Pterin-4-alpha-carbinolamine dehydratase

Overview
NamePterin-4-alpha-carbinolamine dehydratase
Smed IDSMED30027974
Length (bp)478
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Pterin-4-alpha-carbinolamine dehydratase (SMED30027974) t-SNE clustered cells

Violin plots show distribution of expression levels for Pterin-4-alpha-carbinolamine dehydratase (SMED30027974) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Pterin-4-alpha-carbinolamine dehydratase (SMED30027974) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Pterin-4-alpha-carbinolamine dehydratase (SMED30027974) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027974

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30027974h1SMcG0021834 dd_Smed_v4_1214_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30027974h1SMcG0021834 dd_Smed_v4_1214_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30027974h1SMcG0021834 dd_Smed_v4_1214_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30027974h1SMcG0021834 dd_Smed_v4_1214_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30027974h1SMcG0021834 Contig39206uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30027974h1SMcG0021834 Contig39206newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30027974h1SMcG0021834 Contig19180newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30027974h1SMcG0021834 Contig19180uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Pterin-4-alpha-carbinolamine dehydratase vs. Ensembl Human
Match: PCBD2 (pterin-4 alpha-carbinolamine dehydratase 2 [Source:HGNC Symbol;Acc:HGNC:24474])

HSP 1 Score: 115.931 bits (289), Expect = 2.049e-33
Identity = 50/87 (57.47%), Postives = 67/87 (77.01%), Query Frame = 1
Query:  121 EKELSVLLESPHNWKILDDREALYKEFQFKNFNKAFSFMTSVALLAEKMDHHPEWFNVYNKVRVTLSSHDVNGLSMRDIKMAKFMEK 381
            E+  ++L      W  L +R+A+YKEF F NFN+AF FM+ VAL AEKM+HHPEWFNVYNKV++TL+SHD   L+ +D+K+AKF+EK
Sbjct:   39 ERNQAILDLKAAGWSELSERDAIYKEFSFHNFNQAFGFMSRVALQAEKMNHHPEWFNVYNKVQITLTSHDCGELTKKDVKLAKFIEK 125          
BLAST of Pterin-4-alpha-carbinolamine dehydratase vs. Ensembl Human
Match: PCBD2 (pterin-4 alpha-carbinolamine dehydratase 2 [Source:HGNC Symbol;Acc:HGNC:24474])

HSP 1 Score: 115.931 bits (289), Expect = 2.049e-33
Identity = 50/87 (57.47%), Postives = 67/87 (77.01%), Query Frame = 1
Query:  121 EKELSVLLESPHNWKILDDREALYKEFQFKNFNKAFSFMTSVALLAEKMDHHPEWFNVYNKVRVTLSSHDVNGLSMRDIKMAKFMEK 381
            E+  ++L      W  L +R+A+YKEF F NFN+AF FM+ VAL AEKM+HHPEWFNVYNKV++TL+SHD   L+ +D+K+AKF+EK
Sbjct:   39 ERNQAILDLKAAGWSELSERDAIYKEFSFHNFNQAFGFMSRVALQAEKMNHHPEWFNVYNKVQITLTSHDCGELTKKDVKLAKFIEK 125          
BLAST of Pterin-4-alpha-carbinolamine dehydratase vs. Ensembl Human
Match: PCBD2 (pterin-4 alpha-carbinolamine dehydratase 2 [Source:HGNC Symbol;Acc:HGNC:24474])

HSP 1 Score: 115.546 bits (288), Expect = 2.618e-33
Identity = 50/87 (57.47%), Postives = 67/87 (77.01%), Query Frame = 1
Query:  121 EKELSVLLESPHNWKILDDREALYKEFQFKNFNKAFSFMTSVALLAEKMDHHPEWFNVYNKVRVTLSSHDVNGLSMRDIKMAKFMEK 381
            E+  ++L      W  L +R+A+YKEF F NFN+AF FM+ VAL AEKM+HHPEWFNVYNKV++TL+SHD   L+ +D+K+AKF+EK
Sbjct:   28 ERNQAILDLKAAGWSELSERDAIYKEFSFHNFNQAFGFMSRVALQAEKMNHHPEWFNVYNKVQITLTSHDCGELTKKDVKLAKFIEK 114          
BLAST of Pterin-4-alpha-carbinolamine dehydratase vs. Ensembl Human
Match: PCBD1 (pterin-4 alpha-carbinolamine dehydratase 1 [Source:HGNC Symbol;Acc:HGNC:8646])

HSP 1 Score: 112.464 bits (280), Expect = 2.462e-32
Identity = 47/76 (61.84%), Postives = 62/76 (81.58%), Query Frame = 1
Query:  157 NWKILDDREALYKEFQFKNFNKAFSFMTSVALLAEKMDHHPEWFNVYNKVRVTLSSHDVNGLSMRDIKMAKFMEKL 384
             W  L+ R+A++K+F FK+FN+AF FMT VAL AEK+DHHPEWFNVYNKV +TLS+H+  GLS RDI +A F+E++
Sbjct:   24 GWNELEGRDAIFKQFHFKDFNRAFGFMTRVALQAEKLDHHPEWFNVYNKVHITLSTHECAGLSERDINLASFIEQV 99          
BLAST of Pterin-4-alpha-carbinolamine dehydratase vs. Ensembl Celegans
Match: pcbd-1 (Putative pterin-4-alpha-carbinolamine dehydratase [Source:UniProtKB/Swiss-Prot;Acc:Q9TZH6])

HSP 1 Score: 115.546 bits (288), Expect = 1.865e-33
Identity = 56/116 (48.28%), Postives = 76/116 (65.52%), Query Frame = 1
Query:   37 SISSHYIPKIYFAKMSTDYKTKLSSDQLEKELSVLLESPHNWKILDDREALYKEFQFKNFNKAFSFMTSVALLAEKMDHHPEWFNVYNKVRVTLSSHDVNGLSMRDIKMAKFMEKL 384
            S SSH +        +      L+  +  ++LS L  +   WK+++ R+A+ KEF FK+FN+AF FMT V L AEKMDHHPEWFNVYNKV +TLS+HD  GLS  D+K+A F+E +
Sbjct:   26 STSSHRLFSTTIGVFARKKMPLLTESERTEQLSGLKTA--GWKLVEGRDAIQKEFHFKDFNEAFGFMTRVGLKAEKMDHHPEWFNVYNKVDITLSTHDCGGLSPNDVKLATFIESI 139          
BLAST of Pterin-4-alpha-carbinolamine dehydratase vs. Ensembl Fly
Match: Pcd (gene:FBgn0024841 transcript:FBtr0085458)

HSP 1 Score: 114.775 bits (286), Expect = 1.585e-32
Identity = 51/94 (54.26%), Postives = 73/94 (77.66%), Query Frame = 1
Query:   97 TKLSSDQLEKELSVLLESPHNWKILDDREALYKEFQFKNFNKAFSFMTSVALLAEKMDHHPEWFNVYNKVRVTLSSHDVNGLSMRDIKMAKFME 378
             +L+  +  ++L  LL++   W +++ R+A++K+F  K+FN+AFSFMT VALLAEK++HHPEWFN YNKV VTLS+HDV GLS +DI+MA  +E
Sbjct:   94 VRLNEQERAEKLQPLLDA--GWTLVEGRDAIFKQFVLKDFNQAFSFMTGVALLAEKINHHPEWFNCYNKVDVTLSTHDVGGLSSQDIRMATHLE 185          
BLAST of Pterin-4-alpha-carbinolamine dehydratase vs. Ensembl Zebrafish
Match: pcbd1 (pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha [Source:ZFIN;Acc:ZDB-GENE-040426-1787])

HSP 1 Score: 111.694 bits (278), Expect = 2.999e-32
Identity = 47/74 (63.51%), Postives = 61/74 (82.43%), Query Frame = 1
Query:  160 WKILDDREALYKEFQFKNFNKAFSFMTSVALLAEKMDHHPEWFNVYNKVRVTLSSHDVNGLSMRDIKMAKFMEK 381
            W  +  R+A+YKEF FK+FN+AF FM+ VAL AEKMDHHPEWFNVYNKV++TLS+H+  GLS RDI +A F+++
Sbjct:   25 WVEVGGRDAIYKEFIFKDFNQAFGFMSRVALQAEKMDHHPEWFNVYNKVQITLSTHECGGLSQRDINLATFIDQ 98          
BLAST of Pterin-4-alpha-carbinolamine dehydratase vs. Ensembl Xenopus
Match: pcbd1 (pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha [Source:NCBI gene;Acc:496425])

HSP 1 Score: 116.316 bits (290), Expect = 6.533e-34
Identity = 54/95 (56.84%), Postives = 70/95 (73.68%), Query Frame = 1
Query:  100 KLSSDQLEKELSVLLESPHNWKILDDREALYKEFQFKNFNKAFSFMTSVALLAEKMDHHPEWFNVYNKVRVTLSSHDVNGLSMRDIKMAKFMEKL 384
            +LS ++ E+ L  L      W  LD R+A+ KEF FK+FN+AF FMT VAL AEK+DHHPEWFNVY+KV +TLS+HD  GLS RDI +A F+E++
Sbjct:    7 RLSGEEREQLLPNLRAV--GWHELDGRDAICKEFHFKDFNRAFGFMTRVALQAEKLDHHPEWFNVYDKVHITLSTHDCGGLSERDINLASFIEQI 99          
BLAST of Pterin-4-alpha-carbinolamine dehydratase vs. Ensembl Xenopus
Match: pcbd1 (pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha [Source:NCBI gene;Acc:496425])

HSP 1 Score: 116.316 bits (290), Expect = 6.533e-34
Identity = 54/95 (56.84%), Postives = 70/95 (73.68%), Query Frame = 1
Query:  100 KLSSDQLEKELSVLLESPHNWKILDDREALYKEFQFKNFNKAFSFMTSVALLAEKMDHHPEWFNVYNKVRVTLSSHDVNGLSMRDIKMAKFMEKL 384
            +LS ++ E+ L  L      W  LD R+A+ KEF FK+FN+AF FMT VAL AEK+DHHPEWFNVY+KV +TLS+HD  GLS RDI +A F+E++
Sbjct:    7 RLSGEEREQLLPNLRAV--GWHELDGRDAICKEFHFKDFNRAFGFMTRVALQAEKLDHHPEWFNVYDKVHITLSTHDCGGLSERDINLASFIEQI 99          
BLAST of Pterin-4-alpha-carbinolamine dehydratase vs. Ensembl Xenopus
Match: dld (dihydrolipoamide dehydrogenase [Source:Xenbase;Acc:XB-GENE-982851])

HSP 1 Score: 109.768 bits (273), Expect = 6.136e-31
Identity = 44/75 (58.67%), Postives = 62/75 (82.67%), Query Frame = 1
Query:  157 NWKILDDREALYKEFQFKNFNKAFSFMTSVALLAEKMDHHPEWFNVYNKVRVTLSSHDVNGLSMRDIKMAKFMEK 381
             W  + ++ A+YKE++FK FN+AF FMT VAL AEKM+HHPEWFNVYNKV++TL++HD   L+ +D+K+A+F+EK
Sbjct:   51 GWTEVSEKNAIYKEYKFKTFNQAFGFMTRVALQAEKMNHHPEWFNVYNKVQITLTTHDCGRLTKKDLKLAQFIEK 125          
BLAST of Pterin-4-alpha-carbinolamine dehydratase vs. Ensembl Xenopus
Match: dld (dihydrolipoamide dehydrogenase [Source:Xenbase;Acc:XB-GENE-982851])

HSP 1 Score: 78.9518 bits (193), Expect = 4.152e-19
Identity = 34/66 (51.52%), Postives = 48/66 (72.73%), Query Frame = 1
Query:  157 NWKILDDREALYKEFQFKNFNKAFSFMTSVALLAEKMDHHPEWFNVYNK------VRVTLSSHDVN 336
             W  + ++ A+YKE++FK FN+AF FMT VAL AEKM+HHPEWFNVYNK      +++TL++   +
Sbjct:   51 GWTEVSEKNAIYKEYKFKTFNQAFGFMTRVALQAEKMNHHPEWFNVYNKDLFRVPIKLTLNAQRTS 116          
BLAST of Pterin-4-alpha-carbinolamine dehydratase vs. Ensembl Mouse
Match: Pcbd2 (pterin 4 alpha carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha (TCF1) 2 [Source:MGI Symbol;Acc:MGI:1919812])

HSP 1 Score: 124.02 bits (310), Expect = 1.257e-36
Identity = 60/110 (54.55%), Postives = 76/110 (69.09%), Query Frame = 1
Query:   58 PKIYFAKMSTDYK--TKLSSDQLEKELSVLLESPHNWKILDDREALYKEFQFKNFNKAFSFMTSVALLAEKMDHHPEWFNVYNKVRVTLSSHDVNGLSMRDIKMAKFMEK 381
            P    A MS+D +  T    DQL   L         W  L +R+A+YKEF FKNFN+AF FM+ VAL AEKM+HHPEWFNVYNKV++TL+SHD  GL+ RD+K+A+F+EK
Sbjct:   27 PGASRAAMSSDAQWLTAEERDQLIPGLKAA-----GWSELSERDAIYKEFSFKNFNQAFGFMSRVALQAEKMNHHPEWFNVYNKVQITLTSHDCGGLTKRDVKLAQFIEK 131          
BLAST of Pterin-4-alpha-carbinolamine dehydratase vs. Ensembl Mouse
Match: Pcbd2 (pterin 4 alpha carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha (TCF1) 2 [Source:MGI Symbol;Acc:MGI:1919812])

HSP 1 Score: 120.168 bits (300), Expect = 1.532e-35
Identity = 58/103 (56.31%), Postives = 74/103 (71.84%), Query Frame = 1
Query:   79 MSTDYK--TKLSSDQLEKELSVLLESPHNWKILDDREALYKEFQFKNFNKAFSFMTSVALLAEKMDHHPEWFNVYNKVRVTLSSHDVNGLSMRDIKMAKFMEK 381
            MS+D +  T    DQL   L         W  L +R+A+YKEF FKNFN+AF FM+ VAL AEKM+HHPEWFNVYNKV++TL+SHD  GL+ RD+K+A+F+EK
Sbjct:    1 MSSDAQWLTAEERDQLIPGLKAA-----GWSELSERDAIYKEFSFKNFNQAFGFMSRVALQAEKMNHHPEWFNVYNKVQITLTSHDCGGLTKRDVKLAQFIEK 98          
BLAST of Pterin-4-alpha-carbinolamine dehydratase vs. Ensembl Mouse
Match: Pcbd1 (pterin 4 alpha carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha (TCF1) 1 [Source:MGI Symbol;Acc:MGI:94873])

HSP 1 Score: 111.309 bits (277), Expect = 4.604e-32
Identity = 46/76 (60.53%), Postives = 62/76 (81.58%), Query Frame = 1
Query:  157 NWKILDDREALYKEFQFKNFNKAFSFMTSVALLAEKMDHHPEWFNVYNKVRVTLSSHDVNGLSMRDIKMAKFMEKL 384
             W  ++ R+A++K+F FK+FN+AF FMT VAL AEK+DHHPEWFNVYNKV +TLS+H+  GLS RDI +A F+E++
Sbjct:   24 GWNEVEGRDAIFKQFHFKDFNRAFGFMTRVALQAEKLDHHPEWFNVYNKVHITLSTHECAGLSERDINLASFIEQV 99          
BLAST of Pterin-4-alpha-carbinolamine dehydratase vs. Ensembl Mouse
Match: Pcbd1 (pterin 4 alpha carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha (TCF1) 1 [Source:MGI Symbol;Acc:MGI:94873])

HSP 1 Score: 86.6557 bits (213), Expect = 5.738e-23
Identity = 37/54 (68.52%), Postives = 45/54 (83.33%), Query Frame = 1
Query:  223 AFSFMTSVALLAEKMDHHPEWFNVYNKVRVTLSSHDVNGLSMRDIKMAKFMEKL 384
            AF FMT VAL AEK+DHHPEWFNVYNKV +TLS+H+  GLS RDI +A F+E++
Sbjct:    2 AFGFMTRVALQAEKLDHHPEWFNVYNKVHITLSTHECAGLSERDINLASFIEQV 55          
BLAST of Pterin-4-alpha-carbinolamine dehydratase vs. UniProt/SwissProt
Match: sp|P0C8L6|PHS_HYPDU (Probable pterin-4-alpha-carbinolamine dehydratase OS=Hypsibius dujardini OX=232323 GN=Pcd PE=3 SV=1)

HSP 1 Score: 124.405 bits (311), Expect = 2.511e-36
Identity = 54/75 (72.00%), Postives = 66/75 (88.00%), Query Frame = 1
Query:  157 NWKILDDREALYKEFQFKNFNKAFSFMTSVALLAEKMDHHPEWFNVYNKVRVTLSSHDVNGLSMRDIKMAKFMEK 381
             W +++ R+A++KEF+FK+FN AF FMT VALLAEKMDHHPEWFNVYNKV++TLSSHDV GLS RDIK+A F+EK
Sbjct:   21 GWLLVEGRDAIHKEFKFKDFNAAFGFMTRVALLAEKMDHHPEWFNVYNKVQITLSSHDVAGLSQRDIKLASFIEK 95          
BLAST of Pterin-4-alpha-carbinolamine dehydratase vs. UniProt/SwissProt
Match: sp|P58249|PHS_DROVI (Pterin-4-alpha-carbinolamine dehydratase OS=Drosophila virilis OX=7244 GN=Pcd PE=3 SV=1)

HSP 1 Score: 123.25 bits (308), Expect = 5.366e-36
Identity = 56/94 (59.57%), Postives = 77/94 (81.91%), Query Frame = 1
Query:   97 TKLSSDQLEKELSVLLESPHNWKILDDREALYKEFQFKNFNKAFSFMTSVALLAEKMDHHPEWFNVYNKVRVTLSSHDVNGLSMRDIKMAKFME 378
             KL+  +  ++L  LL++   W +++ R+A+YKEF FK+FN+AFSFMT VALLAEKM+HHPEWFNVYNK++VTLS+HDV GLS +DI+MA ++E
Sbjct:    3 AKLTEQERVEKLQPLLDA--GWCLVEGRDAIYKEFLFKDFNQAFSFMTGVALLAEKMNHHPEWFNVYNKLQVTLSTHDVGGLSSQDIRMATYLE 94          
BLAST of Pterin-4-alpha-carbinolamine dehydratase vs. UniProt/SwissProt
Match: sp|Q9CZL5|PHS2_MOUSE (Pterin-4-alpha-carbinolamine dehydratase 2 OS=Mus musculus OX=10090 GN=Pcbd2 PE=1 SV=2)

HSP 1 Score: 124.02 bits (310), Expect = 8.793e-36
Identity = 60/110 (54.55%), Postives = 76/110 (69.09%), Query Frame = 1
Query:   58 PKIYFAKMSTDYK--TKLSSDQLEKELSVLLESPHNWKILDDREALYKEFQFKNFNKAFSFMTSVALLAEKMDHHPEWFNVYNKVRVTLSSHDVNGLSMRDIKMAKFMEK 381
            P    A MS+D +  T    DQL   L         W  L +R+A+YKEF FKNFN+AF FM+ VAL AEKM+HHPEWFNVYNKV++TL+SHD  GL+ RD+K+A+F+EK
Sbjct:   27 PGASRAAMSSDAQWLTAEERDQLIPGLKAA-----GWSELSERDAIYKEFSFKNFNQAFGFMSRVALQAEKMNHHPEWFNVYNKVQITLTSHDCGGLTKRDVKLAQFIEK 131          
BLAST of Pterin-4-alpha-carbinolamine dehydratase vs. UniProt/SwissProt
Match: sp|B2T7M8|PHS_PARPJ (Putative pterin-4-alpha-carbinolamine dehydratase OS=Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN) OX=398527 GN=Bphyt_3922 PE=3 SV=1)

HSP 1 Score: 117.857 bits (294), Expect = 7.159e-34
Identity = 50/95 (52.63%), Postives = 73/95 (76.84%), Query Frame = 1
Query:  100 KLSSDQLEKELSVLLESPHNWKILDDREALYKEFQFKNFNKAFSFMTSVALLAEKMDHHPEWFNVYNKVRVTLSSHDVNGLSMRDIKMAKFMEKL 384
            KL+S+Q   +L+ L    H W+ + DR+A+ ++F+F +FN+AF FMT VA+ A++MDHHPEWFNVYNKV +TLS+HD  GL+ RDIK+A F++ +
Sbjct:    4 KLTSEQRATQLAGL----HGWQAVADRDAIQRQFKFADFNEAFGFMTRVAIKAQEMDHHPEWFNVYNKVEITLSTHDAGGLTERDIKLATFIDSI 94          
BLAST of Pterin-4-alpha-carbinolamine dehydratase vs. UniProt/SwissProt
Match: sp|Q91901|PHS_XENLA (Pterin-4-alpha-carbinolamine dehydratase OS=Xenopus laevis OX=8355 GN=pcbd PE=3 SV=3)

HSP 1 Score: 116.316 bits (290), Expect = 4.032e-33
Identity = 54/95 (56.84%), Postives = 70/95 (73.68%), Query Frame = 1
Query:  100 KLSSDQLEKELSVLLESPHNWKILDDREALYKEFQFKNFNKAFSFMTSVALLAEKMDHHPEWFNVYNKVRVTLSSHDVNGLSMRDIKMAKFMEKL 384
            +LS ++ E+ L  L      W  LD R+A+ KEF FK+FN+AF FMT VAL AEK+DHHPEWFNVY+KV +TLS+HD  GLS RDI +A F+E++
Sbjct:    7 RLSGEEREQLLPNLRAV--GWHELDGRDAICKEFHFKDFNRAFGFMTRVALQAEKLDHHPEWFNVYDKVHITLSTHDCGGLSERDINLASFIEQI 99          
BLAST of Pterin-4-alpha-carbinolamine dehydratase vs. TrEMBL
Match: A0A5E4Q288 (Uncharacterized protein OS=Leptidea sinapis OX=189913 GN=LSINAPIS_LOCUS4203 PE=3 SV=1)

HSP 1 Score: 145.206 bits (365), Expect = 2.383e-41
Identity = 76/128 (59.38%), Postives = 96/128 (75.00%), Query Frame = 1
Query:   16 MITKVIYSISSHYIPK---IYFAKMSTDYKT--KLSSDQLEKELSVLLESPHNWKILDDREALYKEFQFKNFNKAFSFMTSVALLAEKMDHHPEWFNVYNKVRVTLSSHDVNGLSMRDIKMAKFMEKL 384
            +++K I SI+S   P    +  + +ST  K   KLS +Q + +LS LL++   WKI D+R+A+ KEF FKNFN+AF FM+ VALLAEKMDHHPEWFNVYNKV+VTLSSHDVNGLS RDIKMA FM+ +
Sbjct:   34 IVSKSINSITSRTGPVARLVSVSPLSTKRKMADKLSKEQRDTDLSPLLKA--GWKIQDNRDAIEKEFLFKNFNEAFGFMSRVALLAEKMDHHPEWFNVYNKVQVTLSSHDVNGLSKRDIKMATFMDTI 159          
BLAST of Pterin-4-alpha-carbinolamine dehydratase vs. TrEMBL
Match: A0A1E1WEZ9 (Uncharacterized protein OS=Pectinophora gossypiella OX=13191 GN=g.19344 PE=3 SV=1)

HSP 1 Score: 140.969 bits (354), Expect = 8.055e-40
Identity = 70/115 (60.87%), Postives = 86/115 (74.78%), Query Frame = 1
Query:   58 PKIYFAKMSTDYKT------KLSSDQLEKELSVLLESPHNWKILDDREALYKEFQFKNFNKAFSFMTSVALLAEKMDHHPEWFNVYNKVRVTLSSHDVNGLSMRDIKMAKFMEKL 384
            P + FA  S+          KL+S + E EL  LL+S   WK+  +R+A+ KEFQFK+FN+AF FMT VALLA+KMDHHPEWFNVYNK++VTLSSHDVNGLS RDIKMA FM+K+
Sbjct:   39 PAVGFATASSTTTKLRKMADKLNSQERETELQPLLKS--GWKVQSNRDAIEKEFQFKDFNQAFGFMTRVALLADKMDHHPEWFNVYNKIQVTLSSHDVNGLSKRDIKMATFMDKI 151          
BLAST of Pterin-4-alpha-carbinolamine dehydratase vs. TrEMBL
Match: A0A482W8N4 (Pterin-4-alpha-carbinolamine dehydratase OS=Asbolus verrucosus OX=1661398 GN=BDFB_004555 PE=3 SV=1)

HSP 1 Score: 140.198 bits (352), Expect = 1.804e-39
Identity = 67/94 (71.28%), Postives = 81/94 (86.17%), Query Frame = 1
Query:  100 KLSSDQLEKELSVLLESPHNWKILDDREALYKEFQFKNFNKAFSFMTSVALLAEKMDHHPEWFNVYNKVRVTLSSHDVNGLSMRDIKMAKFMEK 381
            KL+ +Q + +L  LL+S   W I+++R+A+YKEF FKNFN+AFSFMT VALLAEKMDHHPEWFNVYNKV+VTLSSHDVNGLS RD+K+A FMEK
Sbjct:   52 KLTEEQRKNDLEPLLKS--GWTIVNNRDAIYKEFLFKNFNEAFSFMTRVALLAEKMDHHPEWFNVYNKVQVTLSSHDVNGLSNRDVKLANFMEK 143          
BLAST of Pterin-4-alpha-carbinolamine dehydratase vs. TrEMBL
Match: A0A210PVD7 (Pterin-4-alpha-carbinolamine dehydratase OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT22345 PE=3 SV=1)

HSP 1 Score: 138.658 bits (348), Expect = 3.754e-39
Identity = 66/109 (60.55%), Postives = 84/109 (77.06%), Query Frame = 1
Query:   55 IPKIYFAKMSTDYKTKLSSDQLEKELSVLLESPHNWKILDDREALYKEFQFKNFNKAFSFMTSVALLAEKMDHHPEWFNVYNKVRVTLSSHDVNGLSMRDIKMAKFMEK 381
            I  IYF+KM+T+ K    SD   ++L   L+    W +++ R+A+YKEF FK+FN+AF FMT VALLA+KMDHHPEWFNVYNKV+VTLS+HDV GLS RD+K+A FMEK
Sbjct:   19 ITSIYFSKMATEAKRAKLSDAERQDLLSPLKGV-GWSMVEGRDAIYKEFLFKDFNEAFGFMTRVALLADKMDHHPEWFNVYNKVQVTLSTHDVGGLSSRDVKLANFMEK 126          
BLAST of Pterin-4-alpha-carbinolamine dehydratase vs. TrEMBL
Match: A0A1A9VYB8 (Uncharacterized protein OS=Glossina austeni OX=7395 PE=3 SV=1)

HSP 1 Score: 139.043 bits (349), Expect = 1.309e-38
Identity = 63/93 (67.74%), Postives = 80/93 (86.02%), Query Frame = 1
Query:  100 KLSSDQLEKELSVLLESPHNWKILDDREALYKEFQFKNFNKAFSFMTSVALLAEKMDHHPEWFNVYNKVRVTLSSHDVNGLSMRDIKMAKFME 378
            KLS DQ ++ L  LL +   W +++ R+A+YKE+QF+NFN+AFSFM+ VALLAEKMDHHPEWFNVYNKV+VT+SSHDV+GLS RDI+MAK+ME
Sbjct:   91 KLSEDQRKELLQPLLNA--GWSMVNGRDAIYKEYQFRNFNQAFSFMSGVALLAEKMDHHPEWFNVYNKVQVTMSSHDVSGLSERDIRMAKYME 181          
BLAST of Pterin-4-alpha-carbinolamine dehydratase vs. Ensembl Cavefish
Match: PCBD2 (pterin-4 alpha-carbinolamine dehydratase 2 [Source:NCBI gene;Acc:103039248])

HSP 1 Score: 114.39 bits (285), Expect = 4.677e-33
Identity = 54/106 (50.94%), Postives = 77/106 (72.64%), Query Frame = 1
Query:   73 AKMSTD--YKTKLSSDQLEKELSVLLESPHNWKILDDREALYKEFQFKNFNKAFSFMTSVALLAEKMDHHPEWFNVYNKVRVTLSSHDVNGLSMRDIKMAKFMEKL 384
            A+M+TD  + +    +QL  EL         W  L++R+ALYKE  FK FN+AF FM+ VAL AEK++HHPEWFNVYNKV++TL++HD  GLS +D+++AKF++K+
Sbjct:   30 AQMATDSSWLSPAEREQLLMELKAT-----GWVELEERDALYKELHFKTFNQAFGFMSRVALQAEKINHHPEWFNVYNKVQITLTTHDCGGLSKKDVRLAKFIDKV 130          
BLAST of Pterin-4-alpha-carbinolamine dehydratase vs. Ensembl Cavefish
Match: PCBD2 (pterin-4 alpha-carbinolamine dehydratase 2 [Source:NCBI gene;Acc:103039248])

HSP 1 Score: 112.079 bits (279), Expect = 2.357e-32
Identity = 46/76 (60.53%), Postives = 64/76 (84.21%), Query Frame = 1
Query:  157 NWKILDDREALYKEFQFKNFNKAFSFMTSVALLAEKMDHHPEWFNVYNKVRVTLSSHDVNGLSMRDIKMAKFMEKL 384
             W  L++R+ALYKE  FK FN+AF FM+ VAL AEK++HHPEWFNVYNKV++TL++HD  GLS +D+++AKF++K+
Sbjct:   32 GWVELEERDALYKELHFKTFNQAFGFMSRVALQAEKINHHPEWFNVYNKVQITLTTHDCGGLSKKDVRLAKFIDKV 107          
BLAST of Pterin-4-alpha-carbinolamine dehydratase vs. Ensembl Cavefish
Match: pcbd1 (pterin-4 alpha-carbinolamine dehydratase 1 [Source:NCBI gene;Acc:103028355])

HSP 1 Score: 112.464 bits (280), Expect = 2.909e-32
Identity = 49/87 (56.32%), Postives = 66/87 (75.86%), Query Frame = 1
Query:  121 EKELSVLLESPHNWKILDDREALYKEFQFKNFNKAFSFMTSVALLAEKMDHHPEWFNVYNKVRVTLSSHDVNGLSMRDIKMAKFMEK 381
            E+E  + +     W  +  R+A+YKEF FK+FN+AF FM+ VAL AEKMDHHPEWFNVYNKV++TLS+H+  GLS RDI +A F+++
Sbjct:   38 EREQLLPMMRSAQWVEVVGRDAIYKEFIFKDFNQAFGFMSRVALQAEKMDHHPEWFNVYNKVQITLSTHECGGLSQRDITLATFIDQ 124          
BLAST of Pterin-4-alpha-carbinolamine dehydratase vs. Ensembl Cavefish
Match: pcbd1 (pterin-4 alpha-carbinolamine dehydratase 1 [Source:NCBI gene;Acc:103028355])

HSP 1 Score: 82.0333 bits (201), Expect = 1.165e-20
Identity = 38/72 (52.78%), Postives = 50/72 (69.44%), Query Frame = 1
Query:  121 EKELSVLLESPHNWKILDDREALYKEFQFKNFNKAFSFMTSVALLAEKMDHHPEWFNVYNKVRVTLSSHDVN 336
            E+E  + +     W  +  R+A+YKEF FK+FN+AF FM+ VAL AEKMDHHPEWFNVYNKV ++     +N
Sbjct:   12 EREQLLPMMRSAQWVEVVGRDAIYKEFIFKDFNQAFGFMSRVALQAEKMDHHPEWFNVYNKVNLSYIIFIIN 83          
BLAST of Pterin-4-alpha-carbinolamine dehydratase vs. Ensembl Cavefish
Match: pcbd1 (pterin-4 alpha-carbinolamine dehydratase 1 [Source:NCBI gene;Acc:103028355])

HSP 1 Score: 82.4185 bits (202), Expect = 1.791e-20
Identity = 38/72 (52.78%), Postives = 50/72 (69.44%), Query Frame = 1
Query:  121 EKELSVLLESPHNWKILDDREALYKEFQFKNFNKAFSFMTSVALLAEKMDHHPEWFNVYNKVRVTLSSHDVN 336
            E+E  + +     W  +  R+A+YKEF FK+FN+AF FM+ VAL AEKMDHHPEWFNVYNKV ++     +N
Sbjct:   38 EREQLLPMMRSAQWVEVVGRDAIYKEFIFKDFNQAFGFMSRVALQAEKMDHHPEWFNVYNKVNLSYIIFIIN 109          
BLAST of Pterin-4-alpha-carbinolamine dehydratase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010671.1 (pep scaffold:Pmarinus_7.0:GL476857:1325062:1327152:-1 gene:ENSPMAG00000009663.1 transcript:ENSPMAT00000010671.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 117.857 bits (294), Expect = 1.835e-35
Identity = 50/89 (56.18%), Postives = 70/89 (78.65%), Query Frame = 1
Query:  115 QLEKELSVLLESPHNWKILDDREALYKEFQFKNFNKAFSFMTSVALLAEKMDHHPEWFNVYNKVRVTLSSHDVNGLSMRDIKMAKFMEK 381
            Q E+E ++   +   W +   R+A++KEF FK+FN+AF FM+ VAL AEKMDHHPEWFNVYNKV++TLS+HD  GLS RD+++A+F++K
Sbjct:   10 QAEREAALPELTASGWLVQASRDAIHKEFLFKDFNQAFGFMSRVALQAEKMDHHPEWFNVYNKVQITLSTHDCGGLSERDVRLARFIDK 98          
BLAST of Pterin-4-alpha-carbinolamine dehydratase vs. Ensembl Nematostella
Match: EDO39949 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8I8])

HSP 1 Score: 122.094 bits (305), Expect = 1.168e-36
Identity = 58/108 (53.70%), Postives = 81/108 (75.00%), Query Frame = 1
Query:   64 IYFAKMSTDYKTKLSSDQLEKELSVLLESPHNWKILDDREALYKEFQFKNFNKAFSFMTSVALLAEKMDHHPEWFNVYNKVRVTLSSHDVNGLSMRDIKMAKFMEKLK 387
            +YF+++S+  + KLS ++ EKEL  LL +   W     R+A+ K+F FKNFN+AF FMT VAL+AEKMDHHPEW NVYNKV +TL++HD  G+S  D+KMA+F++ L+
Sbjct:    9 LYFSQLSSRPQ-KLSPERREKELKSLLST--GWVEAKTRDAIQKDFHFKNFNQAFGFMTRVALMAEKMDHHPEWSNVYNKVNITLTTHDCGGISSNDVKMAEFIDTLQ 113          
BLAST of Pterin-4-alpha-carbinolamine dehydratase vs. Ensembl Nematostella
Match: EDO27693 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T8J2])

HSP 1 Score: 114.775 bits (286), Expect = 4.910e-34
Identity = 52/89 (58.43%), Postives = 67/89 (75.28%), Query Frame = 1
Query:  121 EKELSVLLESPHNWKILDDREALYKEFQFKNFNKAFSFMTSVALLAEKMDHHPEWFNVYNKVRVTLSSHDVNGLSMRDIKMAKFMEKLK 387
            EKEL  LL +   W     R+A+ K+F FKNFN+AF FMT VAL+AEKMDHHPEW NVYNKV +TL++HD  G+S  D+KMA+F++ L+
Sbjct:   10 EKELKSLLST--GWVEAKTRDAIQKDFHFKNFNQAFGFMTQVALMAEKMDHHPEWSNVYNKVNITLTTHDCGGISSNDVKMAEFIDTLQ 96          
BLAST of Pterin-4-alpha-carbinolamine dehydratase vs. Ensembl Nematostella
Match: EDO48563 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIT0])

HSP 1 Score: 114.39 bits (285), Expect = 9.222e-34
Identity = 53/101 (52.48%), Postives = 74/101 (73.27%), Query Frame = 1
Query:   79 MSTDYKTKLSSDQLEKELSVLLESPHNWKILDDREALYKEFQFKNFNKAFSFMTSVALLAEKMDHHPEWFNVYNKVRVTLSSHDVNGLSMRDIKMAKFMEK 381
            MS   + KL  ++   +L  L ++   W  +++R+A+YKEF FK+FN+AF FM  VAL AEKMDHHPEWFNVYNKV++TLS+H+  GLS RD+ +A F+E+
Sbjct:    1 MSDAKRLKLDDEERNAKLPALKKA--GWSEVEERDAIYKEFMFKDFNQAFGFMARVALKAEKMDHHPEWFNVYNKVQITLSTHECTGLSDRDVNLATFIEQ 99          
BLAST of Pterin-4-alpha-carbinolamine dehydratase vs. Ensembl Medaka
Match: PCBD2 (pterin-4 alpha-carbinolamine dehydratase 2 [Source:NCBI gene;Acc:101171269])

HSP 1 Score: 117.857 bits (294), Expect = 3.342e-34
Identity = 57/106 (53.77%), Postives = 76/106 (71.70%), Query Frame = 1
Query:   73 AKMSTD--YKTKLSSDQLEKELSVLLESPHNWKILDDREALYKEFQFKNFNKAFSFMTSVALLAEKMDHHPEWFNVYNKVRVTLSSHDVNGLSMRDIKMAKFMEKL 384
            +KMS+D  +      DQL  EL         W  ++DR+A++KEF FK FN+AF FM+ VAL AEKM+HHPEWFNVYNKV++TL++HD  GLS RDIK+AKF++ +
Sbjct:   36 SKMSSDSHWLPPADRDQLMMELRAT-----GWMEVEDRDAIFKEFHFKTFNQAFGFMSRVALQAEKMNHHPEWFNVYNKVQITLTTHDCGGLSKRDIKLAKFIDNV 136          
BLAST of Pterin-4-alpha-carbinolamine dehydratase vs. Ensembl Medaka
Match: pcbd1 (pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha [Source:ZFIN;Acc:ZDB-GENE-040426-1787])

HSP 1 Score: 114.005 bits (284), Expect = 3.354e-33
Identity = 47/76 (61.84%), Postives = 62/76 (81.58%), Query Frame = 1
Query:  157 NWKILDDREALYKEFQFKNFNKAFSFMTSVALLAEKMDHHPEWFNVYNKVRVTLSSHDVNGLSMRDIKMAKFMEKL 384
             W  +  R+A+YKEF FK+FN+AF FM+ VAL AEKMDHHPEWFNVYNKV++TLS+HD  GLS RD+ +A F++++
Sbjct:   25 QWVEVGGRDAIYKEFVFKDFNQAFGFMSRVALRAEKMDHHPEWFNVYNKVQITLSTHDCGGLSQRDVSLATFIDQV 100          
BLAST of Pterin-4-alpha-carbinolamine dehydratase vs. Planmine SMEST
Match: SMESG000081287.1 (SMESG000081287.1)

HSP 1 Score: 256.144 bits (653), Expect = 3.172e-89
Identity = 125/125 (100.00%), Postives = 125/125 (100.00%), Query Frame = 1
Query:   16 MITKVIYSISSHYIPKIYFAKMSTDYKTKLSSDQLEKELSVLLESPHNWKILDDREALYKEFQFKNFNKAFSFMTSVALLAEKMDHHPEWFNVYNKVRVTLSSHDVNGLSMRDIKMAKFMEKLKE 390
            MITKVIYSISSHYIPKIYFAKMSTDYKTKLSSDQLEKELSVLLESPHNWKILDDREALYKEFQFKNFNKAFSFMTSVALLAEKMDHHPEWFNVYNKVRVTLSSHDVNGLSMRDIKMAKFMEKLKE
Sbjct:    1 MITKVIYSISSHYIPKIYFAKMSTDYKTKLSSDQLEKELSVLLESPHNWKILDDREALYKEFQFKNFNKAFSFMTSVALLAEKMDHHPEWFNVYNKVRVTLSSHDVNGLSMRDIKMAKFMEKLKE 125          
BLAST of Pterin-4-alpha-carbinolamine dehydratase vs. Planmine SMEST
Match: SMESG000081287.1 (SMESG000081287.1)

HSP 1 Score: 213.386 bits (542), Expect = 1.437e-72
Identity = 104/104 (100.00%), Postives = 104/104 (100.00%), Query Frame = 1
Query:   79 MSTDYKTKLSSDQLEKELSVLLESPHNWKILDDREALYKEFQFKNFNKAFSFMTSVALLAEKMDHHPEWFNVYNKVRVTLSSHDVNGLSMRDIKMAKFMEKLKE 390
            MSTDYKTKLSSDQLEKELSVLLESPHNWKILDDREALYKEFQFKNFNKAFSFMTSVALLAEKMDHHPEWFNVYNKVRVTLSSHDVNGLSMRDIKMAKFMEKLKE
Sbjct:    1 MSTDYKTKLSSDQLEKELSVLLESPHNWKILDDREALYKEFQFKNFNKAFSFMTSVALLAEKMDHHPEWFNVYNKVRVTLSSHDVNGLSMRDIKMAKFMEKLKE 104          
The following BLAST results are available for this feature:
BLAST of Pterin-4-alpha-carbinolamine dehydratase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
PCBD22.049e-3357.47pterin-4 alpha-carbinolamine dehydratase 2 [Source... [more]
PCBD22.049e-3357.47pterin-4 alpha-carbinolamine dehydratase 2 [Source... [more]
PCBD22.618e-3357.47pterin-4 alpha-carbinolamine dehydratase 2 [Source... [more]
PCBD12.462e-3261.84pterin-4 alpha-carbinolamine dehydratase 1 [Source... [more]
back to top
BLAST of Pterin-4-alpha-carbinolamine dehydratase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
pcbd-11.865e-3348.28Putative pterin-4-alpha-carbinolamine dehydratase ... [more]
back to top
BLAST of Pterin-4-alpha-carbinolamine dehydratase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Pcd1.585e-3254.26gene:FBgn0024841 transcript:FBtr0085458[more]
back to top
BLAST of Pterin-4-alpha-carbinolamine dehydratase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
pcbd12.999e-3263.51pterin-4 alpha-carbinolamine dehydratase/dimerizat... [more]
back to top
BLAST of Pterin-4-alpha-carbinolamine dehydratase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
pcbd16.533e-3456.84pterin-4 alpha-carbinolamine dehydratase/dimerizat... [more]
pcbd16.533e-3456.84pterin-4 alpha-carbinolamine dehydratase/dimerizat... [more]
dld6.136e-3158.67dihydrolipoamide dehydrogenase [Source:Xenbase;Acc... [more]
dld4.152e-1951.52dihydrolipoamide dehydrogenase [Source:Xenbase;Acc... [more]
back to top
BLAST of Pterin-4-alpha-carbinolamine dehydratase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Pcbd21.257e-3654.55pterin 4 alpha carbinolamine dehydratase/dimerizat... [more]
Pcbd21.532e-3556.31pterin 4 alpha carbinolamine dehydratase/dimerizat... [more]
Pcbd14.604e-3260.53pterin 4 alpha carbinolamine dehydratase/dimerizat... [more]
Pcbd15.738e-2368.52pterin 4 alpha carbinolamine dehydratase/dimerizat... [more]
back to top
BLAST of Pterin-4-alpha-carbinolamine dehydratase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P0C8L6|PHS_HYPDU2.511e-3672.00Probable pterin-4-alpha-carbinolamine dehydratase ... [more]
sp|P58249|PHS_DROVI5.366e-3659.57Pterin-4-alpha-carbinolamine dehydratase OS=Drosop... [more]
sp|Q9CZL5|PHS2_MOUSE8.793e-3654.55Pterin-4-alpha-carbinolamine dehydratase 2 OS=Mus ... [more]
sp|B2T7M8|PHS_PARPJ7.159e-3452.63Putative pterin-4-alpha-carbinolamine dehydratase ... [more]
sp|Q91901|PHS_XENLA4.032e-3356.84Pterin-4-alpha-carbinolamine dehydratase OS=Xenopu... [more]
back to top
BLAST of Pterin-4-alpha-carbinolamine dehydratase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5E4Q2882.383e-4159.38Uncharacterized protein OS=Leptidea sinapis OX=189... [more]
A0A1E1WEZ98.055e-4060.87Uncharacterized protein OS=Pectinophora gossypiell... [more]
A0A482W8N41.804e-3971.28Pterin-4-alpha-carbinolamine dehydratase OS=Asbolu... [more]
A0A210PVD73.754e-3960.55Pterin-4-alpha-carbinolamine dehydratase OS=Mizuho... [more]
A0A1A9VYB81.309e-3867.74Uncharacterized protein OS=Glossina austeni OX=739... [more]
back to top
BLAST of Pterin-4-alpha-carbinolamine dehydratase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PCBD24.677e-3350.94pterin-4 alpha-carbinolamine dehydratase 2 [Source... [more]
PCBD22.357e-3260.53pterin-4 alpha-carbinolamine dehydratase 2 [Source... [more]
pcbd12.909e-3256.32pterin-4 alpha-carbinolamine dehydratase 1 [Source... [more]
pcbd11.165e-2052.78pterin-4 alpha-carbinolamine dehydratase 1 [Source... [more]
pcbd11.791e-2052.78pterin-4 alpha-carbinolamine dehydratase 1 [Source... [more]
back to top
BLAST of Pterin-4-alpha-carbinolamine dehydratase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000010671.11.835e-3556.18pep scaffold:Pmarinus_7.0:GL476857:1325062:1327152... [more]
back to top
BLAST of Pterin-4-alpha-carbinolamine dehydratase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Pterin-4-alpha-carbinolamine dehydratase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO399491.168e-3653.70Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO276934.910e-3458.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO485639.222e-3452.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Pterin-4-alpha-carbinolamine dehydratase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
PCBD23.342e-3453.77pterin-4 alpha-carbinolamine dehydratase 2 [Source... [more]
pcbd13.354e-3361.84pterin-4 alpha-carbinolamine dehydratase/dimerizat... [more]
back to top
BLAST of Pterin-4-alpha-carbinolamine dehydratase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000081287.13.172e-89100.00SMESG000081287.1[more]
SMESG000081287.11.437e-72100.00SMESG000081287.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027974 ID=SMED30027974|Name=Pterin-4-alpha-carbinolamine dehydratase|organism=Schmidtea mediterranea sexual|type=transcript|length=478bp
ATTTAATATTTGTAAATGATAACTAAGGTCATTTATTCAATTTCTAGTCA
TTATATACCTAAGATCTATTTTGCTAAAATGTCTACAGACTATAAAACTA
AATTATCAAGTGATCAACTAGAAAAAGAATTGAGTGTTCTCCTAGAATCT
CCGCACAACTGGAAAATTTTAGACGATAGAGAAGCTTTATATAAAGAATT
TCAATTTAAAAATTTCAATAAAGCTTTTTCATTTATGACAAGTGTTGCAT
TGCTAGCTGAGAAAATGGATCATCATCCTGAGTGGTTCAATGTTTATAAT
AAAGTTAGAGTAACTCTTAGTAGTCACGATGTAAATGGCTTATCTATGCG
AGATATTAAAATGGCTAAATTTATGGAGAAATTGAAAGAATAATTATTTT
GACACGTAAAAGTTTGTTGATAAATTCATTTGAACTTTGAAATTTTTTTG
CGAATATCGAAAATTTTGATAAATAAAT
back to top

protein sequence of SMED30027974-orf-1

>SMED30027974-orf-1 ID=SMED30027974-orf-1|Name=SMED30027974-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=126bp
MITKVIYSISSHYIPKIYFAKMSTDYKTKLSSDQLEKELSVLLESPHNWK
ILDDREALYKEFQFKNFNKAFSFMTSVALLAEKMDHHPEWFNVYNKVRVT
LSSHDVNGLSMRDIKMAKFMEKLKE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036428PCD_sf
IPR001533Pterin_deHydtase
Vocabulary: molecular function
TermDefinition
GO:00081244-alpha-hydroxytetrahydrobiopterin dehydratase activity
GO:0003677DNA binding
GO:0003899DNA-directed 5'-3' RNA polymerase activity
Vocabulary: biological process
TermDefinition
GO:0006729tetrahydrobiopterin biosynthetic process
GO:0006351transcription, DNA-templated
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR036428Pterin 4 alpha carbinolamine dehydratase superfamilyGENE3DG3DSA:3.30.1360.20coord: 22..125
e-value: 2.0E-38
score: 132.2
IPR036428Pterin 4 alpha carbinolamine dehydratase superfamilySUPERFAMILYSSF55248PCD-likecoord: 29..123
IPR001533Pterin 4 alpha carbinolamine dehydratasePFAMPF01329Pterin_4acoord: 29..122
e-value: 7.9E-32
score: 109.3
IPR001533Pterin 4 alpha carbinolamine dehydratasePANTHERPTHR12599PTERIN-4-ALPHA-CARBINOLAMINE DEHYDRATASEcoord: 23..124
NoneNo IPR availablePANTHERPTHR12599:SF13PTERIN-4-ALPHA-CARBINOLAMINE DEHYDRATASEcoord: 23..124
NoneNo IPR availableCDDcd00914PCD_DCoH_subfamily_bcoord: 48..123
e-value: 5.30436E-47
score: 143.907