E+  +P  V L   +   + ++  +   GLHA  LA +  G     VP+    +G Y  L 
Sbjct:   32 VLEAAEAIGTGTSSRNSEVIHAGIYYPEGSLKARLCVEGRQRLYTYCGERGIAHQRCGKLIVATDEAQRGQLQTIARKAEANGVHDLRWLEGAEARAMEPALQCAAALHSPSTGIIDSHALMLALQGDLENAGGMVVCHAEV------QEAAIHPGGVWLRTADGTELTARTLVNAAGLHAPLLAARLQGFPQQFVPQAFYAKGHYFTLS 235          
BLAST of L-2-hydroxyglutarate dehydrogenase, mitochondrial vs. Ensembl Medaka
Match: l2hgdh (L-2-hydroxyglutarate dehydrogenase [Source:NCBI gene;Acc:101160274])

HSP 1 Score: 501.13 bits (1289), Expect = 1.692e-174
Identity = 237/403 (58.81%), Postives = 298/403 (73.95%), Query Frame = 2
Query:  197 LATARELKIRHPKLKMCVLEKEKLLSMHQSGHNSGVIHAGIYYTPGSLKAKLCVEGLKSSYVYLDKKKIPYKKCGKLIVATNPLEVSRLDELLKKGQANEVPDLKVVDASGIKEIEPNCAGLKALHSPHTGIVDWRLVALSYANDFKKSGGEIFLNFEVSEFNEAKES-------LDYPVELVAKNSKRVQSKYAIICGGLHADKLAVKSGCSDVPKIVPFRGDYLILKPDKKNMVRGNIYPVPDPRFPFLGVHFTPRMDGNVWLGPNAILAFKREGYGLLDFNLADTIDAIVFPGMLKIGAKHFTVGLKEMIGVAFISQQVKALKKFIPILTVNDVCRGPSGVRAQALNKDGGLVDDFVFHQGIGSIGSRLLHVRNAPSPAATSSMAIARMIVDKVDVDFKL 1384
            LATAREL +RHP L   +LEKEK L++HQSGHNSGV+H+GIYYTPGSLKA+LCV G   +Y + DKK IPYKKCGKLIVA    EV R+  L ++G  N V DL+++DA GI+E EP C G+ AL SPHTGIVDWR VAL +  DF+++GG +   FEV+  + A ES       + +P+ +       V+ +Y + CGGLH+D+L+  SGCS  P+IVPFRGDYL+LKP+K+ +V+GNIYP+PDPRFPFLGVHFTPRMDG+VWLGPNA+LAFKREGY + DF+  D  DA+ F G+ K+  K+   GL EM    F   QVK L+K+IP L  +DV RGP+GVRAQAL++ G LVDDFVF  G+G +GSR+LHVRNAPSPAATSS+AIA MI D+ +  F L
Sbjct:   41 LATARELILRHPALSFVLLEKEKELALHQSGHNSGVVHSGIYYTPGSLKARLCVRGATLAYDFCDKKGIPYKKCGKLIVAVEQEEVPRMRALYERGLQNNVRDLRIIDAKGIREREPYCRGIAALDSPHTGIVDWRKVALRFGKDFEEAGGAVLTEFEVNNISVASESPAGSSEGMKHPIAVRDAQGSEVRCRYVLTCGGLHSDRLSQISGCSREPRIVPFRGDYLVLKPEKRYLVKGNIYPIPDPRFPFLGVHFTPRMDGSVWLGPNAVLAFKREGYNVYDFSAQDFADALSFRGLQKLVLKNVAYGLGEMYRGVFTGAQVKILQKYIPELQQSDVLRGPAGVRAQALDRHGNLVDDFVFDGGVGEVGSRVLHVRNAPSPAATSSLAIAEMIADEAESRFSL 443          
BLAST of L-2-hydroxyglutarate dehydrogenase, mitochondrial vs. Planmine SMEST
Match: SMESG000024353.1 (SMESG000024353.1)

HSP 1 Score: 887.871 bits (2293), Expect = 0.000e+0
Identity = 446/449 (99.33%), Postives = 447/449 (99.55%), Query Frame = 2
Query:   38 MLKSLLNKKPLNCVKSVVLFERYFSDNFELDLFKPHQPKLEYDIAXXXXXXXXLATARELKIRHPKLKMCVLEKEKLLSMHQSGHNSGVIHAGIYYTPGSLKAKLCVEGLKSSYVYLDKKKIPYKKCGKLIVATNPLEVSRLDELLKKGQANEVPDLKVVDASGIKEIEPNCAGLKALHSPHTGIVDWRLVALSYANDFKKSGGEIFLNFEVSEFNEAKESLDYPVELVAKNSKRVQSKYAIICGGLHADKLAVKSGCSDVPKIVPFRGDYLILKPDKKNMVRGNIYPVPDPRFPFLGVHFTPRMDGNVWLGPNAILAFKREGYGLLDFNLADTIDAIVFPGMLKIGAKHFTVGLKEMIGVAFISQQVKALKKFIPILTVNDVCRGPSGVRAQALNKDGGLVDDFVFHQGIGSIGSRLLHVRNAPSPAATSSMAIARMIVDKVDVDFKL 1384
            MLKSLLNKKPLNC KSVVLFERYFSDNFELDLFKPH PKLEYDIAIVGGGIVGLATARELKIRHPKLKMCVLEKEKLLSMHQSGHNSGVIHAGIYYTPGSLKAKLCVEGLKSSYVYLDKKKIPYKKCGKLIVATNPLEVSRLDELLKKGQANEVPDLKVVDASGIK+IEPNCAGLKALHSPHTGIVDWRLVALSYANDFKKSGGEIFLNFEVSEFNEAKESLDYPVELVAKNSKRVQSKYAIICGGLHADKLAVKSGCSDVPKIVPFRGDYLILKPDKKNMVRGNIYPVPDPRFPFLGVHFTPRMDGNVWLGPNAILAFKREGYGLLDFNLADTIDAIVFPGMLKIGAKHFTVGLKEMIGVAFISQQVKALKKFIPILTVNDVCRGPSGVRAQALNKDGGLVDDFVFHQGIGSIGSRLLHVRNAPSPAATSSMAIARMIVDKVDVDFKL
Sbjct:    1 MLKSLLNKKPLNCAKSVVLFERYFSDNFELDLFKPHHPKLEYDIAIVGGGIVGLATARELKIRHPKLKMCVLEKEKLLSMHQSGHNSGVIHAGIYYTPGSLKAKLCVEGLKSSYVYLDKKKIPYKKCGKLIVATNPLEVSRLDELLKKGQANEVPDLKVVDASGIKDIEPNCAGLKALHSPHTGIVDWRLVALSYANDFKKSGGEIFLNFEVSEFNEAKESLDYPVELVAKNSKRVQSKYAIICGGLHADKLAVKSGCSDVPKIVPFRGDYLILKPDKKNMVRGNIYPVPDPRFPFLGVHFTPRMDGNVWLGPNAILAFKREGYGLLDFNLADTIDAIVFPGMLKIGAKHFTVGLKEMIGVAFISQQVKALKKFIPILTVNDVCRGPSGVRAQALNKDGGLVDDFVFHQGIGSIGSRLLHVRNAPSPAATSSMAIARMIVDKVDVDFKL 449          
BLAST of L-2-hydroxyglutarate dehydrogenase, mitochondrial vs. Planmine SMEST
Match: SMESG000046453.1 (SMESG000046453.1)

HSP 1 Score: 774.237 bits (1998), Expect = 0.000e+0
Identity = 380/381 (99.74%), Postives = 381/381 (100.00%), Query Frame = 2
Query:  242 MCVLEKEKLLSMHQSGHNSGVIHAGIYYTPGSLKAKLCVEGLKSSYVYLDKKKIPYKKCGKLIVATNPLEVSRLDELLKKGQANEVPDLKVVDASGIKEIEPNCAGLKALHSPHTGIVDWRLVALSYANDFKKSGGEIFLNFEVSEFNEAKESLDYPVELVAKNSKRVQSKYAIICGGLHADKLAVKSGCSDVPKIVPFRGDYLILKPDKKNMVRGNIYPVPDPRFPFLGVHFTPRMDGNVWLGPNAILAFKREGYGLLDFNLADTIDAIVFPGMLKIGAKHFTVGLKEMIGVAFISQQVKALKKFIPILTVNDVCRGPSGVRAQALNKDGGLVDDFVFHQGIGSIGSRLLHVRNAPSPAATSSMAIARMIVDKVDVDFKL 1384
            MCVLEKEKLLSMHQSGHNSGVIHAGIYYTPGSLKAKLCVEGLKSSYVYLDKKKIPYKKCGKLIVATNPLEVSRLDELLKKGQANEVPDLKVVDASGIK+IEPNCAGLKALHSPHTGIVDWRLVALSYANDFKKSGGEIFLNFEVSEFNEAKESLDYPVELVAKNSKRVQSKYAIICGGLHADKLAVKSGCSDVPKIVPFRGDYLILKPDKKNMVRGNIYPVPDPRFPFLGVHFTPRMDGNVWLGPNAILAFKREGYGLLDFNLADTIDAIVFPGMLKIGAKHFTVGLKEMIGVAFISQQVKALKKFIPILTVNDVCRGPSGVRAQALNKDGGLVDDFVFHQGIGSIGSRLLHVRNAPSPAATSSMAIARMIVDKVDVDFKL
Sbjct:    1 MCVLEKEKLLSMHQSGHNSGVIHAGIYYTPGSLKAKLCVEGLKSSYVYLDKKKIPYKKCGKLIVATNPLEVSRLDELLKKGQANEVPDLKVVDASGIKDIEPNCAGLKALHSPHTGIVDWRLVALSYANDFKKSGGEIFLNFEVSEFNEAKESLDYPVELVAKNSKRVQSKYAIICGGLHADKLAVKSGCSDVPKIVPFRGDYLILKPDKKNMVRGNIYPVPDPRFPFLGVHFTPRMDGNVWLGPNAILAFKREGYGLLDFNLADTIDAIVFPGMLKIGAKHFTVGLKEMIGVAFISQQVKALKKFIPILTVNDVCRGPSGVRAQALNKDGGLVDDFVFHQGIGSIGSRLLHVRNAPSPAATSSMAIARMIVDKVDVDFKL 381          
The following BLAST results are available for this feature:
BLAST of L-2-hydroxyglutarate dehydrogenase, mitochondrial vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
L2HGDH1.413e-16355.58L-2-hydroxyglutarate dehydrogenase [Source:HGNC Sy... [more]
L2HGDH1.413e-16355.58L-2-hydroxyglutarate dehydrogenase [Source:HGNC Sy... [more]
L2HGDH1.660e-12851.98L-2-hydroxyglutarate dehydrogenase [Source:HGNC Sy... [more]
L2HGDH2.094e-5757.14L-2-hydroxyglutarate dehydrogenase [Source:HGNC Sy... [more]
L2HGDH5.797e-3657.14L-2-hydroxyglutarate dehydrogenase [Source:HGNC Sy... [more]
back to top
BLAST of L-2-hydroxyglutarate dehydrogenase, mitochondrial vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Y45G12B.31.588e-16356.83L-2-hydroxyglutarate dehydrogenase, mitochondrial ... [more]
Y45G12B.31.588e-16356.83L-2-hydroxyglutarate dehydrogenase, mitochondrial ... [more]
Y45G12B.35.165e-11152.74L-2-hydroxyglutarate dehydrogenase, mitochondrial ... [more]
back to top
BLAST of L-2-hydroxyglutarate dehydrogenase, mitochondrial vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
L2HGDH1.455e-17760.92gene:FBgn0032729 transcript:FBtr0340324[more]
L2HGDH1.455e-17760.92gene:FBgn0032729 transcript:FBtr0081186[more]
L2HGDH1.455e-17760.92gene:FBgn0032729 transcript:FBtr0340323[more]
back to top
BLAST of L-2-hydroxyglutarate dehydrogenase, mitochondrial vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
l2hgdh2.012e-17057.83L-2-hydroxyglutarate dehydrogenase [Source:ZFIN;Ac... [more]
back to top
BLAST of L-2-hydroxyglutarate dehydrogenase, mitochondrial vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
L2HGDH9.709e-16457.11L-2-hydroxyglutarate dehydrogenase [Source:NCBI ge... [more]
L2HGDH1.725e-15254.91L-2-hydroxyglutarate dehydrogenase [Source:NCBI ge... [more]
L2HGDH8.280e-13255.56L-2-hydroxyglutarate dehydrogenase [Source:NCBI ge... [more]
back to top
BLAST of L-2-hydroxyglutarate dehydrogenase, mitochondrial vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
L2hgdh8.338e-15753.85L-2-hydroxyglutarate dehydrogenase [Source:MGI Sym... [more]
back to top
BLAST of L-2-hydroxyglutarate dehydrogenase, mitochondrial vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A7SMW7|L2HDH_NEMVE0.000e+062.56L-2-hydroxyglutarate dehydrogenase, mitochondrial ... [more]
sp|A8X2R1|L2HDH_CAEBR5.482e-16357.07L-2-hydroxyglutarate dehydrogenase, mitochondrial ... [more]
sp|Q9H9P8|L2HDH_HUMAN6.787e-16355.58L-2-hydroxyglutarate dehydrogenase, mitochondrial ... [more]
sp|Q9N4Z0|L2HDH_CAEEL2.020e-16256.83L-2-hydroxyglutarate dehydrogenase, mitochondrial ... [more]
sp|A7MBI3|L2HDH_BOVIN8.287e-16255.58L-2-hydroxyglutarate dehydrogenase, mitochondrial ... [more]
back to top
BLAST of L-2-hydroxyglutarate dehydrogenase, mitochondrial vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0L8IEP40.000e+064.88DAO domain-containing protein OS=Octopus bimaculoi... [more]
A0A1S3J4V70.000e+064.32L-2-hydroxyglutarate dehydrogenase, mitochondrial-... [more]
T1FEW00.000e+060.22DAO domain-containing protein OS=Helobdella robust... [more]
A0A3S1H4X70.000e+062.92DAO domain-containing protein (Fragment) OS=Elysia... [more]
A0A0P6IW689.146e-17962.71Putative fad-dependent oxidoreductase (Fragment) O... [more]
back to top
BLAST of L-2-hydroxyglutarate dehydrogenase, mitochondrial vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
l2hgdh1.165e-12558.84L-2-hydroxyglutarate dehydrogenase [Source:ZFIN;Ac... [more]
back to top
BLAST of L-2-hydroxyglutarate dehydrogenase, mitochondrial vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
l2hgdh6.041e-17560.24L-2-hydroxyglutarate dehydrogenase [Source:ZFIN;Ac... [more]
back to top
BLAST of L-2-hydroxyglutarate dehydrogenase, mitochondrial vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of L-2-hydroxyglutarate dehydrogenase, mitochondrial vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO349430.000e+062.56L-2-hydroxyglutarate dehydrogenase, mitochondrial ... [more]
EDO292793.050e-3335.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of L-2-hydroxyglutarate dehydrogenase, mitochondrial vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
l2hgdh1.692e-17458.81L-2-hydroxyglutarate dehydrogenase [Source:NCBI ge... [more]
back to top
BLAST of L-2-hydroxyglutarate dehydrogenase, mitochondrial vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000024353.10.000e+099.33SMESG000024353.1[more]
SMESG000046453.10.000e+099.74SMESG000046453.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027991 ID=SMED30027991|Name=L-2-hydroxyglutarate dehydrogenase, mitochondrial|organism=Schmidtea mediterranea sexual|type=transcript|length=1661bp
TTAGAATTGAAAAATCTTTACAGATGTAACTTTTAAAATGCTGAAAAGTT
TACTAAATAAAAAGCCTCTAAACTGTGTAAAATCAGTAGTCTTATTCGAA
AGATATTTTTCTGATAATTTTGAACTTGATCTTTTTAAACCTCATCAGCC
TAAATTAGAATATGATATTGCTATTGTTGGCGGAGGAATTGTTGGCTTAG
CAACTGCTCGTGAACTCAAAATAAGACATCCTAAACTAAAAATGTGTGTC
TTAGAAAAAGAAAAATTACTTTCAATGCATCAAAGTGGTCATAATAGTGG
GGTAATTCATGCTGGTATATATTACACACCAGGATCATTAAAGGCTAAAT
TATGTGTTGAAGGATTGAAAAGTTCGTATGTATATCTTGATAAAAAAAAG
ATTCCATACAAAAAATGTGGTAAATTGATTGTAGCTACAAATCCTCTTGA
AGTATCTCGTCTTGATGAACTTCTTAAAAAGGGCCAAGCAAATGAAGTTC
CAGATTTGAAAGTAGTGGACGCTTCTGGTATTAAGGAAATTGAACCGAAT
TGTGCGGGATTAAAAGCTCTCCATTCGCCTCATACTGGCATTGTAGATTG
GCGATTGGTTGCGCTATCCTATGCCAATGACTTTAAAAAATCGGGTGGAG
AAATATTTCTTAATTTCGAAGTATCTGAATTTAATGAAGCCAAAGAATCA
TTGGATTATCCTGTTGAATTAGTTGCAAAGAACAGTAAACGAGTTCAATC
AAAGTATGCTATTATATGTGGAGGTCTCCATGCGGATAAATTAGCTGTAA
AGTCTGGTTGTTCTGATGTTCCGAAAATTGTTCCTTTTCGTGGTGATTAT
TTAATTCTAAAACCAGATAAAAAGAATATGGTGAGAGGAAACATATATCC
AGTTCCAGATCCTCGGTTTCCTTTTCTAGGCGTTCATTTTACACCTAGAA
TGGATGGTAATGTATGGTTGGGACCTAATGCAATTTTAGCGTTCAAACGA
GAAGGTTATGGGTTATTAGATTTCAATTTAGCAGACACTATTGATGCTAT
AGTTTTTCCGGGAATGCTAAAAATTGGAGCGAAGCATTTTACCGTAGGTC
TAAAAGAAATGATCGGCGTTGCCTTTATTTCACAACAAGTTAAAGCTTTG
AAAAAATTTATTCCAATTTTGACTGTTAATGATGTTTGTCGTGGACCAAG
TGGGGTAAGAGCTCAAGCTCTTAATAAAGATGGTGGATTGGTTGATGATT
TTGTGTTTCATCAAGGCATAGGGTCCATTGGTTCCAGATTGCTACATGTA
AGAAATGCCCCAAGTCCTGCTGCTACATCTTCTATGGCCATTGCTCGAAT
GATTGTTGATAAAGTTGATGTCGACTTCAAACTATAGATGGTTTTTATTT
TTTTTTGATTTTTGAAATGTACACTAAAAATTTGTTGGTAGTATAAAAAA
CTCATTTCAGTTATTTCTTTGTTTTCCAATGTGTGGTTTGTGAAACTTAG
ATGTTATCAACGGTGACAGGTGACGCAATAAGCGCCTACATTAACTAAGT
CAATTGGAATGTAGCTCATGGCATTTACTCTTGTGAAGAAAATATATGTA
TAATTATTAACTTATGATCGTAAAGTGTGATGAATAAATAAAATAGTGAC
AACGAAAAAAA
back to top

protein sequence of SMED30027991-orf-1

>SMED30027991-orf-1 ID=SMED30027991-orf-1|Name=SMED30027991-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=450bp
MLKSLLNKKPLNCVKSVVLFERYFSDNFELDLFKPHQPKLEYDIAIVGGG
IVGLATARELKIRHPKLKMCVLEKEKLLSMHQSGHNSGVIHAGIYYTPGS
LKAKLCVEGLKSSYVYLDKKKIPYKKCGKLIVATNPLEVSRLDELLKKGQ
ANEVPDLKVVDASGIKEIEPNCAGLKALHSPHTGIVDWRLVALSYANDFK
KSGGEIFLNFEVSEFNEAKESLDYPVELVAKNSKRVQSKYAIICGGLHAD
KLAVKSGCSDVPKIVPFRGDYLILKPDKKNMVRGNIYPVPDPRFPFLGVH
FTPRMDGNVWLGPNAILAFKREGYGLLDFNLADTIDAIVFPGMLKIGAKH
FTVGLKEMIGVAFISQQVKALKKFIPILTVNDVCRGPSGVRAQALNKDGG
LVDDFVFHQGIGSIGSRLLHVRNAPSPAATSSMAIARMIVDKVDVDFKL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0000429neoblast
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036188FAD/NAD-bd_sf
IPR023753FAD/NAD-binding_dom
IPR006076FAD-dep_OxRdtase
Vocabulary: biological process
TermDefinition
GO:0055114oxidation-reduction process
Vocabulary: molecular function
TermDefinition
GO:0016491oxidoreductase activity
GO:00475452-hydroxyglutarate dehydrogenase activity
Vocabulary: cellular component
TermDefinition
GO:0005739mitochondrion
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR036188FAD/NAD(P)-binding domain superfamilyGENE3DG3DSA:3.50.50.60coord: 43..436
e-value: 1.7E-79
score: 269.4
IPR036188FAD/NAD(P)-binding domain superfamilySUPERFAMILYSSF51905FAD/NAD(P)-binding domaincoord: 41..329
NoneNo IPR availableGENE3DG3DSA:3.30.9.10coord: 126..397
e-value: 1.7E-79
score: 269.4
NoneNo IPR availablePANTHERPTHR43104FAMILY NOT NAMEDcoord: 33..448
NoneNo IPR availablePANTHERPTHR43104:SF2L-2-HYDROXYGLUTARATE DEHYDROGENASE, MITOCHONDRIALcoord: 33..448
IPR006076FAD dependent oxidoreductasePFAMPF01266DAOcoord: 43..441
e-value: 1.4E-62
score: 212.3