Calcyphosin protein

Overview
NameCalcyphosin protein
Smed IDSMED30027978
Length (bp)861
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Calcyphosin protein (SMED30027978) t-SNE clustered cells

Violin plots show distribution of expression levels for Calcyphosin protein (SMED30027978) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Calcyphosin protein (SMED30027978) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Calcyphosin protein (SMED30027978) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027978

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 16

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30027978h1SMcG0018773 SmedASXL_071629SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30027978h1SMcG0018773 SmedASXL_012746SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30027978h1SMcG0018773 Contig46115newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30027978h1SMcG0018773 Contig46115uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynxSMED30027978h1SMcG0018773 dd_Smed_v4_4512_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30027978h1SMcG0018773 dd_Smed_v4_4512_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30027978h1SMcG0018773 dd_Smed_v4_4512_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30027978h1SMcG0018773 dd_Smed_v4_4512_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30027978h1SMcG0018773 dd_Smed_v4_4512_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30027978h1SMcG0018773 dd_Smed_v4_4512_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30027978h1SMcG0018773 dd_Smed_v4_4512_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30027978h1SMcG0018773 dd_Smed_v4_4512_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30027978h1SMcG0018773 dd_Smed_v4_9521_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30027978h1SMcG0018773 dd_Smed_v4_9521_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30027978h1SMcG0018773 dd_Smed_v6_4512_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30027978h1SMcG0018773 dd_Smed_v4_4512_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Calcyphosin protein vs. Ensembl Human
Match: CAPSL (calcyphosine like [Source:HGNC Symbol;Acc:HGNC:28375])

HSP 1 Score: 233.802 bits (595), Expect = 1.135e-76
Identity = 121/208 (58.17%), Postives = 163/208 (78.37%), Query Frame = 2
Query:   74 MALTNRGNRELQMKSKEKLKSASDPMEKLRLQCLARGATGIKGLGRAFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVALVIQAFNKLDKTKDGFITVEDLKGVYNVSKHPKYISGERTXXXXXXXXXXXXXAPDEIDGKITKREFLNYYSAVSCSIDNDAYFDLMMRNAYKL 697
            MA T R +RE+ +++K+KL +A+DP+E+LRLQCLARG+ GIKGLGR F+I DDD N TLDF+EF KG+NDY   + KEEV+ +F   DKD +GT+DF+EFL+ LRPPM+++R  +++QAF KLDKT DG IT+EDL+ VYN   HPKY +GE +EE++F +FL NF++P + DG +T  EF+NYY+ VS SID D YF +MMR A+KL
Sbjct:    1 MAGTARHDREMAIQAKKKLTTATDPIERLRLQCLARGSAGIKGLGRVFRIMDDDNNRTLDFKEFMKGLNDYAVVMEKEEVEELFRRFDKDGNGTIDFNEFLLTLRPPMSRARKEVIMQAFRKLDKTGDGVITIEDLREVYNAKHHPKYQNGEWSEEQVFRKFLDNFDSPYDKDGLVTPEEFMNYYAGVSASIDTDVYFIIMMRTAWKL 208          
BLAST of Calcyphosin protein vs. Ensembl Human
Match: CAPSL (calcyphosine like [Source:HGNC Symbol;Acc:HGNC:28375])

HSP 1 Score: 233.802 bits (595), Expect = 1.135e-76
Identity = 121/208 (58.17%), Postives = 163/208 (78.37%), Query Frame = 2
Query:   74 MALTNRGNRELQMKSKEKLKSASDPMEKLRLQCLARGATGIKGLGRAFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVALVIQAFNKLDKTKDGFITVEDLKGVYNVSKHPKYISGERTXXXXXXXXXXXXXAPDEIDGKITKREFLNYYSAVSCSIDNDAYFDLMMRNAYKL 697
            MA T R +RE+ +++K+KL +A+DP+E+LRLQCLARG+ GIKGLGR F+I DDD N TLDF+EF KG+NDY   + KEEV+ +F   DKD +GT+DF+EFL+ LRPPM+++R  +++QAF KLDKT DG IT+EDL+ VYN   HPKY +GE +EE++F +FL NF++P + DG +T  EF+NYY+ VS SID D YF +MMR A+KL
Sbjct:    1 MAGTARHDREMAIQAKKKLTTATDPIERLRLQCLARGSAGIKGLGRVFRIMDDDNNRTLDFKEFMKGLNDYAVVMEKEEVEELFRRFDKDGNGTIDFNEFLLTLRPPMSRARKEVIMQAFRKLDKTGDGVITIEDLREVYNAKHHPKYQNGEWSEEQVFRKFLDNFDSPYDKDGLVTPEEFMNYYAGVSASIDTDVYFIIMMRTAWKL 208          
BLAST of Calcyphosin protein vs. Ensembl Human
Match: CAPSL (calcyphosine like [Source:HGNC Symbol;Acc:HGNC:28375])

HSP 1 Score: 233.802 bits (595), Expect = 1.135e-76
Identity = 121/208 (58.17%), Postives = 163/208 (78.37%), Query Frame = 2
Query:   74 MALTNRGNRELQMKSKEKLKSASDPMEKLRLQCLARGATGIKGLGRAFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVALVIQAFNKLDKTKDGFITVEDLKGVYNVSKHPKYISGERTXXXXXXXXXXXXXAPDEIDGKITKREFLNYYSAVSCSIDNDAYFDLMMRNAYKL 697
            MA T R +RE+ +++K+KL +A+DP+E+LRLQCLARG+ GIKGLGR F+I DDD N TLDF+EF KG+NDY   + KEEV+ +F   DKD +GT+DF+EFL+ LRPPM+++R  +++QAF KLDKT DG IT+EDL+ VYN   HPKY +GE +EE++F +FL NF++P + DG +T  EF+NYY+ VS SID D YF +MMR A+KL
Sbjct:    1 MAGTARHDREMAIQAKKKLTTATDPIERLRLQCLARGSAGIKGLGRVFRIMDDDNNRTLDFKEFMKGLNDYAVVMEKEEVEELFRRFDKDGNGTIDFNEFLLTLRPPMSRARKEVIMQAFRKLDKTGDGVITIEDLREVYNAKHHPKYQNGEWSEEQVFRKFLDNFDSPYDKDGLVTPEEFMNYYAGVSASIDTDVYFIIMMRTAWKL 208          
BLAST of Calcyphosin protein vs. Ensembl Human
Match: CAPSL (calcyphosine like [Source:HGNC Symbol;Acc:HGNC:28375])

HSP 1 Score: 208.379 bits (529), Expect = 6.020e-67
Identity = 109/190 (57.37%), Postives = 149/190 (78.42%), Query Frame = 2
Query:   74 MALTNRGNRELQMKSKEKLKSASDPMEKLRLQCLARGATGIKGLGRAFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVALVIQAFNKLDKTKDGFITVEDLKGVYNVSKHPKYISGERTXXXXXXXXXXXXXAPDEIDGKITKREFLNYYSAVSC 643
            MA T R +RE+ +++K+KL +A+DP+E+LRLQCLARG+ GIKGLGR F+I DDD N TLDF+EF KG+NDY   + KEEV+ +F   DKD +GT+DF+EFL+ LRPPM+++R  +++QAF KLDKT DG IT+EDL+ VYN   HPKY +GE +EE++F +FL NF++P + DG +T  EF+NYY+ VS 
Sbjct:    1 MAGTARHDREMAIQAKKKLTTATDPIERLRLQCLARGSAGIKGLGRVFRIMDDDNNRTLDFKEFMKGLNDYAVVMEKEEVEELFRRFDKDGNGTIDFNEFLLTLRPPMSRARKEVIMQAFRKLDKTGDGVITIEDLREVYNAKHHPKYQNGEWSEEQVFRKFLDNFDSPYDKDGLVTPEEFMNYYAGVSA 190          
BLAST of Calcyphosin protein vs. Ensembl Human
Match: CAPSL (calcyphosine like [Source:HGNC Symbol;Acc:HGNC:28375])

HSP 1 Score: 193.741 bits (491), Expect = 2.397e-61
Identity = 103/179 (57.54%), Postives = 142/179 (79.33%), Query Frame = 2
Query:   74 MALTNRGNRELQMKSKEKLKSASDPMEKLRLQCLARGATGIKGLGRAFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVALVIQAFNKLDKTKDGFITVEDLKGVYNVSKHPKYISGERTXXXXXXXXXXXXXAPDEIDGKITKR 610
            MA T R +RE+ +++K+KL +A+DP+E+LRLQCLARG+ GIKGLGR F+I DDD N TLDF+EF KG+NDY   + KEEV+ +F   DKD +GT+DF+EFL+ LRPPM+++R  +++QAF KLDKT DG IT+EDL+ VYN   HPKY +GE +EE++F +FL NF++P + DG ++KR
Sbjct:    1 MAGTARHDREMAIQAKKKLTTATDPIERLRLQCLARGSAGIKGLGRVFRIMDDDNNRTLDFKEFMKGLNDYAVVMEKEEVEELFRRFDKDGNGTIDFNEFLLTLRPPMSRARKEVIMQAFRKLDKTGDGVITIEDLREVYNAKHHPKYQNGEWSEEQVFRKFLDNFDSPYDKDGLVSKR 179          
BLAST of Calcyphosin protein vs. Ensembl Celegans
Match: cal-4 (CALmodulin related genes [Source:UniProtKB/TrEMBL;Acc:G5EDZ8])

HSP 1 Score: 56.6102 bits (135), Expect = 2.892e-9
Identity = 29/97 (29.90%), Postives = 55/97 (56.70%), Query Frame = 2
Query:  194 IKGLGRAFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVALVIQAFNKLDKTKDGFITVEDLK 484
            ++   +AFK++D DGNNT++ +E  + +   G + ++EE+  +    D D +G +DF EF   ++    ++   L+  AF   DK  +G+IT ++ K
Sbjct:   76 LQEFAQAFKLFDKDGNNTMNIKELGEAMRMLGLNPTEEELLNMVNEYDVDGNGKIDFGEFCKMMKEMNKETDQELIRLAFKVFDKDGNGYITAQEFK 172          
BLAST of Calcyphosin protein vs. Ensembl Celegans
Match: cal-4 (CALmodulin related genes [Source:UniProtKB/TrEMBL;Acc:G5EDZ8])

HSP 1 Score: 55.8398 bits (133), Expect = 2.954e-9
Identity = 29/97 (29.90%), Postives = 55/97 (56.70%), Query Frame = 2
Query:  194 IKGLGRAFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVALVIQAFNKLDKTKDGFITVEDLK 484
            ++   +AFK++D DGNNT++ +E  + +   G + ++EE+  +    D D +G +DF EF   ++    ++   L+  AF   DK  +G+IT ++ K
Sbjct:   22 LQEFAQAFKLFDKDGNNTMNIKELGEAMRMLGLNPTEEELLNMVNEYDVDGNGKIDFGEFCKMMKEMNKETDQELIRLAFKVFDKDGNGYITAQEFK 118          
BLAST of Calcyphosin protein vs. Ensembl Celegans
Match: cal-4 (CALmodulin related genes [Source:UniProtKB/TrEMBL;Acc:G5EDZ8])

HSP 1 Score: 55.8398 bits (133), Expect = 3.272e-9
Identity = 29/97 (29.90%), Postives = 55/97 (56.70%), Query Frame = 2
Query:  194 IKGLGRAFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVALVIQAFNKLDKTKDGFITVEDLK 484
            ++   +AFK++D DGNNT++ +E  + +   G + ++EE+  +    D D +G +DF EF   ++    ++   L+  AF   DK  +G+IT ++ K
Sbjct:   48 LQEFAQAFKLFDKDGNNTMNIKELGEAMRMLGLNPTEEELLNMVNEYDVDGNGKIDFGEFCKMMKEMNKETDQELIRLAFKVFDKDGNGYITAQEFK 144          
BLAST of Calcyphosin protein vs. Ensembl Celegans
Match: C50C3.5 (Uncharacterized calcium-binding protein C50C3.5 [Source:UniProtKB/Swiss-Prot;Acc:P34368])

HSP 1 Score: 54.299 bits (129), Expect = 8.744e-9
Identity = 30/97 (30.93%), Postives = 52/97 (53.61%), Query Frame = 2
Query:  209 RAFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVALVIQ-AFNKLDKTKDGFITVEDLKGVYN 496
            + F++ DDDG+ T+   E  K +N+ G D+S + VQ +    D    G +DF+EFL A+   +  S V   +Q   +K+D   +  I+ E+L   ++
Sbjct:   54 KIFQLMDDDGSGTISSSEVAKMLNELGIDVSPKVVQAVMRSSDVSGDGQIDFEEFLAAVTSKIKLSTVKADVQLMLSKIDNNPEKVISAEELVVAWS 150          
BLAST of Calcyphosin protein vs. Ensembl Celegans
Match: cmd-1 (Calmodulin [Source:UniProtKB/Swiss-Prot;Acc:O16305])

HSP 1 Score: 49.6766 bits (117), Expect = 1.971e-7
Identity = 31/100 (31.00%), Postives = 52/100 (52.00%), Query Frame = 2
Query:  194 IKGLGRAFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVALVI-QAFNKLDKTKDGFITVEDLKGV 490
            I     AF ++D DG+ T+  +E    +   G + ++ E+Q +   +D D +GT+DF EFL  +   M  +     I +AF   DK  +GFI+  +L+ V
Sbjct:   10 IAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHV 109          
BLAST of Calcyphosin protein vs. Ensembl Fly
Match: CG31345 (gene:FBgn0051345 transcript:FBtr0082689)

HSP 1 Score: 202.986 bits (515), Expect = 8.111e-65
Identity = 107/214 (50.00%), Postives = 145/214 (67.76%), Query Frame = 2
Query:   74 MALTNRGNRELQMKSKEKLKSAS----DPMEKLRLQCLARGATGIKGLGRAFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVALVIQAFNKLDKTKDGFITVEDLKGVYNVSKHPKYISGERTXXXXXXX--XXXXXXAPDEIDGKITKREFLNYYSAVSCSIDNDAYFDLMMRNAYKL 697
            M   N  ++E ++K+  K + A+    DP+ KLRLQC +RGATGI GL R+F++ DDDG+ +L   EF KGV D G DL+  E+  +F   D D SG ++  EFL+ LRPPM  SR++++ +AF+K+D   DG ITV DLK VY+V  HPKY+SGE TE ++F +        AP+  DG +T+ EF+NYY+ +S SIDNDAYFDLMMR AYKL
Sbjct:    1 MHRENAYSKEAELKNLAKRELANGLDKDPIYKLRLQCFSRGATGILGLSRSFRVMDDDGSKSLSPEEFKKGVTDIGLDLTDSEIDEMFSRFDTDGSGNINMTEFLVKLRPPMNNSRISIIEKAFDKMDANGDGQITVTDLKNVYSVRDHPKYLSGEMTENQIFTQFLKNFEVGAPNP-DGIVTREEFINYYATISASIDNDAYFDLMMRQAYKL 213          
BLAST of Calcyphosin protein vs. Ensembl Fly
Match: CG10126 (gene:FBgn0038088 transcript:FBtr0082686)

HSP 1 Score: 201.83 bits (512), Expect = 2.372e-64
Identity = 98/186 (52.69%), Postives = 137/186 (73.66%), Query Frame = 2
Query:  143 DPMEKLRLQCLARGATGIKGLGRAFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVALVIQAFNKLDKTKDGFITVEDLKGVYNVSKHPKYISGERTXXXXXXX-XXXXXXAPDEIDGKITKREFLNYYSAVSCSIDNDAYFDLMMRNAYKL 697
            DP+ KLRL CL+RGATGI GLGRAF+  DDDG+  L+  EF  G+ D G D+S+EE++ +F   D+D SG+++  EFL+ LRPPM +SR+ ++ QAFNK+D+ +DG IT++DLK VY+V +HPKY SGE++E+E+  +           +DGKIT+ EF+NYY+ +S SIDND +FDLMMR AY +
Sbjct:   30 DPITKLRLLCLSRGATGILGLGRAFRAMDDDGSKALNEEEFITGIRDTGLDVSEEEIKQMFATFDEDGSGSINMTEFLLKLRPPMPQSRLNIIDQAFNKMDRDEDGVITIQDLKNVYSVKEHPKYQSGEKSEDEILTDFLHNFEGGRGNLDGKITREEFVNYYATISASIDNDMFFDLMMRRAYVM 215          
BLAST of Calcyphosin protein vs. Ensembl Fly
Match: CG10126 (gene:FBgn0038088 transcript:FBtr0082687)

HSP 1 Score: 201.445 bits (511), Expect = 4.029e-64
Identity = 98/186 (52.69%), Postives = 137/186 (73.66%), Query Frame = 2
Query:  143 DPMEKLRLQCLARGATGIKGLGRAFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVALVIQAFNKLDKTKDGFITVEDLKGVYNVSKHPKYISGERTXXXXXXX-XXXXXXAPDEIDGKITKREFLNYYSAVSCSIDNDAYFDLMMRNAYKL 697
            DP+ KLRL CL+RGATGI GLGRAF+  DDDG+  L+  EF  G+ D G D+S+EE++ +F   D+D SG+++  EFL+ LRPPM +SR+ ++ QAFNK+D+ +DG IT++DLK VY+V +HPKY SGE++E+E+  +           +DGKIT+ EF+NYY+ +S SIDND +FDLMMR AY +
Sbjct:   42 DPITKLRLLCLSRGATGILGLGRAFRAMDDDGSKALNEEEFITGIRDTGLDVSEEEIKQMFATFDEDGSGSINMTEFLLKLRPPMPQSRLNIIDQAFNKMDRDEDGVITIQDLKNVYSVKEHPKYQSGEKSEDEILTDFLHNFEGGRGNLDGKITREEFVNYYATISASIDNDMFFDLMMRRAYVM 227          
BLAST of Calcyphosin protein vs. Ensembl Fly
Match: Cam (gene:FBgn0000253 transcript:FBtr0304964)

HSP 1 Score: 50.0618 bits (118), Expect = 2.430e-7
Identity = 31/100 (31.00%), Postives = 52/100 (52.00%), Query Frame = 2
Query:  194 IKGLGRAFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVALVI-QAFNKLDKTKDGFITVEDLKGV 490
            I     AF ++D DG+ T+  +E    +   G + ++ E+Q +   +D D +GT+DF EFL  +   M  +     I +AF   DK  +GFI+  +L+ V
Sbjct:   10 IAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHV 109          
BLAST of Calcyphosin protein vs. Ensembl Fly
Match: Cam (gene:FBgn0000253 transcript:FBtr0088001)

HSP 1 Score: 50.0618 bits (118), Expect = 2.430e-7
Identity = 31/100 (31.00%), Postives = 52/100 (52.00%), Query Frame = 2
Query:  194 IKGLGRAFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVALVI-QAFNKLDKTKDGFITVEDLKGV 490
            I     AF ++D DG+ T+  +E    +   G + ++ E+Q +   +D D +GT+DF EFL  +   M  +     I +AF   DK  +GFI+  +L+ V
Sbjct:   10 IAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHV 109          
BLAST of Calcyphosin protein vs. Ensembl Zebrafish
Match: capslb (calcyphosine-like b [Source:ZFIN;Acc:ZDB-GENE-050417-298])

HSP 1 Score: 259.225 bits (661), Expect = 2.124e-86
Identity = 129/208 (62.02%), Postives = 165/208 (79.33%), Query Frame = 2
Query:   74 MALTNRGNRELQMKSKEKLKSASDPMEKLRLQCLARGATGIKGLGRAFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVALVIQAFNKLDKTKDGFITVEDLKGVYNVSKHPKYISGERTXXXXXXXXXXXXXAPDEIDGKITKREFLNYYSAVSCSIDNDAYFDLMMRNAYKL 697
            MA T+R NRE+ + +K++L   SDP+E+LRLQCL+RG  GIKGLGR F+I DDD N TLD +EF KG+NDYG  + KEE   +F+  D+D SG +DFDEFLI LRPPM+ +R  +V+QAF KLDKT DG ITVEDLKGVY+V KHPKY++GE TE+++F +FL +F++PD+ DGK+TK EF+NYYS VS SID D YF LMMRNA++L
Sbjct:   40 MAGTSRHNREMMINAKKQLAECSDPIERLRLQCLSRGCAGIKGLGRTFRIMDDDNNRTLDLKEFIKGLNDYGVLMEKEEAINLFQQFDRDGSGQIDFDEFLITLRPPMSNARKEVVLQAFKKLDKTGDGVITVEDLKGVYDVRKHPKYLNGEWTEDQIFRKFLDSFDSPDDKDGKVTKEEFMNYYSGVSASIDTDIYFILMMRNAWRL 247          
BLAST of Calcyphosin protein vs. Ensembl Zebrafish
Match: capsla (calcyphosine-like a [Source:ZFIN;Acc:ZDB-GENE-030131-7291])

HSP 1 Score: 213.772 bits (543), Expect = 2.112e-69
Identity = 103/187 (55.08%), Postives = 142/187 (75.94%), Query Frame = 2
Query:  137 ASDPMEKLRLQCLARGATGIKGLGRAFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVALVIQAFNKLDKTKDGFITVEDLKGVYNVSKHPKYISGERTXXXXXXXXXXXXXAPDEIDGKITKREFLNYYSAVSCSIDNDAYFDLMMRNAYKL 697
            A+D ++ LR QCL+RGA GIKGLGR F+  DDDG+ +LDF+EF +G+ DYG  + +++ Q IF  +DKD SG+++FDEFL  LRPPM+ +R+ ++ QAF K DK+ DG +TVEDL+GVYN   HPKY SGE TE ++F  FL +F++P + DGK+T  EF+NYYS VS S+D+D YF  MM++A+KL
Sbjct:    2 AADALQDLRQQCLSRGAAGIKGLGRMFRSMDDDGSKSLDFQEFVRGLQDYGVSVGRDQAQQIFAMMDKDGSGSINFDEFLEKLRPPMSSARMQVIRQAFQKFDKSGDGVVTVEDLQGVYNSKHHPKYKSGEWTETQVFHSFLDSFDSPHDKDGKVTLEEFVNYYSGVSASVDSDEYFISMMKSAWKL 188          
BLAST of Calcyphosin protein vs. Ensembl Zebrafish
Match: si:rp71-17i16.4 (si:rp71-17i16.4 [Source:ZFIN;Acc:ZDB-GENE-090312-215])

HSP 1 Score: 55.8398 bits (133), Expect = 3.652e-9
Identity = 31/104 (29.81%), Postives = 55/104 (52.88%), Query Frame = 2
Query:  212 AFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVA----LVIQAFNKLDKTKDGFITVEDLKGVYNVSKHP 511
            AF ++D DG   +  +E    +   G + S+EE+  I E +D+D SGT+DF+EFL+ +   + + +       + + F   DK +DGFI  E+   + + +  P
Sbjct:   24 AFDMFDTDGGGDISTKELGTVMRMLGQNPSREELDAIIEEVDEDGSGTIDFEEFLVMMVQQLKEDQAGKSEEELSECFRIFDKNQDGFIDREEFGDILHATGEP 127          
BLAST of Calcyphosin protein vs. Ensembl Zebrafish
Match: CR749762.5 (si:rp71-17i16.4 [Source:NCBI gene;Acc:100002038])

HSP 1 Score: 55.4546 bits (132), Expect = 3.996e-9
Identity = 31/104 (29.81%), Postives = 55/104 (52.88%), Query Frame = 2
Query:  212 AFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVA----LVIQAFNKLDKTKDGFITVEDLKGVYNVSKHP 511
            AF ++D DG   +  +E    +   G + S+EE+  I E +D+D SGT+DF+EFL+ +   + + +       + + F   DK +DGFI  E+   + + +  P
Sbjct:   23 AFDMFDTDGGGDISTKELGTVMRMLGQNPSREELDAIIEEVDEDGSGTIDFEEFLVMMVQQLKEDQAGKSEEELSECFRIFDKNQDGFIDREEFGDILHATGEP 126          
BLAST of Calcyphosin protein vs. Ensembl Zebrafish
Match: calm3a (calmodulin 3a (phosphorylase kinase, delta) [Source:ZFIN;Acc:ZDB-GENE-030131-5590])

HSP 1 Score: 48.9062 bits (115), Expect = 8.063e-7
Identity = 29/95 (30.53%), Postives = 51/95 (53.68%), Query Frame = 2
Query:  209 RAFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVALVI-QAFNKLDKTKDGFITVEDLKGV 490
             AF ++D DG+ T+  +E    +   G + ++ E+Q +   +D D +GT+DF EFL  +   M  +     I +AF   DK  +G+I+  +L+ V
Sbjct:   15 EAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHV 109          
BLAST of Calcyphosin protein vs. Ensembl Xenopus
Match: capsl (calcyphosine like [Source:NCBI gene;Acc:549278])

HSP 1 Score: 251.906 bits (642), Expect = 7.147e-84
Identity = 124/208 (59.62%), Postives = 164/208 (78.85%), Query Frame = 2
Query:   74 MALTNRGNRELQMKSKEKLKSASDPMEKLRLQCLARGATGIKGLGRAFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVALVIQAFNKLDKTKDGFITVEDLKGVYNVSKHPKYISGERTXXXXXXXXXXXXXAPDEIDGKITKREFLNYYSAVSCSIDNDAYFDLMMRNAYKL 697
            M  T R +R++ +++K+ L S +DP+EKLRLQCL+RG+ GIKGLGR F+I DDDGN TLDF+EF+KG++DYG  + K E Q +F   DKD SGT+DFDEFL+ LRPPM+ +R  +++QAF KLDK+ DG +T+EDL+GVYN   HPKY +GE TE+++F  FL NF++P + DG++TK EFLNYYS VS SID+D YF LMMRNA+KL
Sbjct:    1 MPGTARHDRDMALQAKKNLSSCTDPVEKLRLQCLSRGSAGIKGLGRVFRIMDDDGNKTLDFKEFSKGLSDYGVMMDKTETQELFSVFDKDGSGTIDFDEFLVTLRPPMSNARKDMILQAFRKLDKSGDGVVTIEDLRGVYNAKHHPKYQNGEWTEDQVFRSFLDNFDSPYDKDGQVTKDEFLNYYSGVSASIDSDTYFILMMRNAWKL 208          
BLAST of Calcyphosin protein vs. Ensembl Xenopus
Match: capsl (calcyphosine like [Source:NCBI gene;Acc:549278])

HSP 1 Score: 245.358 bits (625), Expect = 2.878e-81
Identity = 120/208 (57.69%), Postives = 161/208 (77.40%), Query Frame = 2
Query:   74 MALTNRGNRELQMKSKEKLKSASDPMEKLRLQCLARGATGIKGLGRAFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVALVIQAFNKLDKTKDGFITVEDLKGVYNVSKHPKYISGERTXXXXXXXXXXXXXAPDEIDGKITKREFLNYYSAVSCSIDNDAYFDLMMRNAYKL 697
            M  T R +R++ +++K+ L S +DP+EKLRLQCL+RG+ GIKGLGR F+I DDDGN TLDF+EF+KG++DYG  + K E Q +F   DKD SGT+DFDEFL+ LRPPM+ +R  +++QAF KLDK+ DG +T+EDL+GVYN   HPKY +GE TE+++F  FL NF++P + DG++T  EF+NYY+ VS SID D YF  MMRNA+KL
Sbjct:    1 MPGTARHDRDMALQAKKNLSSCTDPVEKLRLQCLSRGSAGIKGLGRVFRIMDDDGNKTLDFKEFSKGLSDYGVMMDKTETQELFSVFDKDGSGTIDFDEFLVTLRPPMSNARKDMILQAFRKLDKSGDGVVTIEDLRGVYNAKHHPKYQNGEWTEDQVFRSFLDNFDSPYDKDGQVTPDEFMNYYAGVSASIDTDIYFITMMRNAWKL 208          
BLAST of Calcyphosin protein vs. Ensembl Xenopus
Match: capsl (calcyphosine like [Source:NCBI gene;Acc:549278])

HSP 1 Score: 238.81 bits (608), Expect = 6.599e-79
Identity = 116/198 (58.59%), Postives = 155/198 (78.28%), Query Frame = 2
Query:  104 LQMKSKEKLKSASDPMEKLRLQCLARGATGIKGLGRAFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVALVIQAFNKLDKTKDGFITVEDLKGVYNVSKHPKYISGERTXXXXXXXXXXXXXAPDEIDGKITKREFLNYYSAVSCSIDNDAYFDLMMRNAYKL 697
            + +++K+ L S +DP+EKLRLQCL+RG+ GIKGLGR F+I DDDGN TLDF+EF+KG++DYG  + K E Q +F   DKD SGT+DFDEFL+ LRPPM+ +R  +++QAF KLDK+ DG +T+EDL+GVYN   HPKY +GE TE+++F  FL NF++P + DG++T  EF+NYY+ VS SID D YF  MMRNA+KL
Sbjct:    1 MALQAKKNLSSCTDPVEKLRLQCLSRGSAGIKGLGRVFRIMDDDGNKTLDFKEFSKGLSDYGVMMDKTETQELFSVFDKDGSGTIDFDEFLVTLRPPMSNARKDMILQAFRKLDKSGDGVVTIEDLRGVYNAKHHPKYQNGEWTEDQVFRSFLDNFDSPYDKDGQVTPDEFMNYYAGVSASIDTDIYFITMMRNAWKL 198          
BLAST of Calcyphosin protein vs. Ensembl Xenopus
Match: caps (calcyphosine [Source:NCBI gene;Acc:100037881])

HSP 1 Score: 219.935 bits (559), Expect = 2.502e-71
Identity = 110/208 (52.88%), Postives = 153/208 (73.56%), Query Frame = 2
Query:   74 MALTNRGNRELQMKSKEKLKSASDPMEKLRLQCLARGATGIKGLGRAFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVALVIQAFNKLDKTKDGFITVEDLKGVYNVSKHPKYISGERTXXXXXXXXXXXXXAPDEIDGKITKREFLNYYSAVSCSIDNDAYFDLMMRNAYKL 697
            MA   +  RE+  K++ +     DP+EKLRLQCLARGA+GIKGLGRAF+I DD+ ++TLD  EF+KG+ ++G  L   EV  IF   D + +GT++FDEFLI++RPPM+ +R  +++ AF K+D+T DG IT+EDLKGVYN   H KY +GE  E ++F  FL NF++P+  DG++T+ EFLNYYS VS SID+DAYF +MM+N +K+
Sbjct:    1 MASMTQLEREMMAKAQRQYPQCQDPVEKLRLQCLARGASGIKGLGRAFRIMDDNRSSTLDLEEFSKGLQNFGISLQPSEVLDIFHQFDTNGNGTINFDEFLISIRPPMSNARRQVILDAFKKMDRTGDGVITIEDLKGVYNPKFHQKYRNGEWNERQVFQNFLDNFDSPNNKDGQVTEEEFLNYYSGVSASIDSDAYFVVMMKNEWKI 208          
BLAST of Calcyphosin protein vs. Ensembl Xenopus
Match: ENSXETT00000016513.1 (calcyphosine 2 [Source:NCBI gene;Acc:100380015])

HSP 1 Score: 83.5741 bits (205), Expect = 6.212e-19
Identity = 55/172 (31.98%), Postives = 95/172 (55.23%), Query Frame = 2
Query:  176 ARGATGIKGLGRAFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVALVIQAFNKLDKTKDGFITVEDLKGVYNVSKHPKYISGERTXXXXXXXXXXXXXAPDEIDGKITKREFLNYYSAVSCSIDNDAYFDLMMRNAY 691
            +RG   + GLG+ F+  D++G+  L   +F + +  +  D+S+E  +  ++ LD+   G LD+ +F  AL   M + R   V +AF KLD  K G I + D++  Y   KHP+ +SG  +EEE+   FLK  +A      +++  EF ++Y  +S  I +D  F  ++RN++
Sbjct:   11 SRGVQTLTGLGKFFRQVDENGDGILQKAKFKQALKVFHLDVSEEIFESFWKILDEKHEGKLDYGKFTRALIGEMNEYRKTFVQKAFMKLDPNKSGIIPMIDIRKFYCARKHPQVLSGHSSEEEILSSFLKTLQAACRNPKEVSYCEFEDFYEGLSIEILSDNDFINILRNSW 182          
BLAST of Calcyphosin protein vs. Ensembl Mouse
Match: Capsl (calcyphosine-like [Source:MGI Symbol;Acc:MGI:1922818])

HSP 1 Score: 240.35 bits (612), Expect = 1.988e-79
Identity = 119/208 (57.21%), Postives = 162/208 (77.88%), Query Frame = 2
Query:   74 MALTNRGNRELQMKSKEKLKSASDPMEKLRLQCLARGATGIKGLGRAFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVALVIQAFNKLDKTKDGFITVEDLKGVYNVSKHPKYISGERTXXXXXXXXXXXXXAPDEIDGKITKREFLNYYSAVSCSIDNDAYFDLMMRNAYKL 697
            MA T R +RE+ ++SK+KL +A+DP+E+LRLQCLARG+ GIKGLGR F+I DD+ N TLDF+EF KG+NDY   + KEE + +F+  D+D SGT+DF+EFL+ LRPPM+++R  ++++AF KLDKT DG IT+EDL+ VYN   HPKY +GE TEE++F +FL NF++P + DG +T  EF+NYY+ VS SID D YF +MM  A+KL
Sbjct:    1 MAGTARHDREMAIQSKKKLSTATDPIERLRLQCLARGSAGIKGLGRVFRIMDDNNNRTLDFKEFLKGLNDYAVVMEKEEAEELFQRFDRDGSGTIDFNEFLLTLRPPMSRARKEVIMKAFRKLDKTGDGVITIEDLREVYNAKHHPKYQNGEWTEEQVFRKFLDNFDSPYDKDGLVTPEEFMNYYAGVSASIDTDVYFIIMMTTAWKL 208          
BLAST of Calcyphosin protein vs. Ensembl Mouse
Match: Capsl (calcyphosine-like [Source:MGI Symbol;Acc:MGI:1922818])

HSP 1 Score: 135.961 bits (341), Expect = 1.375e-39
Identity = 62/105 (59.05%), Postives = 84/105 (80.00%), Query Frame = 2
Query:   74 MALTNRGNRELQMKSKEKLKSASDPMEKLRLQCLARGATGIKGLGRAFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALR 388
            MA T R +RE+ ++SK+KL +A+DP+E+LRLQCLARG+ GIKGLGR F+I DD+ N TLDF+EF KG+NDY   + KEE + +F+  D+D SGT+DF+EFL+ LR
Sbjct:    1 MAGTARHDREMAIQSKKKLSTATDPIERLRLQCLARGSAGIKGLGRVFRIMDDNNNRTLDFKEFLKGLNDYAVVMEKEEAEELFQRFDRDGSGTIDFNEFLLTLR 105          
BLAST of Calcyphosin protein vs. Ensembl Mouse
Match: Caps2 (calcyphosphine 2 [Source:MGI Symbol;Acc:MGI:2441980])

HSP 1 Score: 77.0258 bits (188), Expect = 2.154e-15
Identity = 55/186 (29.57%), Postives = 100/186 (53.76%), Query Frame = 2
Query:  149 MEKLRLQCLARGATGIKGLGRAFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQ---FIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVALVIQAFNKLDKTKDGFITVEDLKGVYNVSKHPKYISGERTXXXXXXXXXXXXXAPDEIDGKITKREFLNYYSAVSCSIDNDAYFDLMMRNAYKL 697
             +KL+ Q   +GA  + GLGR F+  D +GN  L+  +F + +  +  ++S+++ +    I +G    K+  +D+ EF  A+   M + R + V +AF +LD  K G ++V D++  Y   KHP+ ISG  TEEE+   FL+  +       +++  EF +YY  +S  +  D  F  ++R  +++
Sbjct:  408 QDKLKEQLHKKGARILTGLGRYFQGLDKEGNGLLEKADFQQALKTFHLEVSEQDFESFWLILQGYGHSKN-KVDYGEFKRAIFGEMNEYRKSFVRKAFMQLDFNKTGIVSVIDIRKCYCAKKHPRVISGHSTEEEIKSSFLETLKGTCSKCDEVSYGEFEDYYEGLSIGVAGDEDFVNILRIPWRI 592          
BLAST of Calcyphosin protein vs. Ensembl Mouse
Match: Caps2 (calcyphosphine 2 [Source:MGI Symbol;Acc:MGI:2441980])

HSP 1 Score: 77.0258 bits (188), Expect = 2.273e-15
Identity = 55/186 (29.57%), Postives = 100/186 (53.76%), Query Frame = 2
Query:  149 MEKLRLQCLARGATGIKGLGRAFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQ---FIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVALVIQAFNKLDKTKDGFITVEDLKGVYNVSKHPKYISGERTXXXXXXXXXXXXXAPDEIDGKITKREFLNYYSAVSCSIDNDAYFDLMMRNAYKL 697
             +KL+ Q   +GA  + GLGR F+  D +GN  L+  +F + +  +  ++S+++ +    I +G    K+  +D+ EF  A+   M + R + V +AF +LD  K G ++V D++  Y   KHP+ ISG  TEEE+   FL+  +       +++  EF +YY  +S  +  D  F  ++R  +++
Sbjct:  366 QDKLKEQLHKKGARILTGLGRYFQGLDKEGNGLLEKADFQQALKTFHLEVSEQDFESFWLILQGYGHSKN-KVDYGEFKRAIFGEMNEYRKSFVRKAFMQLDFNKTGIVSVIDIRKCYCAKKHPRVISGHSTEEEIKSSFLETLKGTCSKCDEVSYGEFEDYYEGLSIGVAGDEDFVNILRIPWRI 550          
BLAST of Calcyphosin protein vs. Ensembl Mouse
Match: Tnnc2 (troponin C2, fast [Source:MGI Symbol;Acc:MGI:98780])

HSP 1 Score: 55.4546 bits (132), Expect = 4.271e-9
Identity = 34/102 (33.33%), Postives = 53/102 (51.96%), Query Frame = 2
Query:  212 AFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMT-----KSRVALVIQAFNKLDKTKDGFITVEDLKGVYNVS 502
            AF ++D DG   +  +E    +   G   +KEE+  I E +D+D SGT+DF+EFL+ +   M      KS   L  + F   D+  DG+I  E+L  ++  S
Sbjct:   23 AFDMFDADGGGDISVKELGTVMRMLGQTPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMKEDAKGKSEEELA-ECFRIFDRNADGYIDAEELAEIFRAS 123          
BLAST of Calcyphosin protein vs. UniProt/SwissProt
Match: sp|Q6P8Y1|CAPSL_MOUSE (Calcyphosin-like protein OS=Mus musculus OX=10090 GN=Capsl PE=2 SV=4)

HSP 1 Score: 240.35 bits (612), Expect = 1.391e-78
Identity = 119/208 (57.21%), Postives = 162/208 (77.88%), Query Frame = 2
Query:   74 MALTNRGNRELQMKSKEKLKSASDPMEKLRLQCLARGATGIKGLGRAFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVALVIQAFNKLDKTKDGFITVEDLKGVYNVSKHPKYISGERTXXXXXXXXXXXXXAPDEIDGKITKREFLNYYSAVSCSIDNDAYFDLMMRNAYKL 697
            MA T R +RE+ ++SK+KL +A+DP+E+LRLQCLARG+ GIKGLGR F+I DD+ N TLDF+EF KG+NDY   + KEE + +F+  D+D SGT+DF+EFL+ LRPPM+++R  ++++AF KLDKT DG IT+EDL+ VYN   HPKY +GE TEE++F +FL NF++P + DG +T  EF+NYY+ VS SID D YF +MM  A+KL
Sbjct:    1 MAGTARHDREMAIQSKKKLSTATDPIERLRLQCLARGSAGIKGLGRVFRIMDDNNNRTLDFKEFLKGLNDYAVVMEKEEAEELFQRFDRDGSGTIDFNEFLLTLRPPMSRARKEVIMKAFRKLDKTGDGVITIEDLREVYNAKHHPKYQNGEWTEEQVFRKFLDNFDSPYDKDGLVTPEEFMNYYAGVSASIDTDVYFIIMMTTAWKL 208          
BLAST of Calcyphosin protein vs. UniProt/SwissProt
Match: sp|Q8WWF8|CAPSL_HUMAN (Calcyphosin-like protein OS=Homo sapiens OX=9606 GN=CAPSL PE=2 SV=4)

HSP 1 Score: 233.802 bits (595), Expect = 5.453e-76
Identity = 121/208 (58.17%), Postives = 163/208 (78.37%), Query Frame = 2
Query:   74 MALTNRGNRELQMKSKEKLKSASDPMEKLRLQCLARGATGIKGLGRAFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVALVIQAFNKLDKTKDGFITVEDLKGVYNVSKHPKYISGERTXXXXXXXXXXXXXAPDEIDGKITKREFLNYYSAVSCSIDNDAYFDLMMRNAYKL 697
            MA T R +RE+ +++K+KL +A+DP+E+LRLQCLARG+ GIKGLGR F+I DDD N TLDF+EF KG+NDY   + KEEV+ +F   DKD +GT+DF+EFL+ LRPPM+++R  +++QAF KLDKT DG IT+EDL+ VYN   HPKY +GE +EE++F +FL NF++P + DG +T  EF+NYY+ VS SID D YF +MMR A+KL
Sbjct:    1 MAGTARHDREMAIQAKKKLTTATDPIERLRLQCLARGSAGIKGLGRVFRIMDDDNNRTLDFKEFMKGLNDYAVVMEKEEVEELFRRFDKDGNGTIDFNEFLLTLRPPMSRARKEVIMQAFRKLDKTGDGVITIEDLREVYNAKHHPKYQNGEWSEEQVFRKFLDNFDSPYDKDGLVTPEEFMNYYAGVSASIDTDVYFIIMMRTAWKL 208          
BLAST of Calcyphosin protein vs. UniProt/SwissProt
Match: sp|Q0VCC0|CAYP1_BOVIN (Calcyphosin OS=Bos taurus OX=9913 GN=CAPS PE=2 SV=1)

HSP 1 Score: 172.555 bits (436), Expect = 2.522e-52
Identity = 92/183 (50.27%), Postives = 128/183 (69.95%), Query Frame = 2
Query:  149 MEKLRLQCLARGATGIKGLGRAFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVALVIQAFNKLDKTKDGFITVEDLKGVYNVSKHPKYISGERTXXXXXXXXXXXXXAPDEIDGKITKREFLNYYSAVSCSIDNDAYFDLMMRNAYKL 697
            MEKLR QCL+RGA+GI+G+ R F+  D DG+ +LD RE  +G+ + G  L   E++ +    D+D SGTLD +EFL ALRPPM+++R A+V  AF KLD++ DG +TV+DL+GVY+   HPK  SGE TEE++   FL NF++  E DG++T  EF +YYS VS S+D D  F  MM +A++L
Sbjct:    8 MEKLRAQCLSRGASGIQGVARFFRRLDQDGSRSLDVRELQRGLAELGLVLDTAEMEGVCRRWDRDGSGTLDLEEFLRALRPPMSQAREAVVTAAFAKLDRSGDGVVTVDDLRGVYSGRTHPKVRSGEWTEEQVLRHFLDNFDSS-EKDGQVTLAEFQDYYSGVSASMDTDEEFVAMMTSAWRL 189          
BLAST of Calcyphosin protein vs. UniProt/SwissProt
Match: sp|Q13938|CAYP1_HUMAN (Calcyphosin OS=Homo sapiens OX=9606 GN=CAPS PE=1 SV=2)

HSP 1 Score: 166.392 bits (420), Expect = 7.372e-49
Identity = 90/183 (49.18%), Postives = 127/183 (69.40%), Query Frame = 2
Query:  149 MEKLRLQCLARGATGIKGLGRAFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVALVIQAFNKLDKTKDGFITVEDLKGVYNVSKHPKYISGERTXXXXXXXXXXXXXAPDEIDGKITKREFLNYYSAVSCSIDNDAYFDLMMRNAYKL 697
            MEKLR QCL+RGA+GI+GL R F+  D DG+ +LD  EF +G+   G  L + E + +    D++ SGTLD +EFL ALRPPM+++R A++  AF KLD++ DG +TV+DL+GVY+   HPK  SGE TE+E+   FL NF++  E DG++T  EF +YYS VS S++ D  F  MM +A++L
Sbjct:   94 MEKLRAQCLSRGASGIQGLARFFRQLDRDGSRSLDADEFRQGLAKLGLVLDQAEAEGVCRKWDRNGSGTLDLEEFLRALRPPMSQAREAVIAAAFAKLDRSGDGVVTVDDLRGVYSGRAHPKVRSGEWTEDEVLRRFLDNFDS-SEKDGQVTLAEFQDYYSGVSASMNTDEEFVAMMTSAWQL 275          
BLAST of Calcyphosin protein vs. UniProt/SwissProt
Match: sp|P41150|CAYP1_RABIT (Calcyphosin OS=Oryctolagus cuniculus OX=9986 GN=CAPS PE=1 SV=1)

HSP 1 Score: 161.77 bits (408), Expect = 3.846e-48
Identity = 89/190 (46.84%), Postives = 127/190 (66.84%), Query Frame = 2
Query:  128 LKSASDPMEKLRLQCLARGATGIKGLGRAFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVALVIQAFNKLDKTKDGFITVEDLKGVYNVSKHPKYISGERTXXXXXXXXXXXXXAPDEIDGKITKREFLNYYSAVSCSIDNDAYFDLMMRNAYKL 697
            + +A   +EKLR QCLARGA GI+GL R F+  D DG+ +LD  E  +G+   G  L + E Q +    D++ SGTLD +EFL ALRPPM+++R A++  AF KLD++ DG +T+ DL+GVY+   HPK  +GE TE+E+   FL NF++  E DG++T  EF +YYS +S S+D D  F  MM +A++L
Sbjct:    1 MDTADAIVEKLRAQCLARGAAGIQGLARFFRRLDRDGSRSLDAGELRQGLAKLGLALDEAEAQSVCRRWDRNGSGTLDLEEFLRALRPPMSQAREAVIAAAFAKLDRSGDGVVTLGDLRGVYSGRNHPKVRTGEWTEDEVLRRFLDNFDSS-EKDGQVTLAEFQDYYSGLSASVDTDEEFVAMMSSAWQL 189          
BLAST of Calcyphosin protein vs. TrEMBL
Match: A0A564YA36 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS3682 PE=4 SV=1)

HSP 1 Score: 274.248 bits (700), Expect = 1.993e-89
Identity = 139/208 (66.83%), Postives = 174/208 (83.65%), Query Frame = 2
Query:   74 MALTNRGNRELQMKSKEKLKSASDPMEKLRLQCLARGATGIKGLGRAFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVALVIQAFNKLDKTKDGFITVEDLKGVYNVSKHPKYISGERTXXXXXXXXXXXXXAPDEIDGKITKREFLNYYSAVSCSIDNDAYFDLMMRNAYKL 697
            MA+T RG+ +L++K+K+K++S++DP+EKLRL CLARG +GI GLGR F+I DD+G+  LD REF KG  D+G DL+KEE++ +FE LDKD SG +DFDEFL ALRPPM K R+ L+ QAFNK+D+T+DG+IT EDLKGVYN   HPKY +GE TEE++F EFLK FEAP+EIDGK+TK EFLNYY+ VS SIDN+AYFDLMMRNAYKL
Sbjct:    1 MAITARGDYQLKLKAKQKIQSSTDPVEKLRLNCLARGGSGILGLGRQFRIIDDNGDKKLDMREFTKGCQDFGIDLTKEEIREVFEHLDKDGSGHIDFDEFLEALRPPMPKCRLELINQAFNKMDRTRDGYITAEDLKGVYNCKFHPKYRNGEWTEEQVFNEFLKKFEAPNEIDGKVTKSEFLNYYAGVSASIDNNAYFDLMMRNAYKL 208          
BLAST of Calcyphosin protein vs. TrEMBL
Match: A0A068YA96 (Calcyphosin protein OS=Echinococcus multilocularis OX=6211 PE=4 SV=1)

HSP 1 Score: 272.707 bits (696), Expect = 7.889e-89
Identity = 141/208 (67.79%), Postives = 171/208 (82.21%), Query Frame = 2
Query:   74 MALTNRGNRELQMKSKEKLKSASDPMEKLRLQCLARGATGIKGLGRAFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVALVIQAFNKLDKTKDGFITVEDLKGVYNVSKHPKYISGERTXXXXXXXXXXXXXAPDEIDGKITKREFLNYYSAVSCSIDNDAYFDLMMRNAYKL 697
            MALT+RG+ +L++K+K+K++  + P+EKLRLQCLARG TGI GLGR F+I DDDGN  LD REF KG  D+G DL+KEEV+ IFE LDKD SG +DFDEFL ALRPPM K RV L+ QAF K+D+++DG+IT EDL+GVYN   HPKY +GE TEE++F EFL+ FEAP EIDGK+TK EFLNYY+ VS SIDN+AYFDLMMRNAYKL
Sbjct:    1 MALTSRGDYQLKLKAKKKVQETTSPLEKLRLQCLARGGTGILGLGRQFRIIDDDGNKLLDLREFTKGCADFGVDLTKEEVKEIFELLDKDGSGHIDFDEFLEALRPPMPKCRVDLINQAFMKMDRSRDGYITAEDLRGVYNCKFHPKYRNGEWTEEQVFEEFLRKFEAPAEIDGKVTKSEFLNYYAGVSASIDNNAYFDLMMRNAYKL 208          
BLAST of Calcyphosin protein vs. TrEMBL
Match: U6J8X4 (Calcyphosin protein OS=Echinococcus granulosus OX=6210 GN=EGR_04400 PE=4 SV=1)

HSP 1 Score: 272.322 bits (695), Expect = 1.071e-88
Identity = 141/208 (67.79%), Postives = 171/208 (82.21%), Query Frame = 2
Query:   74 MALTNRGNRELQMKSKEKLKSASDPMEKLRLQCLARGATGIKGLGRAFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVALVIQAFNKLDKTKDGFITVEDLKGVYNVSKHPKYISGERTXXXXXXXXXXXXXAPDEIDGKITKREFLNYYSAVSCSIDNDAYFDLMMRNAYKL 697
            MALT+RG+ +L++K+K+K++  + P+EKLRLQCLARG TGI GLGR F+I DDDGN  LD REF KG  D+G DL+KEEV+ IFE LDKD SG +DFDEFL ALRPPM K RV L+ QAF K+D+++DG+IT EDL+GVYN   HPKY +GE TEE++F EFL+ FEAP EIDGK+TK EFLNYY+ VS SIDN+AYFDLMMRNAYKL
Sbjct:    1 MALTSRGDYQLKLKAKKKVQETTSPLEKLRLQCLARGGTGILGLGRQFRIIDDDGNKLLDLREFTKGCADFGVDLTKEEVKEIFELLDKDGSGYIDFDEFLEALRPPMPKCRVDLINQAFMKMDRSRDGYITAEDLRGVYNCKFHPKYRNGEWTEEQVFEEFLRKFEAPAEIDGKVTKSEFLNYYAGVSASIDNNAYFDLMMRNAYKL 208          
BLAST of Calcyphosin protein vs. TrEMBL
Match: T2M8P3 (Calcyphosin-like protein OS=Hydra vulgaris OX=6087 GN=CAPSL PE=2 SV=1)

HSP 1 Score: 270.781 bits (691), Expect = 3.484e-88
Identity = 133/208 (63.94%), Postives = 164/208 (78.85%), Query Frame = 2
Query:   74 MALTNRGNRELQMKSKEKLKSASDPMEKLRLQCLARGATGIKGLGRAFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVALVIQAFNKLDKTKDGFITVEDLKGVYNVSKHPKYISGERTXXXXXXXXXXXXXAPDEIDGKITKREFLNYYSAVSCSIDNDAYFDLMMRNAYKL 697
            M +TNR N  L+  +   L   +DP+EKLRL CL+RGA GIKGLGR FKI+DDDG+ TLDF+EF+KG+ DYG  L  +EV+ IF+  DKDKS  LDFDEFL+ALRPPM+ +R A++ +AFNKLDK+ DGF+TVEDLKG YNV+KHPKY+SGE TE++ + +FL  F+ PD  DG IT  EF+NYYS VS SIDNDAYFDLMMRNAYK+
Sbjct:    1 MPVTNRTNEALKRSATSALNKTTDPIEKLRLACLSRGAAGIKGLGRTFKIFDDDGSRTLDFKEFSKGLRDYGLHLEPQEVKEIFDAFDKDKSQQLDFDEFLLALRPPMSNARKAIISKAFNKLDKSGDGFVTVEDLKGTYNVTKHPKYLSGEWTEDQCYRQFLDAFDTPDSCDGTITLEEFINYYSGVSASIDNDAYFDLMMRNAYKI 208          
BLAST of Calcyphosin protein vs. TrEMBL
Match: A0A0R3VXY1 (Uncharacterized protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS2276 PE=4 SV=1)

HSP 1 Score: 263.848 bits (673), Expect = 3.029e-85
Identity = 138/219 (63.01%), Postives = 172/219 (78.54%), Query Frame = 2
Query:   74 MALTNRGNRELQMKSKEKLKSASDPMEKLRLQCLARGATGIKGLGRAFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVALVIQAFNKLDKTKDGFITV-----------EDLKGVYNVSKHPKYISGERTXXXXXXXXXXXXXAPDEIDGKITKREFLNYYSAVSCSIDNDAYFDLMMRNAYKL 697
            MA+T+RG+ +L++K+++K++  + P+EKLRLQCLARG +GI GLGR F+I DDDGN  LD REF KG  D+G DL+KEEV+ IFE LD+D SG +DFDEFL ALRPPM K R+ LV QAF K+D+++DGFITV           EDL+GVYN   HPKY +GE TEE++F EFL+ FEAP EIDGK+TK EF+NYY+ VS SIDN+AYFDLMMRNAYKL
Sbjct:    1 MAITSRGDYQLKLKARKKIQETTSPLEKLRLQCLARGGSGILGLGRQFRIMDDDGNKLLDLREFTKGCADFGADLTKEEVKEIFELLDRDGSGHIDFDEFLEALRPPMPKCRIDLVNQAFMKMDRSRDGFITVSFLRLTYRKLAEDLRGVYNCKFHPKYKNGEWTEEQVFEEFLRKFEAPSEIDGKVTKSEFMNYYAGVSASIDNNAYFDLMMRNAYKL 219          
BLAST of Calcyphosin protein vs. Ensembl Cavefish
Match: capslb (calcyphosine like [Source:NCBI gene;Acc:103021302])

HSP 1 Score: 240.35 bits (612), Expect = 1.630e-79
Identity = 121/208 (58.17%), Postives = 162/208 (77.88%), Query Frame = 2
Query:   74 MALTNRGNRELQMKSKEKLKSASDPMEKLRLQCLARGATGIKGLGRAFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVALVIQAFNKLDKTKDGFITVEDLKGVYNVSKHPKYISGERTXXXXXXXXXXXXXAPDEIDGKITKREFLNYYSAVSCSIDNDAYFDLMMRNAYKL 697
            MA T+R +R++ + +K++L  A+DP+E+LRLQCLARG+ GIKGLGR F+I DDD +  L+ +EF KG+NDYG  + K+E   +F   DKD SG +DFDEFLI LRPPM+ +R  +++QAF KLDKT DG ITVEDL+GVYNV  HPKY +GE TE+++F +FL +F++ D+ DGK+TK EF+NYYS VS SID+D YF LMM+ A+KL
Sbjct:    1 MAGTSRHDRQMAIDAKKRLSEATDPVERLRLQCLARGSAGIKGLGRVFRIMDDDNSRNLELKEFMKGLNDYGIMMEKDEAMELFRTFDKDGSGQIDFDEFLITLRPPMSNARKEVIMQAFRKLDKTGDGVITVEDLRGVYNVKNHPKYQNGEWTEDQIFRKFLDSFDSDDK-DGKVTKEEFVNYYSGVSASIDSDVYFILMMKTAWKL 207          
BLAST of Calcyphosin protein vs. Ensembl Cavefish
Match: capslb (calcyphosine like [Source:NCBI gene;Acc:103021302])

HSP 1 Score: 239.195 bits (609), Expect = 3.941e-79
Identity = 119/208 (57.21%), Postives = 162/208 (77.88%), Query Frame = 2
Query:   74 MALTNRGNRELQMKSKEKLKSASDPMEKLRLQCLARGATGIKGLGRAFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVALVIQAFNKLDKTKDGFITVEDLKGVYNVSKHPKYISGERTXXXXXXXXXXXXXAPDEIDGKITKREFLNYYSAVSCSIDNDAYFDLMMRNAYKL 697
            MA T+R +R++ + +K++L  A+DP+E+LRLQCLARG+ GIKGLGR F+I DDD +  L+ +EF KG+NDYG  + K+E   +F   DKD SG +DFDEFLI LRPPM+ +R  +++QAF KLDKT DG ITVEDL+GVYNV  HPKY +GE TE+++F +FL +F++ D+ DGK+T+ EF+NYY+ VS SID D YF +MM+NA+KL
Sbjct:    1 MAGTSRHDRQMAIDAKKRLSEATDPVERLRLQCLARGSAGIKGLGRVFRIMDDDNSRNLELKEFMKGLNDYGIMMEKDEAMELFRTFDKDGSGQIDFDEFLITLRPPMSNARKEVIMQAFRKLDKTGDGVITVEDLRGVYNVKNHPKYQNGEWTEDQIFRKFLDSFDSDDK-DGKVTQEEFMNYYAGVSASIDTDVYFIVMMKNAWKL 207          
BLAST of Calcyphosin protein vs. Ensembl Cavefish
Match: capsla (calcyphosin-like protein [Source:NCBI gene;Acc:103033765])

HSP 1 Score: 218.779 bits (556), Expect = 2.251e-71
Identity = 109/186 (58.60%), Postives = 144/186 (77.42%), Query Frame = 2
Query:  140 SDPMEKLRLQCLARGATGIKGLGRAFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVALVIQAFNKLDKTKDGFITVEDLKGVYNVSKHPKYISGERTXXXXXXXXXXXXXAPDEIDGKITKREFLNYYSAVSCSIDNDAYFDLMMRNAYKL 697
            +D +E+LR QCL+RGA GIKGLGR F+I DDDG+ +L+ +EF KG+  YG ++  E+ + IF  +DKD+SGT+DF+EFL  LRPPM+ +RV ++ QAF KLD T DG +T+EDL+GVYN   HPKY SGE TEE++F  FL +F++P E DGK+T  EF+NYYS VS SID+DAYF  MM+NA+KL
Sbjct:    2 ADVLEELRQQCLSRGAAGIKGLGRTFRIMDDDGSKSLNLQEFQKGLETYGVNVGLEKAKQIFTIIDKDRSGTIDFNEFLEKLRPPMSSTRVQVIKQAFQKLDSTGDGLVTIEDLQGVYNSKHHPKYKSGEWTEEQVFRSFLDSFDSPYEKDGKVTLEEFVNYYSGVSASIDDDAYFVTMMQNAWKL 187          
BLAST of Calcyphosin protein vs. Ensembl Cavefish
Match: si:rp71-17i16.4 (troponin C, skeletal muscle [Source:NCBI gene;Acc:103044939])

HSP 1 Score: 53.5286 bits (127), Expect = 2.008e-8
Identity = 31/104 (29.81%), Postives = 53/104 (50.96%), Query Frame = 2
Query:  212 AFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVA----LVIQAFNKLDKTKDGFITVEDLKGVYNVSKHP 511
            AF ++D DG   +  +E    +   G + S+EE+  I E +D+D SGT+DF+EFL+ +   + + +       + + F   DK  DGFI  E+   +   +  P
Sbjct:   24 AFDMFDTDGGGDISTKELGTVMRMLGQNPSREELDAIIEEVDEDGSGTIDFEEFLVMMVQQLKEDQAGKSEEELSECFRVFDKNGDGFIDREEFGDIMRSTGEP 127          
BLAST of Calcyphosin protein vs. Ensembl Cavefish
Match: si:rp71-17i16.4 (troponin C, skeletal muscle [Source:NCBI gene;Acc:103044939])

HSP 1 Score: 54.299 bits (129), Expect = 2.036e-8
Identity = 31/104 (29.81%), Postives = 53/104 (50.96%), Query Frame = 2
Query:  212 AFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVA----LVIQAFNKLDKTKDGFITVEDLKGVYNVSKHP 511
            AF ++D DG   +  +E    +   G + S+EE+  I E +D+D SGT+DF+EFL+ +   + + +       + + F   DK  DGFI  E+   +   +  P
Sbjct:   64 AFDMFDTDGGGDISTKELGTVMRMLGQNPSREELDAIIEEVDEDGSGTIDFEEFLVMMVQQLKEDQAGKSEEELSECFRVFDKNGDGFIDREEFGDIMRSTGEP 167          
BLAST of Calcyphosin protein vs. Ensembl Sea Lamprey
Match: si:rp71-17i16.4 (si:rp71-17i16.4 [Source:ZFIN;Acc:ZDB-GENE-090312-215])

HSP 1 Score: 54.299 bits (129), Expect = 2.190e-9
Identity = 33/97 (34.02%), Postives = 52/97 (53.61%), Query Frame = 2
Query:  212 AFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVAL----VIQAFNKLDKTKDGFITVEDLKGV 490
            AF ++D DG   +   E  K +   G   +KEE+  I E +D+D SGT+DF+EFL+ +   M +         + +AF  LD   DG+I  ++LK +
Sbjct:   28 AFDMFDADGGGDISTSELGKVMKLLGQTPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMKEESAGQTEEELAEAFRILDTNGDGYIDRDELKDI 124          
BLAST of Calcyphosin protein vs. Ensembl Sea Lamprey
Match: CETN1 (centrin 1 [Source:HGNC Symbol;Acc:HGNC:1866])

HSP 1 Score: 51.9878 bits (123), Expect = 1.895e-8
Identity = 30/94 (31.91%), Postives = 53/94 (56.38%), Query Frame = 2
Query:  212 AFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMT-KSRVALVIQAFNKLDKTKDGFITVEDLKGV 490
            AF ++D DG+ T+D +E    +   G +  KEE++ +    DKD SG ++F++FL  +   M+ K     +++AF   D  + G I+ ++LK V
Sbjct:   47 AFDLFDADGSGTIDVKELKVAMRALGFEPKKEEIKKMIADFDKDGSGKINFNDFLAMMTQKMSEKDSREEILKAFRLFDDDETGKISFKNLKRV 140          
BLAST of Calcyphosin protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006008.1 (pep scaffold:Pmarinus_7.0:GL476713:142259:146509:-1 gene:ENSPMAG00000005430.1 transcript:ENSPMAT00000006008.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 49.2914 bits (116), Expect = 8.575e-8
Identity = 30/100 (30.00%), Postives = 52/100 (52.00%), Query Frame = 2
Query:  194 IKGLGRAFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVALVI-QAFNKLDKTKDGFITVEDLKGV 490
            I     AF ++D DG+ T+  +E    +   G + ++ E+Q +   +D D +GT+DF EFL  +   M  +     I +AF   DK  +G+I+  +L+ V
Sbjct:   10 IAEFKEAFSLFDKDGDGTITVKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHV 109          
BLAST of Calcyphosin protein vs. Ensembl Sea Lamprey
Match: CALML3 (calmodulin like 3 [Source:HGNC Symbol;Acc:HGNC:1452])

HSP 1 Score: 48.521 bits (114), Expect = 1.418e-7
Identity = 30/100 (30.00%), Postives = 52/100 (52.00%), Query Frame = 2
Query:  194 IKGLGRAFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVALVI-QAFNKLDKTKDGFITVEDLKGV 490
            I     AF ++D DG+ T+  +E    +   G + ++ E+Q +   +D D +GT+DF EFL  +   M  +     I +AF   DK  +G+I+  +L+ V
Sbjct:   10 IAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHV 109          
BLAST of Calcyphosin protein vs. Ensembl Sea Lamprey
Match: CALM3 (calmodulin 3 [Source:HGNC Symbol;Acc:HGNC:1449])

HSP 1 Score: 48.521 bits (114), Expect = 1.431e-7
Identity = 30/100 (30.00%), Postives = 52/100 (52.00%), Query Frame = 2
Query:  194 IKGLGRAFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVALVI-QAFNKLDKTKDGFITVEDLKGV 490
            I     AF ++D DG+ T+  +E    +   G + ++ E+Q +   +D D +GT+DF EFL  +   M  +     I +AF   DK  +G+I+  +L+ V
Sbjct:   10 IAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHV 109          
BLAST of Calcyphosin protein vs. Ensembl Yeast
Match: CMD1 (Calmodulin; Ca2+ binding protein that regulates Ca2+ independent processes (mitosis, bud growth, actin organization, endocytosis, etc.) and Ca2+ dependent processes (stress-activated pathways), targets include Nuf1p, Myo2p and calcineurin; binds to the Hog1p MAPK in response to hyperosmotic stress; potentiates membrane tubulation and constriction mediated by the Rvs161p-Rvs167p complex; human CALM1 or CALM2 functionally complement repression induced inviability [Source:SGD;Acc:S000000313])

HSP 1 Score: 42.743 bits (99), Expect = 8.872e-6
Identity = 30/97 (30.93%), Postives = 47/97 (48.45%), Query Frame = 2
Query:  209 RAFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVAL--VIQAFNKLDKTKDGFITVEDLKGVY 493
             AF ++D D N ++   E    +   G   S+ EV  +   +D D +  ++F EFL AL     KS  +   +++AF   DK  DG I+  +LK V 
Sbjct:   15 EAFALFDKDNNGSISSSELATVMRSLGLSPSEAEVNDLMNEIDVDGNHQIEFSEFL-ALMSRQLKSNDSEQELLEAFKVFDKNGDGLISAAELKHVL 110          
BLAST of Calcyphosin protein vs. Ensembl Nematostella
Match: EDO32961 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STK4])

HSP 1 Score: 250.751 bits (639), Expect = 4.425e-84
Identity = 133/208 (63.94%), Postives = 156/208 (75.00%), Query Frame = 2
Query:   74 MALTNRGNRELQMKSKEKLKSASDPMEKLRLQCLARGATGIKGLGRAFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVALVIQAFNKLDKTKDGFITVEDLKGVYNVSKHPKYISGERTXXXXXXXXXXXXXAPDEIDGKITKREFLNYYSAVSCSIDNDAYFDLMMRNAYKL 697
            MA T R  +EL  K K+      DP+E LRL CL+RG++GIKGLGR FKI DDDGN +LDF EF KG+ DYG  L  +EV+  FE  D D SGT+DFDEFLI LRPPM+K+R  ++ QAFNKLDKT D  ITVEDLKGVYNV  HPKY +GE TEE+   +FL +F++PD+ DG IT  EFLNYYS VS SID+DAYFDLMMRNAYKL
Sbjct:    1 MAATARHEKELIEKCKKNAGQTKDPVESLRLACLSRGSSGIKGLGRTFKIMDDDGNRSLDFNEFKKGLRDYGVMLEPKEVKRTFEAFDTDGSGTIDFDEFLIRLRPPMSKARKNVIQQAFNKLDKTGDNNITVEDLKGVYNVKHHPKYQNGEWTEEQCLRKFLDSFDSPDDKDGIITYDEFLNYYSGVSASIDSDAYFDLMMRNAYKL 208          
BLAST of Calcyphosin protein vs. Ensembl Nematostella
Match: EDO32962 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STK5])

HSP 1 Score: 153.68 bits (387), Expect = 2.374e-46
Identity = 74/146 (50.68%), Postives = 104/146 (71.23%), Query Frame = 2
Query:   98 RELQMKSKEKLKSASDPMEKLRLQCLARGATGIKGLGRAFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVALVIQAFNKLDKTKDGFITVEDLKGVYNVSKHPKYISGERT 535
            REL++K+K+  ++A  P+EKL      RG  GIK  GRAF+I+DDDGN  L+  EF KG+ D+G  L+ +EV+ +F   DKD SG+LDF+EFL A+RP M+K+RV ++++AF+K+D T DG IT+ DLK VYN  +  +Y SGE T
Sbjct:   10 RELKIKAKKMEENAKTPIEKLHAAMAGRGTCGIKMFGRAFRIFDDDGNRALNIDEFRKGMQDFGTKLTDDEVKQLFAQFDKDGSGSLDFEEFLRAVRPSMSKNRVEIIMKAFHKMDTTGDGVITIADLKKVYNARQDKRYQSGEMT 155          
BLAST of Calcyphosin protein vs. Ensembl Nematostella
Match: EDO33723 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRH0])

HSP 1 Score: 119.398 bits (298), Expect = 1.509e-33
Identity = 77/174 (44.25%), Postives = 104/174 (59.77%), Query Frame = 2
Query:  212 AFKIYDDDGNNTLDFREFNKGVNDYGCDLSKE-----------EVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVALVIQAFNKLDKTKDGFITVEDLKGVYNVSKHPKYISGERTXXXXXXXXXXXXXA-PDEIDGKITKREFLNYYSAVSCSIDNDAYFDLMMRNAYKL 697
            AF+I+DDDGN  L+  EF KG+ DYG  L+ +           ++  IF+GL+                       R  ++++AF+K+D T DG IT+ DLK VYN  +  +Y SGE TE E+F +FL  FE  P + DGK+TK EFL+YY+ VS SID+DAYFDLMMR A+KL
Sbjct:    2 AFRIFDDDGNKALNIDEFRKGMQDYGTKLTDDVSFTHFSAQSTDLLLIFQGLE----------------------LRFRIIMKAFHKMDTTGDGVITIADLKKVYNARQDKRYQSGEMTEAEVFQKFLATFEPDPAKRDGKVTKGEFLDYYNGVSVSIDDDAYFDLMMRQAWKL 153          
BLAST of Calcyphosin protein vs. Ensembl Nematostella
Match: EDO37727 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SF01])

HSP 1 Score: 85.1149 bits (209), Expect = 4.140e-19
Identity = 56/179 (31.28%), Postives = 91/179 (50.84%), Query Frame = 2
Query:  155 KLRLQCLARGATGIKGLGRAFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVALVIQAFNKLDKTKDGFITVEDLKGVYNVSKHPKYISGERTXXXXXXXXXXXXXAPDEIDGKITKREFLNYYSAVSCSIDNDAYFDLMMRNAY 691
            ++R Q   R +  + G+GR F+  D DG+    F EF + V        KE +  ++  LD +  G LD+ EF+      M ++R A V + F+K D +K G + + ++K  ++  KHPK +SG R +E    +   +     E  G++T  EF +YY  VS  I +D  F  MM+N +
Sbjct:  148 EVRRQLAQRASKTLMGMGRHFRTLDKDGHRL--FEEFWEVVE-------KEVLGGLWNLLDVNGDGALDYGEFVRGFIGEMNETRKAYVRKVFHKFDPSKTGLVELNNMKKFFSAKKHPKVLSG-RLKEHEAQQMFLSSFENCEHRGEVTYAEFEDYYEGVSIGIASDEEFVAMMKNCW 316          
BLAST of Calcyphosin protein vs. Ensembl Nematostella
Match: EDO40775 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S690])

HSP 1 Score: 57.3806 bits (137), Expect = 2.923e-10
Identity = 33/94 (35.11%), Postives = 55/94 (58.51%), Query Frame = 2
Query:  212 AFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMT-KSRVALVIQAFNKLDKTKDGFITVEDLKGV 490
            AF ++D DG+ T+D +E    +   G +  KEE++ +   +DKD SGT+DF+EFL  +   M+ K     +++AF   D  + G I+ ++LK V
Sbjct:   26 AFDLFDTDGSGTIDAKELKVAMRALGFEPKKEEIKKMISDIDKDGSGTIDFNEFLQMMTAKMSEKDSKEEILKAFKLFDDDETGKISFKNLKRV 119          
BLAST of Calcyphosin protein vs. Ensembl Medaka
Match: capslb (calcyphosine like [Source:NCBI gene;Acc:101171382])

HSP 1 Score: 246.514 bits (628), Expect = 3.153e-81
Identity = 121/208 (58.17%), Postives = 163/208 (78.37%), Query Frame = 2
Query:   74 MALTNRGNRELQMKSKEKLKSASDPMEKLRLQCLARGATGIKGLGRAFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVALVIQAFNKLDKTKDGFITVEDLKGVYNVSKHPKYISGERTXXXXXXXXXXXXXAPDEIDGKITKREFLNYYSAVSCSIDNDAYFDLMMRNAYKL 697
            MA T+R + E+ + +K +L   SDP+EKLRLQCL RG++GIKGLGR F++ DD+ N +LD +EF KG+NDYG  + KEE   +F+  D+D SGT+ FDEFLIALRPPM+++R+ +V+QAF K+DKT DG ITVEDL+GVYN   HPKY +GE +E+++F  FL +F++P + DGK+TK EF++YYS VS SID+D YF LMMRNA+KL
Sbjct:   51 MAGTSRHDHEMAVMAKRQLSQCSDPVEKLRLQCLIRGSSGIKGLGRTFRVMDDNQNRSLDLKEFLKGLNDYGLLMEKEEAAALFQHFDRDGSGTISFDEFLIALRPPMSRARLEVVMQAFRKMDKTGDGVITVEDLRGVYNAKYHPKYQNGELSEDQVFRTFLDSFDSPYDKDGKVTKEEFIDYYSGVSASIDSDVYFILMMRNAWKL 258          
BLAST of Calcyphosin protein vs. Ensembl Medaka
Match: si:rp71-17i16.4 (troponin C, skeletal muscle [Source:NCBI gene;Acc:101171577])

HSP 1 Score: 52.7582 bits (125), Expect = 7.767e-8
Identity = 29/101 (28.71%), Postives = 54/101 (53.47%), Query Frame = 2
Query:  212 AFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVA----LVIQAFNKLDKTKDGFITVEDLKGVYNVS 502
            AF ++D DG   +  +E    +   G + S+EE+  I E +D+D SGT+DF+EFL+ +   + + +       + + F   DK  DGF+  E+   + +++
Sbjct:   88 AFDMFDTDGGGDISTKELGTVMRMLGQNPSREELDAIIEEVDEDGSGTIDFEEFLVMMVQQLKEDQAGKSEEELSECFRIFDKNSDGFVDREEFGDILHMT 188          
BLAST of Calcyphosin protein vs. Ensembl Medaka
Match: tnnc2 (troponin C, skeletal muscle [Source:NCBI gene;Acc:101171829])

HSP 1 Score: 50.0618 bits (118), Expect = 2.409e-7
Identity = 30/104 (28.85%), Postives = 52/104 (50.00%), Query Frame = 2
Query:  212 AFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVA----LVIQAFNKLDKTKDGFITVEDLKGVYNVSKHP 511
            AF ++D DG   +  +E    +   G + ++EE+  I E +D+D SGT+DF+EFL+ +   + + +       + + F   DK  DG I  E+   +   S  P
Sbjct:   23 AFDMFDTDGGGDISTKELGTVMRMLGQNPTREELDEIIEEVDEDGSGTIDFEEFLVMMVRLLKEDQAGKSEEELAECFRVFDKNGDGVIDREEFAQIIRSSGEP 126          
BLAST of Calcyphosin protein vs. Ensembl Medaka
Match: calm2a (calmodulin 2 [Source:NCBI gene;Acc:100049420])

HSP 1 Score: 48.521 bits (114), Expect = 7.013e-7
Identity = 30/100 (30.00%), Postives = 52/100 (52.00%), Query Frame = 2
Query:  194 IKGLGRAFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVALVI-QAFNKLDKTKDGFITVEDLKGV 490
            I     AF ++D DG+ T+  +E    +   G + ++ E+Q +   +D D +GT+DF EFL  +   M  +     I +AF   DK  +G+I+  +L+ V
Sbjct:   10 IAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHV 109          
BLAST of Calcyphosin protein vs. Ensembl Medaka
Match: ENSORLT00000008599.2 (calmodulin 3 [Source:NCBI gene;Acc:100049421])

HSP 1 Score: 48.521 bits (114), Expect = 7.013e-7
Identity = 30/100 (30.00%), Postives = 52/100 (52.00%), Query Frame = 2
Query:  194 IKGLGRAFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVALVI-QAFNKLDKTKDGFITVEDLKGV 490
            I     AF ++D DG+ T+  +E    +   G + ++ E+Q +   +D D +GT+DF EFL  +   M  +     I +AF   DK  +G+I+  +L+ V
Sbjct:   10 IAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHV 109          
BLAST of Calcyphosin protein vs. Planmine SMEST
Match: SMESG000025859.1 (SMESG000025859.1)

HSP 1 Score: 386.341 bits (991), Expect = 2.752e-137
Identity = 204/208 (98.08%), Postives = 205/208 (98.56%), Query Frame = 2
Query:   74 MALTNRGNRELQMKSKEKLKSASDPMEKLRLQCLARGATGIKGLGRAFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVALVIQAFNKLDKTKDGFITVEDLKGVYNVSKHPKYISGERTXXXXXXXXXXXXXAPDEIDGKITKREFLNYYSAVSCSIDNDAYFDLMMRNAYKL 697
            MALTNRGNRELQMKSKEKLKSASDPMEKLRLQCLARGATGIKGLGRAFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVALVIQAFNKLDKTKDGFITVEDLKGVYNVSKHPKYISGERTEEELFLEFLKNFEAPDEIDGK+TK EFLNYYS VS SIDNDAYFDLMMRNAYKL
Sbjct:    1 MALTNRGNRELQMKSKEKLKSASDPMEKLRLQCLARGATGIKGLGRAFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVALVIQAFNKLDKTKDGFITVEDLKGVYNVSKHPKYISGERTEEELFLEFLKNFEAPDEIDGKVTKEEFLNYYSGVSASIDNDAYFDLMMRNAYKL 208          
BLAST of Calcyphosin protein vs. Planmine SMEST
Match: SMESG000005291.1 (SMESG000005291.1)

HSP 1 Score: 278.87 bits (712), Expect = 6.291e-95
Identity = 141/208 (67.79%), Postives = 174/208 (83.65%), Query Frame = 2
Query:   74 MALTNRGNRELQMKSKEKLKSASDPMEKLRLQCLARGATGIKGLGRAFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVALVIQAFNKLDKTKDGFITVEDLKGVYNVSKHPKYISGERTXXXXXXXXXXXXXAPDEIDGKITKREFLNYYSAVSCSIDNDAYFDLMMRNAYKL 697
            MA T+R N+ELQ++S +KL++A+DP+E+LRL CL+RGATGIKGL R FK++DDDG+ +LDF EF KG+ DYG  +   E+  IF  +D+DKSGTLDFDEFLIALRPPM+KSRV ++ +AF K+DKTKDG ITVEDLKGVY+   HPK+ SGE TE+++F EFLKNFEAP+EIDG +TK EFLNYY  +S SIDNDAYFDLMMRNAYKL
Sbjct:    1 MAFTSRENKELQVQSNKKLQNATDPVERLRLMCLSRGATGIKGLSRTFKVFDDDGSRSLDFNEFKKGIADYGIVMDNNEIHEIFNQIDRDKSGTLDFDEFLIALRPPMSKSRVEMISKAFAKMDKTKDGAITVEDLKGVYSAVHHPKFKSGEWTEDQVFREFLKNFEAPEEIDGIVTKEEFLNYYCGISASIDNDAYFDLMMRNAYKL 208          
BLAST of Calcyphosin protein vs. Planmine SMEST
Match: SMESG000005291.1 (SMESG000005291.1)

HSP 1 Score: 279.641 bits (714), Expect = 7.614e-95
Identity = 141/208 (67.79%), Postives = 174/208 (83.65%), Query Frame = 2
Query:   74 MALTNRGNRELQMKSKEKLKSASDPMEKLRLQCLARGATGIKGLGRAFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVALVIQAFNKLDKTKDGFITVEDLKGVYNVSKHPKYISGERTXXXXXXXXXXXXXAPDEIDGKITKREFLNYYSAVSCSIDNDAYFDLMMRNAYKL 697
            MA T+R N+ELQ++S +KL++A+DP+E+LRL CL+RGATGIKGL R FK++DDDG+ +LDF EF KG+ DYG  +   E+  IF  +D+DKSGTLDFDEFLIALRPPM+KSRV ++ +AF K+DKTKDG ITVEDLKGVY+   HPK+ SGE TE+++F EFLKNFEAP+EIDG +TK EFLNYY  +S SIDNDAYFDLMMRNAYKL
Sbjct:    1 MAFTSRENKELQVQSNKKLQNATDPVERLRLMCLSRGATGIKGLSRTFKVFDDDGSRSLDFNEFKKGIADYGIVMDNNEIHEIFNQIDRDKSGTLDFDEFLIALRPPMSKSRVEMISKAFAKMDKTKDGAITVEDLKGVYSAVHHPKFKSGEWTEDQVFREFLKNFEAPEEIDGIVTKEEFLNYYCGISASIDNDAYFDLMMRNAYKL 208          
BLAST of Calcyphosin protein vs. Planmine SMEST
Match: SMESG000017753.1 (SMESG000017753.1)

HSP 1 Score: 204.142 bits (518), Expect = 1.993e-65
Identity = 106/208 (50.96%), Postives = 154/208 (74.04%), Query Frame = 2
Query:   74 MALTNRGNRELQMKSKEKLKSASDPMEKLRLQCLARGATGIKGLGRAFKIYDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEFLIALRPPMTKSRVALVIQAFNKLDKTKDGFITVEDLKGVYNVSKHPKYISGERTXXXXXXXXXXXXXAPDEIDGKITKREFLNYYSAVSCSIDNDAYFDLMMRNAYKL 697
            MA +++ + EL+MK++++L +A DP+ KLRLQCL  GA+GIKGL R F+I +DD +  L   EF  G+  +G  L+  E++ +F+ +D+D S T+   EFL ALRPP++ +R+ L+ +AF  +DKT DG IT+EDLK VYN +KHPK  +GE +E  +F EFLK+FEAP++ DG +T  EFL+YYS++S SIDN+ YFDLMMRN++K+
Sbjct:    1 MAFSDKDDMELRMKARKELSTAKDPLTKLRLQCLCNGASGIKGLSRRFRIMNDDNDRFLSQTEFKNGIKGFGLLLTDSEIEDLFKLMDRDGSNTICMTEFLRALRPPLSDNRLKLIKKAFTLMDKTGDGVITIEDLKHVYNATKHPKCQNGEWSETRVFQEFLKSFEAPNDADGIVTWDEFLDYYSSISNSIDNEGYFDLMMRNSFKM 208          
BLAST of Calcyphosin protein vs. Planmine SMEST
Match: SMESG000072346.1 (SMESG000072346.1)

HSP 1 Score: 72.4034 bits (176), Expect = 3.647e-16
Identity = 43/75 (57.33%), Postives = 63/75 (84.00%), Query Frame = 2
Query:  470 VEDLKGVYNVSKHPKYISGERTXXXXXXXXXXXXXAPDEIDGKITKREFLNYYSAVSCSIDNDAYFDLMMRNAYK 694
            ++D+KGVY++ K+ +Y++G+ TEE+ FLEFLKNFE  ++IDG +T  EFL+YYS +S SID D+YF+LMMRN++K
Sbjct:   15 IDDVKGVYDIRKNSRYLNGDWTEEKCFLEFLKNFENQNQIDGIVTYEEFLDYYSVISASIDKDSYFNLMMRNSFK 89          
The following BLAST results are available for this feature:
BLAST of Calcyphosin protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CAPSL1.135e-7658.17calcyphosine like [Source:HGNC Symbol;Acc:HGNC:283... [more]
CAPSL1.135e-7658.17calcyphosine like [Source:HGNC Symbol;Acc:HGNC:283... [more]
CAPSL1.135e-7658.17calcyphosine like [Source:HGNC Symbol;Acc:HGNC:283... [more]
CAPSL6.020e-6757.37calcyphosine like [Source:HGNC Symbol;Acc:HGNC:283... [more]
CAPSL2.397e-6157.54calcyphosine like [Source:HGNC Symbol;Acc:HGNC:283... [more]
back to top
BLAST of Calcyphosin protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cal-42.892e-929.90CALmodulin related genes [Source:UniProtKB/TrEMBL... [more]
cal-42.954e-929.90CALmodulin related genes [Source:UniProtKB/TrEMBL... [more]
cal-43.272e-929.90CALmodulin related genes [Source:UniProtKB/TrEMBL... [more]
C50C3.58.744e-930.93Uncharacterized calcium-binding protein C50C3.5 [... [more]
cmd-11.971e-731.00Calmodulin [Source:UniProtKB/Swiss-Prot;Acc:O1630... [more]
back to top
BLAST of Calcyphosin protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG313458.111e-6550.00gene:FBgn0051345 transcript:FBtr0082689[more]
CG101262.372e-6452.69gene:FBgn0038088 transcript:FBtr0082686[more]
CG101264.029e-6452.69gene:FBgn0038088 transcript:FBtr0082687[more]
Cam2.430e-731.00gene:FBgn0000253 transcript:FBtr0304964[more]
Cam2.430e-731.00gene:FBgn0000253 transcript:FBtr0088001[more]
back to top
BLAST of Calcyphosin protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
capslb2.124e-8662.02calcyphosine-like b [Source:ZFIN;Acc:ZDB-GENE-0504... [more]
capsla2.112e-6955.08calcyphosine-like a [Source:ZFIN;Acc:ZDB-GENE-0301... [more]
si:rp71-17i16.43.652e-929.81si:rp71-17i16.4 [Source:ZFIN;Acc:ZDB-GENE-090312-2... [more]
CR749762.53.996e-929.81si:rp71-17i16.4 [Source:NCBI gene;Acc:100002038][more]
calm3a8.063e-730.53calmodulin 3a (phosphorylase kinase, delta) [Sourc... [more]
back to top
BLAST of Calcyphosin protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
capsl7.147e-8459.62calcyphosine like [Source:NCBI gene;Acc:549278][more]
capsl2.878e-8157.69calcyphosine like [Source:NCBI gene;Acc:549278][more]
capsl6.599e-7958.59calcyphosine like [Source:NCBI gene;Acc:549278][more]
caps2.502e-7152.88calcyphosine [Source:NCBI gene;Acc:100037881][more]
ENSXETT00000016513.16.212e-1931.98calcyphosine 2 [Source:NCBI gene;Acc:100380015][more]
back to top
BLAST of Calcyphosin protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Capsl1.988e-7957.21calcyphosine-like [Source:MGI Symbol;Acc:MGI:19228... [more]
Capsl1.375e-3959.05calcyphosine-like [Source:MGI Symbol;Acc:MGI:19228... [more]
Caps22.154e-1529.57calcyphosphine 2 [Source:MGI Symbol;Acc:MGI:244198... [more]
Caps22.273e-1529.57calcyphosphine 2 [Source:MGI Symbol;Acc:MGI:244198... [more]
Tnnc24.271e-933.33troponin C2, fast [Source:MGI Symbol;Acc:MGI:98780... [more]
back to top
BLAST of Calcyphosin protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6P8Y1|CAPSL_MOUSE1.391e-7857.21Calcyphosin-like protein OS=Mus musculus OX=10090 ... [more]
sp|Q8WWF8|CAPSL_HUMAN5.453e-7658.17Calcyphosin-like protein OS=Homo sapiens OX=9606 G... [more]
sp|Q0VCC0|CAYP1_BOVIN2.522e-5250.27Calcyphosin OS=Bos taurus OX=9913 GN=CAPS PE=2 SV=... [more]
sp|Q13938|CAYP1_HUMAN7.372e-4949.18Calcyphosin OS=Homo sapiens OX=9606 GN=CAPS PE=1 S... [more]
sp|P41150|CAYP1_RABIT3.846e-4846.84Calcyphosin OS=Oryctolagus cuniculus OX=9986 GN=CA... [more]
back to top
BLAST of Calcyphosin protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A564YA361.993e-8966.83Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
A0A068YA967.889e-8967.79Calcyphosin protein OS=Echinococcus multilocularis... [more]
U6J8X41.071e-8867.79Calcyphosin protein OS=Echinococcus granulosus OX=... [more]
T2M8P33.484e-8863.94Calcyphosin-like protein OS=Hydra vulgaris OX=6087... [more]
A0A0R3VXY13.029e-8563.01Uncharacterized protein OS=Taenia asiatica OX=6051... [more]
back to top
BLAST of Calcyphosin protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
capslb1.630e-7958.17calcyphosine like [Source:NCBI gene;Acc:103021302][more]
capslb3.941e-7957.21calcyphosine like [Source:NCBI gene;Acc:103021302][more]
capsla2.251e-7158.60calcyphosin-like protein [Source:NCBI gene;Acc:103... [more]
si:rp71-17i16.42.008e-829.81troponin C, skeletal muscle [Source:NCBI gene;Acc:... [more]
si:rp71-17i16.42.036e-829.81troponin C, skeletal muscle [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Calcyphosin protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:rp71-17i16.42.190e-934.02si:rp71-17i16.4 [Source:ZFIN;Acc:ZDB-GENE-090312-2... [more]
CETN11.895e-831.91centrin 1 [Source:HGNC Symbol;Acc:HGNC:1866][more]
ENSPMAT00000006008.18.575e-830.00pep scaffold:Pmarinus_7.0:GL476713:142259:146509:-... [more]
CALML31.418e-730.00calmodulin like 3 [Source:HGNC Symbol;Acc:HGNC:145... [more]
CALM31.431e-730.00calmodulin 3 [Source:HGNC Symbol;Acc:HGNC:1449][more]
back to top
BLAST of Calcyphosin protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
CMD18.872e-630.93Calmodulin; Ca2+ binding protein that regulates Ca... [more]
back to top
BLAST of Calcyphosin protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO329614.425e-8463.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO329622.374e-4650.68Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO337231.509e-3344.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO377274.140e-1931.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO407752.923e-1035.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Calcyphosin protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
capslb3.153e-8158.17calcyphosine like [Source:NCBI gene;Acc:101171382][more]
si:rp71-17i16.47.767e-828.71troponin C, skeletal muscle [Source:NCBI gene;Acc:... [more]
tnnc22.409e-728.85troponin C, skeletal muscle [Source:NCBI gene;Acc:... [more]
calm2a7.013e-730.00calmodulin 2 [Source:NCBI gene;Acc:100049420][more]
ENSORLT00000008599.27.013e-730.00calmodulin 3 [Source:NCBI gene;Acc:100049421][more]
back to top
BLAST of Calcyphosin protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000025859.12.752e-13798.08SMESG000025859.1[more]
SMESG000005291.16.291e-9567.79SMESG000005291.1[more]
SMESG000005291.17.614e-9567.79SMESG000005291.1[more]
SMESG000017753.11.993e-6550.96SMESG000017753.1[more]
SMESG000072346.13.647e-1657.33SMESG000072346.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027978 ID=SMED30027978|Name=Calcyphosin protein|organism=Schmidtea mediterranea sexual|type=transcript|length=861bp
ATTTGTTTAACTACACTGTTTCTATAGAAATAATAACTTAATTCTTGATT
GTTTTCTCCAAACCTTACTAATTATGGCTCTAACTAATCGTGGAAACAGA
GAATTGCAAATGAAATCAAAAGAAAAATTAAAGAGTGCTTCTGATCCAAT
GGAAAAGCTTCGTTTGCAATGTTTAGCAAGAGGAGCTACAGGAATTAAAG
GTTTAGGAAGAGCTTTTAAAATATATGATGACGATGGAAATAATACTTTG
GATTTCAGAGAATTTAATAAAGGAGTCAATGATTATGGATGCGATTTATC
CAAGGAAGAAGTTCAATTCATTTTTGAAGGTCTCGACAAAGACAAAAGTG
GCACCTTGGATTTTGACGAATTCCTCATAGCTTTGCGACCACCAATGACA
AAAAGTCGAGTTGCACTAGTTATTCAGGCATTCAACAAATTAGATAAAAC
CAAAGACGGATTTATAACAGTTGAAGACCTCAAAGGAGTTTACAATGTCA
GCAAGCATCCCAAATATATCAGTGGAGAAAGAACAGAAGAAGAATTGTTT
TTGGAATTTTTGAAGAATTTTGAAGCTCCAGATGAGATAGATGGAAAGAT
CACCAAGCGAGAATTCCTCAATTATTATTCGGCAGTTAGCTGCTCTATTG
ACAATGATGCCTATTTTGATTTGATGATGAGAAATGCCTATAAACTGTGA
ATCATGTGGAACTTGTGTTTCGTAATATTTCAATCAAATTTGTATGAGGG
GTCCTCCTTGAGTCTTCATGAATGTTGCTGTCTGATGCTATAGTTTGGCA
TTTGCAGATGATTTGGAAATATTTATATTTTATATTTTTTTCAAATTTTA
ATCTCAATAAA
back to top

protein sequence of SMED30027978-orf-1

>SMED30027978-orf-1 ID=SMED30027978-orf-1|Name=SMED30027978-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=209bp
MALTNRGNRELQMKSKEKLKSASDPMEKLRLQCLARGATGIKGLGRAFKI
YDDDGNNTLDFREFNKGVNDYGCDLSKEEVQFIFEGLDKDKSGTLDFDEF
LIALRPPMTKSRVALVIQAFNKLDKTKDGFITVEDLKGVYNVSKHPKYIS
GERTEEELFLEFLKNFEAPDEIDGKITKREFLNYYSAVSCSIDNDAYFDL
MMRNAYKL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR002048EF_hand_dom
IPR011992EF-hand-dom_pair
IPR018247EF_Hand_1_Ca_BS
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002048EF-hand domainSMARTSM00054efh_1coord: 43..71
e-value: 1.3
score: 17.0
coord: 115..143
e-value: 4.3
score: 12.6
coord: 79..107
e-value: 0.0018
score: 27.5
IPR002048EF-hand domainPFAMPF13202EF-hand_5coord: 118..138
e-value: 4.4E-4
score: 19.6
IPR002048EF-hand domainPFAMPF13499EF-hand_7coord: 44..104
e-value: 1.2E-10
score: 41.7
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 75..110
score: 13.147
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 173..191
score: 5.95
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 111..146
score: 11.194
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 39..74
score: 11.222
IPR002048EF-hand domainCDDcd00051EFhcoord: 46..101
e-value: 5.32494E-14
score: 62.1801
NoneNo IPR availableGENE3DG3DSA:1.10.238.10coord: 109..208
e-value: 1.0E-32
score: 114.7
NoneNo IPR availableGENE3DG3DSA:1.10.238.10coord: 23..108
e-value: 5.0E-22
score: 79.4
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..23
NoneNo IPR availablePANTHERPTHR23064TROPONINcoord: 1..208
NoneNo IPR availablePANTHERPTHR23064:SF36coord: 1..208
IPR018247EF-Hand 1, calcium-binding sitePROSITEPS00018EF_HAND_1coord: 88..100
IPR018247EF-Hand 1, calcium-binding sitePROSITEPS00018EF_HAND_1coord: 52..64
IPR011992EF-hand domain pairSUPERFAMILYSSF47473EF-handcoord: 41..205