3'-phosphoadenosine 5'-phosphosulfate synthase

Overview
Name3'-phosphoadenosine 5'-phosphosulfate synthase
Smed IDSMED30027968
Length (bp)3144
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of 3'-phosphoadenosine 5'-phosphosulfate synthase (SMED30027968) t-SNE clustered cells

Violin plots show distribution of expression levels for 3'-phosphoadenosine 5'-phosphosulfate synthase (SMED30027968) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of 3'-phosphoadenosine 5'-phosphosulfate synthase (SMED30027968) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for 3'-phosphoadenosine 5'-phosphosulfate synthase (SMED30027968) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027968

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 15

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30027968SMESG000077893.1 dd_Smed_v4_2536_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30027968SMESG000077893.1 dd_Smed_v4_2536_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30027968SMESG000077893.1 dd_Smed_v4_2536_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30027968SMESG000077893.1 dd_Smed_v4_2536_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30027968SMESG000077893.1 dd_Smed_v4_2536_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30027968SMESG000077893.1 dd_Smed_v4_2536_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30027968SMESG000077893.1 dd_Smed_v4_2536_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30027968SMESG000077893.1 dd_Smed_v4_2536_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30027968SMESG000014746.1 Contig4309GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30027968SMESG000077893.1 Contig52046newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30027968SMESG000077893.1 Contig52046uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30027968SMESG000077896.1 SMESG000077893.1 Contig35062newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30027968SMESG000077896.1 SMESG000077893.1 Contig35062uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30027968SMESG000077893.1 Contig4309GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pigment cellSMED30027968SMESG000077893.1 dd_Smed_v6_2536_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of 3'-phosphoadenosine 5'-phosphosulfate synthase vs. Ensembl Human
Match: PAPSS2 (3'-phosphoadenosine 5'-phosphosulfate synthase 2 [Source:HGNC Symbol;Acc:HGNC:8604])

HSP 1 Score: 832.787 bits (2150), Expect = 0.000e+0
Identity = 378/597 (63.32%), Postives = 483/597 (80.90%), Query Frame = 3
Query: 1266 NENVFWQKKHVSRIKRGEILG-EGSFRGCTIWFTGLSGAGKTTLAFHLEHFLVAHGIPSYSLDGDNVRTGLNQNLGFTAEDREENIRRIAEVAKLFSDGGIVCLTSFISPFEKNRQQARELHSISGLPFFEVFIDTPIEICEERDVKGLYKKARAGEIKHFTGVDSAYEPPKNPDLVLKAGEKSVYECVDILVEFLRQKDILTDSIMMKYSELYVPENILDQARSEASNLPRINIKTIDCQWLQVLCEGWASPLTGFMKEREFLQCIHFNSL-NKGLYSQSIPIVLPINEEDKTAISNHPAIALCYDNRIVSIIRNPEIYKHRKEERCARTFGFVDKRHPSIKMIFESGDFLLGGDIEVLERFHWNDNLDKYRYTPKQIRQKMKEMNADTIFAFQLRNPIHNGHALLMQDARRKLIEMGYKNPVLLLHPLGGWTKDDDVPLNVRIKQHESVLDSGVLDRNSTILAIFPSPMIYAGPTEVQWHAKARMAAGVNYYIVGRDPAGIPHPETKEDLYDPFHGAEVLSMAPGLTKLEIIPFKVAAYDKLNKRMDYFDPNRKDDFIFISGTKMRNLAKNNECPPDGFMVPAAWEILRDYYQNL 3050
            + NV +Q  HVSR KRG+++G  G FRGCT+W TGLSGAGKTT++F LE +LV+H IP YSLDGDNVR GLN+NLGF+  DREENIRRIAEVAKLF+D G+VC+TSFISPF K+R+ AR++H  +GLPFFE+F+D P+ ICE RDVKGLYK+ARAGEIK FTG+DS YE P+ P+ VLK    +V +CV  +VE L++++I+  +I+    EL+VPEN LD  R+EA  LP ++I  +D QW+QVL EGWA+PL GFM+E+E+LQ +HF++L + G+ + SIPIVLP++ EDKT +       L +  R V+I+R+ E Y+HRKEERC+R +G    +HP IKM+ ESGD+L+GGD++VLE+  WND LD+YR TP +++QK KEMNAD +FAFQLRNP+HNGHALLMQD RR+L+E GYK+PVLLLHPLGGWTKDDDVPL+ R+KQH +VL+ GVLD  STI+AIFPSPM+YAGPTEVQWH ++RM AG N+YIVGRDPAG+PHPETK+DLY+P HG +VLSMAPGLT +EIIPF+VAAY+K  K MD++DP R ++F FISGT+MR LA+  E PPDGFM P AW++L DYY++L
Sbjct:   15 STNVVYQAHHVSRNKRGQVVGTRGGFRGCTVWLTGLSGAGKTTISFALEEYLVSHAIPCYSLDGDNVRHGLNRNLGFSPGDREENIRRIAEVAKLFADAGLVCITSFISPFAKDRENARKIHESAGLPFFEIFVDAPLNICESRDVKGLYKRARAGEIKGFTGIDSDYEKPETPERVLKTNLSTVSDCVHQVVELLQEQNIVPYTIIKDIHELFVPENKLDHVRAEAETLPSLSITKLDLQWVQVLSEGWATPLKGFMREKEYLQVMHFDTLLDDGVINMSIPIVLPVSAEDKTRLEGCSKFVLAHGGRRVAILRDAEFYEHRKEERCSRVWGTTCTKHPHIKMVMESGDWLVGGDLQVLEKIRWNDGLDQYRLTPLELKQKCKEMNADAVFAFQLRNPVHNGHALLMQDTRRRLLERGYKHPVLLLHPLGGWTKDDDVPLDWRMKQHAAVLEEGVLDPKSTIVAIFPSPMLYAGPTEVQWHCRSRMIAGANFYIVGRDPAGMPHPETKKDLYEPTHGGKVLSMAPGLTSVEIIPFRVAAYNKAKKAMDFYDPARHNEFDFISGTRMRKLAREGENPPDGFMAPKAWKVLTDYYRSL 611          
BLAST of 3'-phosphoadenosine 5'-phosphosulfate synthase vs. Ensembl Human
Match: PAPSS2 (3'-phosphoadenosine 5'-phosphosulfate synthase 2 [Source:HGNC Symbol;Acc:HGNC:8604])

HSP 1 Score: 829.321 bits (2141), Expect = 0.000e+0
Identity = 378/602 (62.79%), Postives = 482/602 (80.07%), Query Frame = 3
Query: 1266 NENVFWQKKHVSRIKRGEILG-EGSFRGCTIWFTGLSGAGKTTLAFHLEHFLVAHGIPSYSLDGDNVRTGLNQNLGFTAEDREENIRRIAEVAKLFSDGGIVCLTSFISPFEKNRQQARELHSISGLPFFEVFIDTPIEICEERDVKGLYKKARAGEIKHFTGVDSAYEPPKNPDLVLKAGEKSVYECVDILVEFLRQKDILTDSIMMKYSELYVPENILDQARSEASNLPRINIKTIDCQWLQVLCEGWASPLTGFMKEREFLQCIHFNSLNKGL------YSQSIPIVLPINEEDKTAISNHPAIALCYDNRIVSIIRNPEIYKHRKEERCARTFGFVDKRHPSIKMIFESGDFLLGGDIEVLERFHWNDNLDKYRYTPKQIRQKMKEMNADTIFAFQLRNPIHNGHALLMQDARRKLIEMGYKNPVLLLHPLGGWTKDDDVPLNVRIKQHESVLDSGVLDRNSTILAIFPSPMIYAGPTEVQWHAKARMAAGVNYYIVGRDPAGIPHPETKEDLYDPFHGAEVLSMAPGLTKLEIIPFKVAAYDKLNKRMDYFDPNRKDDFIFISGTKMRNLAKNNECPPDGFMVPAAWEILRDYYQNL 3050
            + NV +Q  HVSR KRG+++G  G FRGCT+W TGLSGAGKTT++F LE +LV+H IP YSLDGDNVR GLN+NLGF+  DREENIRRIAEVAKLF+D G+VC+TSFISPF K+R+ AR++H  +GLPFFE+F+D P+ ICE RDVKGLYK+ARAGEIK FTG+DS YE P+ P+ VLK    +V +CV  +VE L++++I+  +I+    EL+VPEN LD  R+EA  LP ++I  +D QW+QVL EGWA+PL GFM+E+E+LQ +HF++L  G+       + SIPIVLP++ EDKT +       L +  R V+I+R+ E Y+HRKEERC+R +G    +HP IKM+ ESGD+L+GGD++VLE+  WND LD+YR TP +++QK KEMNAD +FAFQLRNP+HNGHALLMQD RR+L+E GYK+PVLLLHPLGGWTKDDDVPL+ R+KQH +VL+ GVLD  STI+AIFPSPM+YAGPTEVQWH ++RM AG N+YIVGRDPAG+PHPETK+DLY+P HG +VLSMAPGLT +EIIPF+VAAY+K  K MD++DP R ++F FISGT+MR LA+  E PPDGFM P AW++L DYY++L
Sbjct:   15 STNVVYQAHHVSRNKRGQVVGTRGGFRGCTVWLTGLSGAGKTTISFALEEYLVSHAIPCYSLDGDNVRHGLNRNLGFSPGDREENIRRIAEVAKLFADAGLVCITSFISPFAKDRENARKIHESAGLPFFEIFVDAPLNICESRDVKGLYKRARAGEIKGFTGIDSDYEKPETPERVLKTNLSTVSDCVHQVVELLQEQNIVPYTIIKDIHELFVPENKLDHVRAEAETLPSLSITKLDLQWVQVLSEGWATPLKGFMREKEYLQVMHFDTLLDGMALPDGVINMSIPIVLPVSAEDKTRLEGCSKFVLAHGGRRVAILRDAEFYEHRKEERCSRVWGTTCTKHPHIKMVMESGDWLVGGDLQVLEKIRWNDGLDQYRLTPLELKQKCKEMNADAVFAFQLRNPVHNGHALLMQDTRRRLLERGYKHPVLLLHPLGGWTKDDDVPLDWRMKQHAAVLEEGVLDPKSTIVAIFPSPMLYAGPTEVQWHCRSRMIAGANFYIVGRDPAGMPHPETKKDLYEPTHGGKVLSMAPGLTSVEIIPFRVAAYNKAKKAMDFYDPARHNEFDFISGTRMRKLAREGENPPDGFMAPKAWKVLTDYYRSL 616          
BLAST of 3'-phosphoadenosine 5'-phosphosulfate synthase vs. Ensembl Human
Match: PAPSS1 (3'-phosphoadenosine 5'-phosphosulfate synthase 1 [Source:HGNC Symbol;Acc:HGNC:8603])

HSP 1 Score: 815.068 bits (2104), Expect = 0.000e+0
Identity = 368/595 (61.85%), Postives = 472/595 (79.33%), Query Frame = 3
Query: 1272 NVFWQKKHVSRIKRGEILG-EGSFRGCTIWFTGLSGAGKTTLAFHLEHFLVAHGIPSYSLDGDNVRTGLNQNLGFTAEDREENIRRIAEVAKLFSDGGIVCLTSFISPFEKNRQQARELHSISGLPFFEVFIDTPIEICEERDVKGLYKKARAGEIKHFTGVDSAYEPPKNPDLVLKAGEKSVYECVDILVEFLRQKDILTDSIMMKYSELYVPENILDQARSEASNLPRINIKTIDCQWLQVLCEGWASPLTGFMKEREFLQCIHFNSL-NKGLYSQSIPIVLPINEEDKTAISNHPAIALCYDNRIVSIIRNPEIYKHRKEERCARTFGFVDKRHPSIKMIFESGDFLLGGDIEVLERFHWNDNLDKYRYTPKQIRQKMKEMNADTIFAFQLRNPIHNGHALLMQDARRKLIEMGYKNPVLLLHPLGGWTKDDDVPLNVRIKQHESVLDSGVLDRNSTILAIFPSPMIYAGPTEVQWHAKARMAAGVNYYIVGRDPAGIPHPETKEDLYDPFHGAEVLSMAPGLTKLEIIPFKVAAYDKLNKRMDYFDPNRKDDFIFISGTKMRNLAKNNECPPDGFMVPAAWEILRDYYQNL 3050
            NV +Q  HVSR KRG+++G  G FRGCT+W TGLSGAGKTT++  LE +LV HGIP Y+LDGDN+R GLN+NLGF+ EDREEN+RRIAEVAKLF+D G+VC+TSFISP+ ++R  AR++H  + LPFFEVF+D P+ +CE+RDVKGLYKKARAGEIK FTG+DS YE P+ P+LVLK     V +CV  +VE L+++DI+      +  ELYVPEN L  A+++A  LP + I  +D QW+QVL EGWA+PL GFM+ERE+LQC+HF+ L + G+ + S+PIVL    EDK  +    A AL Y+ R V+I+RNPE ++HRKEERCAR +G   K HP IKM+ E GD+L+GGD++VL+R +WND LD+YR TP +++QK K+MNAD +FAFQLRNP+HNGHALLMQD  ++L+E GY+ PVLLLHPLGGWTKDDDVPL  R+KQH +VL+ GVL+  +T++AIFPSPM+YAGPTEVQWH +ARM AG N+YIVGRDPAG+PHPET +DLY+P HGA+VL+MAPGL  LEI+PF+VAAY+K  KRMDY+D    +DF FISGT+MR LA+  + PP+GFM P AW +L +YY++L
Sbjct:   27 NVTYQAHHVSRNKRGQVVGTRGGFRGCTVWLTGLSGAGKTTVSMALEEYLVCHGIPCYTLDGDNIRQGLNKNLGFSPEDREENVRRIAEVAKLFADAGLVCITSFISPYTQDRNNARQIHEGASLPFFEVFVDAPLHVCEQRDVKGLYKKARAGEIKGFTGIDSEYEKPEAPELVLKTDSCDVNDCVQQVVELLQERDIVPVDASYEVKELYVPENKLHLAKTDAETLPALKINKVDMQWVQVLAEGWATPLNGFMREREYLQCLHFDCLLDGGVINLSVPIVLTATHEDKERLDGCTAFALMYEGRRVAILRNPEFFEHRKEERCARQWGTTCKNHPYIKMVMEQGDWLIGGDLQVLDRVYWNDGLDQYRLTPTELKQKFKDMNADAVFAFQLRNPVHNGHALLMQDTHKQLLERGYRRPVLLLHPLGGWTKDDDVPLMWRMKQHAAVLEEGVLNPETTVVAIFPSPMMYAGPTEVQWHCRARMVAGANFYIVGRDPAGMPHPETGKDLYEPSHGAKVLTMAPGLITLEIVPFRVAAYNKKKKRMDYYDSEHHEDFEFISGTRMRKLAREGQKPPEGFMAPKAWTVLTEYYKSL 621          
BLAST of 3'-phosphoadenosine 5'-phosphosulfate synthase vs. Ensembl Celegans
Match: pps-1 (3'-Phosphoadenosine 5'-Phosphosulfate Synthetase [Source:UniProtKB/TrEMBL;Acc:Q22501])

HSP 1 Score: 709.909 bits (1831), Expect = 0.000e+0
Identity = 338/623 (54.25%), Postives = 458/623 (73.52%), Query Frame = 3
Query: 1272 NVFWQKKHVSRIKRGEILG--EGSFRGCTIWFTGLSGAGKTTLAFHLEHFLVAHGIPSYSLDGDNVRTGLNQNLGFTAEDREENIRRIAEVAKLFSDGGIVCLTSFISPFEKNRQQARELHSISGLPFFEVFIDTPIEICEERDVKGLYKKARAGEIKHFTGVDSAYEPPKNPDLVLKAGEKSVYECVDILVEFLRQKDILTDSI--MMKYSELYVPENI-LDQARSEASNLPRINIKTIDCQWLQVLCEGWASPLTGFMKEREFLQCIHFNSL----NKGLY------------------SQSIPIVLPINEEDKTAISNHPAIALCYDNRIVSIIRNPEIYKHRKEERCARTFGFVDKRHPSIKMIFESGDFLLGGDIEVLERFHWNDNLDKYRYTPKQIRQKMKEMNADTIFAFQLRNPIHNGHALLMQDARRKLIEMGYKNPVLLLHPLGGWTKDDDVPLNVRIKQHESVLDSGVLDRNSTILAIFPSPMIYAGPTEVQWHAKARMAAGVNYYIVGRDPAGIPHPETKEDLYDPFHGAEVLSMAPGLTKLEIIPFKVAAYDKLNKRMDYFDPNRKDDFIFISGTKMRNLAKNNECPPDGFMVPAAWEILRDYYQNLNNT 3059
            N+ +Q+  +SR +R   +G  EG FRGCTIWFTGLSGAGKTT++F LE  L   GIP Y LDGDN+R GL +NLGF+ EDR+ENIRR+AEVAKLF+D G++CL +FISPF+++R  AR++H    + F EV + T +E+CE+RD K LYKKARAG+I  FTG+DSAYEPP+N +++L AG+  V +CV  +++ L  K +L + I  +    EL+V +++ + +   E+ NLP + +  +D QWLQVL EGWA+PL+GFM+ER++LQ +HF  L    +K  +                  +QSIPIVLPI+++ K  +     IAL Y+ ++ +I+ +PEI++HRK+ER  R FG  D RHP++  + ESG++LLGGD+ V+++  +ND LDKYR TP ++R    E NAD +FAFQLRNPIHNGHALLM+D R KL+   +KNP+LLLHPLGGWTKDDDVPL++RIKQHE+V+   VLD   T+L+IFPSPM+YAGPTEVQWHA++R+AAG+ +YIVGRDPAGI  P + + LY+  HGA+VLSMAPGL+ L I+PF+VAAYDK  K+M +FD +RK+DF  ISGTKMR LA+N + PP+GFM P AWE+L  YY++L N+
Sbjct:   31 NITYQEHTISREERAAAVGRHEG-FRGCTIWFTGLSGAGKTTISFALERTLNKLGIPCYGLDGDNIRHGLCKNLGFSKEDRQENIRRVAEVAKLFADSGMICLAAFISPFQEDRLDARKIHESENVKFIEVHVSTTLEVCEQRDPKQLYKKARAGQILGFTGIDSAYEPPENAEIILDAGKDGVQQCVQKVLDHLESKGLLPEQIPDVPAVRELFVSDDLTVAELLKESQNLPTVELTKVDLQWLQVLAEGWATPLSGFMRERQYLQSMHFGQLLDLKHKVAFVGEKSDDKEDSWPMMDDINQSIPIVLPISDDVKKGLEGVTRIALKYNGQVYAILSDPEIFEHRKDERVCRQFGTNDPRHPAVAQVLESGNWLLGGDVAVVQKIQFNDGLDKYRKTPNELRAIFAEKNADAVFAFQLRNPIHNGHALLMRDTREKLL-AEHKNPILLLHPLGGWTKDDDVPLDIRIKQHEAVIAERVLDPEWTVLSIFPSPMMYAGPTEVQWHARSRIAAGIQHYIVGRDPAGIQKPGSPDALYETTHGAKVLSMAPGLSALHILPFRVAAYDKTAKKMSFFDTSRKEDFENISGTKMRGLARNGDTPPEGFMAPTAWEVLAGYYKSLQNS 651          
BLAST of 3'-phosphoadenosine 5'-phosphosulfate synthase vs. Ensembl Celegans
Match: pps-1 (3'-Phosphoadenosine 5'-Phosphosulfate Synthetase [Source:UniProtKB/TrEMBL;Acc:Q22501])

HSP 1 Score: 704.516 bits (1817), Expect = 0.000e+0
Identity = 338/625 (54.08%), Postives = 458/625 (73.28%), Query Frame = 3
Query: 1272 NVFWQKKHVSRIKRGEILG--EGSFRGCTIWFTGLSGAGKTTLAFHLEHFLVAHGIPSYSLDGDNVRTGLNQNLGFTAEDREENIRRIAEVAKLFSDGGIVCLTSFISPFEKNRQQARELHSISGLPFFEVFIDTPIEICEERDVK--GLYKKARAGEIKHFTGVDSAYEPPKNPDLVLKAGEKSVYECVDILVEFLRQKDILTDSI--MMKYSELYVPENI-LDQARSEASNLPRINIKTIDCQWLQVLCEGWASPLTGFMKEREFLQCIHFNSL----NKGLY------------------SQSIPIVLPINEEDKTAISNHPAIALCYDNRIVSIIRNPEIYKHRKEERCARTFGFVDKRHPSIKMIFESGDFLLGGDIEVLERFHWNDNLDKYRYTPKQIRQKMKEMNADTIFAFQLRNPIHNGHALLMQDARRKLIEMGYKNPVLLLHPLGGWTKDDDVPLNVRIKQHESVLDSGVLDRNSTILAIFPSPMIYAGPTEVQWHAKARMAAGVNYYIVGRDPAGIPHPETKEDLYDPFHGAEVLSMAPGLTKLEIIPFKVAAYDKLNKRMDYFDPNRKDDFIFISGTKMRNLAKNNECPPDGFMVPAAWEILRDYYQNLNNT 3059
            N+ +Q+  +SR +R   +G  EG FRGCTIWFTGLSGAGKTT++F LE  L   GIP Y LDGDN+R GL +NLGF+ EDR+ENIRR+AEVAKLF+D G++CL +FISPF+++R  AR++H    + F EV + T +E+CE+RD K   LYKKARAG+I  FTG+DSAYEPP+N +++L AG+  V +CV  +++ L  K +L + I  +    EL+V +++ + +   E+ NLP + +  +D QWLQVL EGWA+PL+GFM+ER++LQ +HF  L    +K  +                  +QSIPIVLPI+++ K  +     IAL Y+ ++ +I+ +PEI++HRK+ER  R FG  D RHP++  + ESG++LLGGD+ V+++  +ND LDKYR TP ++R    E NAD +FAFQLRNPIHNGHALLM+D R KL+   +KNP+LLLHPLGGWTKDDDVPL++RIKQHE+V+   VLD   T+L+IFPSPM+YAGPTEVQWHA++R+AAG+ +YIVGRDPAGI  P + + LY+  HGA+VLSMAPGL+ L I+PF+VAAYDK  K+M +FD +RK+DF  ISGTKMR LA+N + PP+GFM P AWE+L  YY++L N+
Sbjct:   31 NITYQEHTISREERAAAVGRHEG-FRGCTIWFTGLSGAGKTTISFALERTLNKLGIPCYGLDGDNIRHGLCKNLGFSKEDRQENIRRVAEVAKLFADSGMICLAAFISPFQEDRLDARKIHESENVKFIEVHVSTTLEVCEQRDPKPSELYKKARAGQILGFTGIDSAYEPPENAEIILDAGKDGVQQCVQKVLDHLESKGLLPEQIPDVPAVRELFVSDDLTVAELLKESQNLPTVELTKVDLQWLQVLAEGWATPLSGFMRERQYLQSMHFGQLLDLKHKVAFVGEKSDDKEDSWPMMDDINQSIPIVLPISDDVKKGLEGVTRIALKYNGQVYAILSDPEIFEHRKDERVCRQFGTNDPRHPAVAQVLESGNWLLGGDVAVVQKIQFNDGLDKYRKTPNELRAIFAEKNADAVFAFQLRNPIHNGHALLMRDTREKLL-AEHKNPILLLHPLGGWTKDDDVPLDIRIKQHEAVIAERVLDPEWTVLSIFPSPMMYAGPTEVQWHARSRIAAGIQHYIVGRDPAGIQKPGSPDALYETTHGAKVLSMAPGLSALHILPFRVAAYDKTAKKMSFFDTSRKEDFENISGTKMRGLARNGDTPPEGFMAPTAWEVLAGYYKSLQNS 653          
BLAST of 3'-phosphoadenosine 5'-phosphosulfate synthase vs. Ensembl Fly
Match: Papss (gene:FBgn0020389 transcript:FBtr0074888)

HSP 1 Score: 754.977 bits (1948), Expect = 0.000e+0
Identity = 364/622 (58.52%), Postives = 454/622 (72.99%), Query Frame = 3
Query: 1224 ITTLNSPEMTSKILNENVFWQKKHVSRIKRGEILGEG-SFRGCTIWFTGLSGAGKTTLAFHLEHFLVAHGIPSYSLDGDNVRTGLNQNLGFTAEDREENIRRIAEVAKLFSDGGIVCLTSFISPFEKNRQQARELHSISGLPFFEVFIDTPIEICEERDVKGLYKKARAGEIKHFTGVDSAYEPPKNPDLVLKAGEKSVYECVDILVEFLRQKDILTDSI--MMKYSELYVPENILDQA-RSEASNLPRINIKTIDCQWLQVLCEGWASPLTGFMKEREFLQCIHFNSLNKGL-----YSQSIPIVLPINEEDKTAISNHPAIALCYDNRIVSIIRNPEIYKHRKEERCARTFGFVDKRHPSIKMIFESGDFLLGGDIEVLERFHWNDNLDKYRYTPKQIRQKMKEMNADTIFAFQLRNPIHNGHALLMQDARRKLIEMGYKNPVLLLHPLGGWTKDDDVPLNVRIKQHESVLDSGVLDRNSTILAIFPSPMIYAGPTEVQWHAKARMAAGVNYYIVGRDPAGIPHP--ETKED--LYDPFHGAEVLSMAPGLTKLEIIPFKVAAYDKLNKRMDYFDPNRKDDFIFISGTKMRNLAKNNECPPDGFMVPAAWEILRDYYQNL 3050
            + ++  PE     +  NV  QK HV+R  RG+ LG    FRGCT+W TGLSGAGKT++AF LE +LV+ GIP+Y LDGDN+RTGLN+NLGFT  DREENIRR+ EVAKLF+D G+V + SF+SPF  +R+ AR++H  +GL F+E+F+DTP+++CE RDVKGLYKKAR G IK FTG+   YE P+ P+LV+     +V E    LV  L Q+ I+  S+  +    ELY  E+I  +A R EA +L  I I T++ QW+QVL EGWA PL GFM+E E+LQ +HFN+L  G+      + S+PIVL   + DK  +    ++ L Y  + V+I+R PE Y  RKEER AR FG  +  HP  K ++ESGD+L+GGD+ V+ER  W D LD+YR TP ++R++ KE+NAD IFAFQLRNPIHNGHALLMQD RR+L+E G+K PVLLLHPLGGWTKDDDVPL+VR+KQH++VLD+GVL R  T+LAIFPSPM+YAGPTEVQWHAKARM AG N+YIVGRDPAG+PHP  ET  D  LYD  HGA VL MA GL  +EI+PF+VAAYDK   RM +F+P RKD+F FISGTKMR LAK    PPDGFM P AW IL  YYQNL
Sbjct:   33 LPSVEKPEDACLQVATNVTEQKHHVTRETRGKNLGLCRGFRGCTVWLTGLSGAGKTSIAFELEAYLVSRGIPAYGLDGDNIRTGLNKNLGFTPADREENIRRVGEVAKLFADSGVVAICSFVSPFADDREMARKIHKDAGLKFYEIFVDTPLDVCETRDVKGLYKKAREGVIKGFTGITQEYERPQMPELVVNTHGYTVRESTQKLVTLLEQEGIIPRSLRDVDLLPELYPSESIATEALRHEAESLQAIEISTVELQWVQVLAEGWAYPLRGFMREDEYLQTLHFNTLQSGMDGSYRENHSVPIVLSATQADKDRLDGCSSLTLKYQGKAVAILRRPEFYFQRKEERLARQFGTSNPNHPYSKQVYESGDYLVGGDLAVIERIRWEDGLDQYRLTPNELRRRFKELNADAIFAFQLRNPIHNGHALLMQDTRRQLLERGFKQPVLLLHPLGGWTKDDDVPLDVRMKQHQAVLDAGVLRREDTVLAIFPSPMMYAGPTEVQWHAKARMNAGANFYIVGRDPAGMPHPAKETYPDGNLYDATHGARVLKMAQGLDSMEILPFRVAAYDKSASRMAFFEPKRKDEFEFISGTKMRTLAKTGASPPDGFMEPEAWRILATYYQNL 654          
BLAST of 3'-phosphoadenosine 5'-phosphosulfate synthase vs. Ensembl Fly
Match: Papss (gene:FBgn0020389 transcript:FBtr0074885)

HSP 1 Score: 753.051 bits (1943), Expect = 0.000e+0
Identity = 362/606 (59.74%), Postives = 448/606 (73.93%), Query Frame = 3
Query: 1272 NVFWQKKHVSRIKRGEILGE-GSFRGCTIWFTGLSGAGKTTLAFHLEHFLVAHGIPSYSLDGDNVRTGLNQNLGFTAEDREENIRRIAEVAKLFSDGGIVCLTSFISPFEKNRQQARELHSISGLPFFEVFIDTPIEICEERDVKGLYKKARAGEIKHFTGVDSAYEPPKNPDLVLKAGEKSVYECVDILVEFLRQKDILTDSI--MMKYSELYVPENILDQA-RSEASNLPRINIKTIDCQWLQVLCEGWASPLTGFMKEREFLQCIHFNSLNKGL-----YSQSIPIVLPINEEDKTAISNHPAIALCYDNRIVSIIRNPEIYKHRKEERCARTFGFVDKRHPSIKMIFESGDFLLGGDIEVLERFHWNDNLDKYRYTPKQIRQKMKEMNADTIFAFQLRNPIHNGHALLMQDARRKLIEMGYKNPVLLLHPLGGWTKDDDVPLNVRIKQHESVLDSGVLDRNSTILAIFPSPMIYAGPTEVQWHAKARMAAGVNYYIVGRDPAGIPHP--ETKED--LYDPFHGAEVLSMAPGLTKLEIIPFKVAAYDKLNKRMDYFDPNRKDDFIFISGTKMRNLAKNNECPPDGFMVPAAWEILRDYYQNL 3050
            NV  QK HV+R  RG+ LG    FRGCT+W TGLSGAGKT++AF LE +LV+ GIP+Y LDGDN+RTGLN+NLGFT  DREENIRR+ EVAKLF+D G+V + SF+SPF  +R+ AR++H  +GL F+E+F+DTP+++CE RDVKGLYKKAR G IK FTG+   YE P+ P+LV+     +V E    LV  L Q+ I+  S+  +    ELY  E+I  +A R EA +L  I I T++ QW+QVL EGWA PL GFM+E E+LQ +HFN+L  G+      + S+PIVL   + DK  +    ++ L Y  + V+I+R PE Y  RKEER AR FG  +  HP  K ++ESGD+L+GGD+ V+ER  W D LD+YR TP ++R++ KE+NAD IFAFQLRNPIHNGHALLMQD RR+L+E G+K PVLLLHPLGGWTKDDDVPL+VR+KQH++VLD+GVL R  T+LAIFPSPM+YAGPTEVQWHAKARM AG N+YIVGRDPAG+PHP  ET  D  LYD  HGA VL MA GL  +EI+PF+VAAYDK   RM +F+P RKD+F FISGTKMR LAK    PPDGFM P AW IL  YYQNL
Sbjct:   21 NVTEQKHHVTRETRGKNLGLCRGFRGCTVWLTGLSGAGKTSIAFELEAYLVSRGIPAYGLDGDNIRTGLNKNLGFTPADREENIRRVGEVAKLFADSGVVAICSFVSPFADDREMARKIHKDAGLKFYEIFVDTPLDVCETRDVKGLYKKAREGVIKGFTGITQEYERPQMPELVVNTHGYTVRESTQKLVTLLEQEGIIPRSLRDVDLLPELYPSESIATEALRHEAESLQAIEISTVELQWVQVLAEGWAYPLRGFMREDEYLQTLHFNTLQSGMDGSYRENHSVPIVLSATQADKDRLDGCSSLTLKYQGKAVAILRRPEFYFQRKEERLARQFGTSNPNHPYSKQVYESGDYLVGGDLAVIERIRWEDGLDQYRLTPNELRRRFKELNADAIFAFQLRNPIHNGHALLMQDTRRQLLERGFKQPVLLLHPLGGWTKDDDVPLDVRMKQHQAVLDAGVLRREDTVLAIFPSPMMYAGPTEVQWHAKARMNAGANFYIVGRDPAGMPHPAKETYPDGNLYDATHGARVLKMAQGLDSMEILPFRVAAYDKSASRMAFFEPKRKDEFEFISGTKMRTLAKTGASPPDGFMEPEAWRILATYYQNL 626          
BLAST of 3'-phosphoadenosine 5'-phosphosulfate synthase vs. Ensembl Fly
Match: Papss (gene:FBgn0020389 transcript:FBtr0074887)

HSP 1 Score: 753.051 bits (1943), Expect = 0.000e+0
Identity = 362/606 (59.74%), Postives = 448/606 (73.93%), Query Frame = 3
Query: 1272 NVFWQKKHVSRIKRGEILGE-GSFRGCTIWFTGLSGAGKTTLAFHLEHFLVAHGIPSYSLDGDNVRTGLNQNLGFTAEDREENIRRIAEVAKLFSDGGIVCLTSFISPFEKNRQQARELHSISGLPFFEVFIDTPIEICEERDVKGLYKKARAGEIKHFTGVDSAYEPPKNPDLVLKAGEKSVYECVDILVEFLRQKDILTDSI--MMKYSELYVPENILDQA-RSEASNLPRINIKTIDCQWLQVLCEGWASPLTGFMKEREFLQCIHFNSLNKGL-----YSQSIPIVLPINEEDKTAISNHPAIALCYDNRIVSIIRNPEIYKHRKEERCARTFGFVDKRHPSIKMIFESGDFLLGGDIEVLERFHWNDNLDKYRYTPKQIRQKMKEMNADTIFAFQLRNPIHNGHALLMQDARRKLIEMGYKNPVLLLHPLGGWTKDDDVPLNVRIKQHESVLDSGVLDRNSTILAIFPSPMIYAGPTEVQWHAKARMAAGVNYYIVGRDPAGIPHP--ETKED--LYDPFHGAEVLSMAPGLTKLEIIPFKVAAYDKLNKRMDYFDPNRKDDFIFISGTKMRNLAKNNECPPDGFMVPAAWEILRDYYQNL 3050
            NV  QK HV+R  RG+ LG    FRGCT+W TGLSGAGKT++AF LE +LV+ GIP+Y LDGDN+RTGLN+NLGFT  DREENIRR+ EVAKLF+D G+V + SF+SPF  +R+ AR++H  +GL F+E+F+DTP+++CE RDVKGLYKKAR G IK FTG+   YE P+ P+LV+     +V E    LV  L Q+ I+  S+  +    ELY  E+I  +A R EA +L  I I T++ QW+QVL EGWA PL GFM+E E+LQ +HFN+L  G+      + S+PIVL   + DK  +    ++ L Y  + V+I+R PE Y  RKEER AR FG  +  HP  K ++ESGD+L+GGD+ V+ER  W D LD+YR TP ++R++ KE+NAD IFAFQLRNPIHNGHALLMQD RR+L+E G+K PVLLLHPLGGWTKDDDVPL+VR+KQH++VLD+GVL R  T+LAIFPSPM+YAGPTEVQWHAKARM AG N+YIVGRDPAG+PHP  ET  D  LYD  HGA VL MA GL  +EI+PF+VAAYDK   RM +F+P RKD+F FISGTKMR LAK    PPDGFM P AW IL  YYQNL
Sbjct:   21 NVTEQKHHVTRETRGKNLGLCRGFRGCTVWLTGLSGAGKTSIAFELEAYLVSRGIPAYGLDGDNIRTGLNKNLGFTPADREENIRRVGEVAKLFADSGVVAICSFVSPFADDREMARKIHKDAGLKFYEIFVDTPLDVCETRDVKGLYKKAREGVIKGFTGITQEYERPQMPELVVNTHGYTVRESTQKLVTLLEQEGIIPRSLRDVDLLPELYPSESIATEALRHEAESLQAIEISTVELQWVQVLAEGWAYPLRGFMREDEYLQTLHFNTLQSGMDGSYRENHSVPIVLSATQADKDRLDGCSSLTLKYQGKAVAILRRPEFYFQRKEERLARQFGTSNPNHPYSKQVYESGDYLVGGDLAVIERIRWEDGLDQYRLTPNELRRRFKELNADAIFAFQLRNPIHNGHALLMQDTRRQLLERGFKQPVLLLHPLGGWTKDDDVPLDVRMKQHQAVLDAGVLRREDTVLAIFPSPMMYAGPTEVQWHAKARMNAGANFYIVGRDPAGMPHPAKETYPDGNLYDATHGARVLKMAQGLDSMEILPFRVAAYDKSASRMAFFEPKRKDEFEFISGTKMRTLAKTGASPPDGFMEPEAWRILATYYQNL 626          
BLAST of 3'-phosphoadenosine 5'-phosphosulfate synthase vs. Ensembl Fly
Match: Papss (gene:FBgn0020389 transcript:FBtr0074886)

HSP 1 Score: 753.051 bits (1943), Expect = 0.000e+0
Identity = 362/606 (59.74%), Postives = 448/606 (73.93%), Query Frame = 3
Query: 1272 NVFWQKKHVSRIKRGEILGE-GSFRGCTIWFTGLSGAGKTTLAFHLEHFLVAHGIPSYSLDGDNVRTGLNQNLGFTAEDREENIRRIAEVAKLFSDGGIVCLTSFISPFEKNRQQARELHSISGLPFFEVFIDTPIEICEERDVKGLYKKARAGEIKHFTGVDSAYEPPKNPDLVLKAGEKSVYECVDILVEFLRQKDILTDSI--MMKYSELYVPENILDQA-RSEASNLPRINIKTIDCQWLQVLCEGWASPLTGFMKEREFLQCIHFNSLNKGL-----YSQSIPIVLPINEEDKTAISNHPAIALCYDNRIVSIIRNPEIYKHRKEERCARTFGFVDKRHPSIKMIFESGDFLLGGDIEVLERFHWNDNLDKYRYTPKQIRQKMKEMNADTIFAFQLRNPIHNGHALLMQDARRKLIEMGYKNPVLLLHPLGGWTKDDDVPLNVRIKQHESVLDSGVLDRNSTILAIFPSPMIYAGPTEVQWHAKARMAAGVNYYIVGRDPAGIPHP--ETKED--LYDPFHGAEVLSMAPGLTKLEIIPFKVAAYDKLNKRMDYFDPNRKDDFIFISGTKMRNLAKNNECPPDGFMVPAAWEILRDYYQNL 3050
            NV  QK HV+R  RG+ LG    FRGCT+W TGLSGAGKT++AF LE +LV+ GIP+Y LDGDN+RTGLN+NLGFT  DREENIRR+ EVAKLF+D G+V + SF+SPF  +R+ AR++H  +GL F+E+F+DTP+++CE RDVKGLYKKAR G IK FTG+   YE P+ P+LV+     +V E    LV  L Q+ I+  S+  +    ELY  E+I  +A R EA +L  I I T++ QW+QVL EGWA PL GFM+E E+LQ +HFN+L  G+      + S+PIVL   + DK  +    ++ L Y  + V+I+R PE Y  RKEER AR FG  +  HP  K ++ESGD+L+GGD+ V+ER  W D LD+YR TP ++R++ KE+NAD IFAFQLRNPIHNGHALLMQD RR+L+E G+K PVLLLHPLGGWTKDDDVPL+VR+KQH++VLD+GVL R  T+LAIFPSPM+YAGPTEVQWHAKARM AG N+YIVGRDPAG+PHP  ET  D  LYD  HGA VL MA GL  +EI+PF+VAAYDK   RM +F+P RKD+F FISGTKMR LAK    PPDGFM P AW IL  YYQNL
Sbjct:   21 NVTEQKHHVTRETRGKNLGLCRGFRGCTVWLTGLSGAGKTSIAFELEAYLVSRGIPAYGLDGDNIRTGLNKNLGFTPADREENIRRVGEVAKLFADSGVVAICSFVSPFADDREMARKIHKDAGLKFYEIFVDTPLDVCETRDVKGLYKKAREGVIKGFTGITQEYERPQMPELVVNTHGYTVRESTQKLVTLLEQEGIIPRSLRDVDLLPELYPSESIATEALRHEAESLQAIEISTVELQWVQVLAEGWAYPLRGFMREDEYLQTLHFNTLQSGMDGSYRENHSVPIVLSATQADKDRLDGCSSLTLKYQGKAVAILRRPEFYFQRKEERLARQFGTSNPNHPYSKQVYESGDYLVGGDLAVIERIRWEDGLDQYRLTPNELRRRFKELNADAIFAFQLRNPIHNGHALLMQDTRRQLLERGFKQPVLLLHPLGGWTKDDDVPLDVRMKQHQAVLDAGVLRREDTVLAIFPSPMMYAGPTEVQWHAKARMNAGANFYIVGRDPAGMPHPAKETYPDGNLYDATHGARVLKMAQGLDSMEILPFRVAAYDKSASRMAFFEPKRKDEFEFISGTKMRTLAKTGASPPDGFMEPEAWRILATYYQNL 626          
BLAST of 3'-phosphoadenosine 5'-phosphosulfate synthase vs. Ensembl Fly
Match: Papss (gene:FBgn0020389 transcript:FBtr0332146)

HSP 1 Score: 753.051 bits (1943), Expect = 0.000e+0
Identity = 362/606 (59.74%), Postives = 448/606 (73.93%), Query Frame = 3
Query: 1272 NVFWQKKHVSRIKRGEILGE-GSFRGCTIWFTGLSGAGKTTLAFHLEHFLVAHGIPSYSLDGDNVRTGLNQNLGFTAEDREENIRRIAEVAKLFSDGGIVCLTSFISPFEKNRQQARELHSISGLPFFEVFIDTPIEICEERDVKGLYKKARAGEIKHFTGVDSAYEPPKNPDLVLKAGEKSVYECVDILVEFLRQKDILTDSI--MMKYSELYVPENILDQA-RSEASNLPRINIKTIDCQWLQVLCEGWASPLTGFMKEREFLQCIHFNSLNKGL-----YSQSIPIVLPINEEDKTAISNHPAIALCYDNRIVSIIRNPEIYKHRKEERCARTFGFVDKRHPSIKMIFESGDFLLGGDIEVLERFHWNDNLDKYRYTPKQIRQKMKEMNADTIFAFQLRNPIHNGHALLMQDARRKLIEMGYKNPVLLLHPLGGWTKDDDVPLNVRIKQHESVLDSGVLDRNSTILAIFPSPMIYAGPTEVQWHAKARMAAGVNYYIVGRDPAGIPHP--ETKED--LYDPFHGAEVLSMAPGLTKLEIIPFKVAAYDKLNKRMDYFDPNRKDDFIFISGTKMRNLAKNNECPPDGFMVPAAWEILRDYYQNL 3050
            NV  QK HV+R  RG+ LG    FRGCT+W TGLSGAGKT++AF LE +LV+ GIP+Y LDGDN+RTGLN+NLGFT  DREENIRR+ EVAKLF+D G+V + SF+SPF  +R+ AR++H  +GL F+E+F+DTP+++CE RDVKGLYKKAR G IK FTG+   YE P+ P+LV+     +V E    LV  L Q+ I+  S+  +    ELY  E+I  +A R EA +L  I I T++ QW+QVL EGWA PL GFM+E E+LQ +HFN+L  G+      + S+PIVL   + DK  +    ++ L Y  + V+I+R PE Y  RKEER AR FG  +  HP  K ++ESGD+L+GGD+ V+ER  W D LD+YR TP ++R++ KE+NAD IFAFQLRNPIHNGHALLMQD RR+L+E G+K PVLLLHPLGGWTKDDDVPL+VR+KQH++VLD+GVL R  T+LAIFPSPM+YAGPTEVQWHAKARM AG N+YIVGRDPAG+PHP  ET  D  LYD  HGA VL MA GL  +EI+PF+VAAYDK   RM +F+P RKD+F FISGTKMR LAK    PPDGFM P AW IL  YYQNL
Sbjct:   21 NVTEQKHHVTRETRGKNLGLCRGFRGCTVWLTGLSGAGKTSIAFELEAYLVSRGIPAYGLDGDNIRTGLNKNLGFTPADREENIRRVGEVAKLFADSGVVAICSFVSPFADDREMARKIHKDAGLKFYEIFVDTPLDVCETRDVKGLYKKAREGVIKGFTGITQEYERPQMPELVVNTHGYTVRESTQKLVTLLEQEGIIPRSLRDVDLLPELYPSESIATEALRHEAESLQAIEISTVELQWVQVLAEGWAYPLRGFMREDEYLQTLHFNTLQSGMDGSYRENHSVPIVLSATQADKDRLDGCSSLTLKYQGKAVAILRRPEFYFQRKEERLARQFGTSNPNHPYSKQVYESGDYLVGGDLAVIERIRWEDGLDQYRLTPNELRRRFKELNADAIFAFQLRNPIHNGHALLMQDTRRQLLERGFKQPVLLLHPLGGWTKDDDVPLDVRMKQHQAVLDAGVLRREDTVLAIFPSPMMYAGPTEVQWHAKARMNAGANFYIVGRDPAGMPHPAKETYPDGNLYDATHGARVLKMAQGLDSMEILPFRVAAYDKSASRMAFFEPKRKDEFEFISGTKMRTLAKTGASPPDGFMEPEAWRILATYYQNL 626          
BLAST of 3'-phosphoadenosine 5'-phosphosulfate synthase vs. Ensembl Zebrafish
Match: papss1 (3'-phosphoadenosine 5'-phosphosulfate synthase 1 [Source:ZFIN;Acc:ZDB-GENE-080721-5])

HSP 1 Score: 840.106 bits (2169), Expect = 0.000e+0
Identity = 377/607 (62.11%), Postives = 483/607 (79.57%), Query Frame = 3
Query: 1236 NSPEMTSKILNENVFWQKKHVSRIKRGEILG-EGSFRGCTIWFTGLSGAGKTTLAFHLEHFLVAHGIPSYSLDGDNVRTGLNQNLGFTAEDREENIRRIAEVAKLFSDGGIVCLTSFISPFEKNRQQARELHSISGLPFFEVFIDTPIEICEERDVKGLYKKARAGEIKHFTGVDSAYEPPKNPDLVLKAGEKSVYECVDILVEFLRQKDILTDSIMMKYSELYVPENILDQARSEASNLPRINIKTIDCQWLQVLCEGWASPLTGFMKEREFLQCIHFNSL-NKGLYSQSIPIVLPINEEDKTAISNHPAIALCYDNRIVSIIRNPEIYKHRKEERCARTFGFVDKRHPSIKMIFESGDFLLGGDIEVLERFHWNDNLDKYRYTPKQIRQKMKEMNADTIFAFQLRNPIHNGHALLMQDARRKLIEMGYKNPVLLLHPLGGWTKDDDVPLNVRIKQHESVLDSGVLDRNSTILAIFPSPMIYAGPTEVQWHAKARMAAGVNYYIVGRDPAGIPHPETKEDLYDPFHGAEVLSMAPGLTKLEIIPFKVAAYDKLNKRMDYFDPNRKDDFIFISGTKMRNLAKNNECPPDGFMVPAAWEILRDYYQNL 3050
            N+PE        NV +Q  HVSR KRG+++G  G FRGCT+W TGLSGAGKTT++  LE +LV HGIP Y+LDGDN+R GLN+NLGF+ EDREENIRRIAEVAKLF+D G+VC+ SFISP+ ++R  AR++H  +GLPFFEVF+D P+++CE+RDVKGLYK+ARAGEI+ FTG+DS YE P+ P+LVLK    SV EC+  L++ L+++DI+      +  ELYV EN LD A+++A  LP + I  +D QW+QVL EGWA+PL GFM+EREFLQC+HFN L + G+ + S+P+VLP++  DK  +    A AL Y  R V+I+RNPE Y+HRKEERCAR +G   K HP IKM+ ESGD+L+GGD++VL+R +WND LD YR TP +++QK KEMNAD +FAFQLRNP+HNGHALLMQD +R+LIE GY+ PVLLLHPLGGWTKDDDVPL  R+KQH +VL+ G+LD NSTI+AIFPSPM+YAGPTEVQWH +ARM AG N+YIVGRDPAG+PHP+T +DLY+P HGA+VL+MAPGL  LEI+PFKVAAY+K+ K MD++DP +  D+ FISGT+MR +A+  + PP+GFM P AW +L++YYQ+L
Sbjct:   15 NAPESWGMQRATNVTYQAHHVSRNKRGQVVGTRGGFRGCTVWLTGLSGAGKTTVSMALEEYLVCHGIPCYTLDGDNIRQGLNKNLGFSPEDREENIRRIAEVAKLFADAGLVCIASFISPYSRDRMNARKIHEAAGLPFFEVFVDAPLDVCEQRDVKGLYKRARAGEIRGFTGIDSEYEKPEAPELVLKTDSCSVNECIQQLLDLLQERDIVPVDASYEVKELYVAENKLDLAKADAETLPAVEITKVDMQWVQVLAEGWATPLNGFMREREFLQCLHFNCLLDGGVINLSVPVVLPVSSADKERLDGSTAFALAYGGRRVAILRNPEFYEHRKEERCARQWGTTCKDHPHIKMVMESGDWLVGGDLQVLDRIYWNDGLDSYRLTPTELKQKFKEMNADAVFAFQLRNPVHNGHALLMQDTQRRLIERGYRRPVLLLHPLGGWTKDDDVPLAWRMKQHAAVLEEGLLDPNSTIVAIFPSPMMYAGPTEVQWHCRARMVAGANFYIVGRDPAGMPHPDTGKDLYEPSHGAKVLTMAPGLISLEIVPFKVAAYNKVKKAMDFYDPKKHQDYDFISGTRMRRMAREGQNPPEGFMAPKAWNVLKEYYQSL 621          
BLAST of 3'-phosphoadenosine 5'-phosphosulfate synthase vs. Ensembl Zebrafish
Match: papss2b (3'-phosphoadenosine 5'-phosphosulfate synthase 2b [Source:ZFIN;Acc:ZDB-GENE-010323-5])

HSP 1 Score: 833.943 bits (2153), Expect = 0.000e+0
Identity = 378/595 (63.53%), Postives = 485/595 (81.51%), Query Frame = 3
Query: 1272 NVFWQKKHVSRIKRGEILG-EGSFRGCTIWFTGLSGAGKTTLAFHLEHFLVAHGIPSYSLDGDNVRTGLNQNLGFTAEDREENIRRIAEVAKLFSDGGIVCLTSFISPFEKNRQQARELHSISGLPFFEVFIDTPIEICEERDVKGLYKKARAGEIKHFTGVDSAYEPPKNPDLVLKAGEKSVYECVDILVEFLRQKDILTDSIMMKYSELYVPENILDQARSEASNLPRINIKTIDCQWLQVLCEGWASPLTGFMKEREFLQCIHFNSL-NKGLYSQSIPIVLPINEEDKTAISNHPAIALCYDNRIVSIIRNPEIYKHRKEERCARTFGFVDKRHPSIKMIFESGDFLLGGDIEVLERFHWNDNLDKYRYTPKQIRQKMKEMNADTIFAFQLRNPIHNGHALLMQDARRKLIEMGYKNPVLLLHPLGGWTKDDDVPLNVRIKQHESVLDSGVLDRNSTILAIFPSPMIYAGPTEVQWHAKARMAAGVNYYIVGRDPAGIPHPETKEDLYDPFHGAEVLSMAPGLTKLEIIPFKVAAYDKLNKRMDYFDPNRKDDFIFISGTKMRNLAKNNECPPDGFMVPAAWEILRDYYQNL 3050
            NV +Q  HVSR KRG+++G  G FRGCT+W TGLSGAGKTT+ F LE +LV+H IP YSLDGDN+R GLN+NLGFT+ DREENIRRIAEVAKLF+D G+VC+TSFISPF K+R++AR++H  +GLPFFEVF++ P+E+CE RDVKGLYKKARAGEIK FTG+DS YE P+ P+LVLK GE +V +C+  +V+ L+++DI+   +  + +EL+VPEN LD   S+A+ LP + I  +D QW+QVL EGWA+PL GFM+EREFLQ +HF +L + G+ + S+PIVLP+ +EDK  +    A  L ++ + V+I+RNPE Y+HRKEERCAR +G    +HP IKM+ ESGD+L GG++EVLER  WND LD+YR TP+Q+RQK KEM AD IFAFQLRNP+HNGHALLMQD +R+L++ GYK PVLLLHPLGGWTK+DDVPL+ R++QH +VL+ GVLD  +TI+AIFPSPM+YAGPTEVQWH +ARM AG N+YIVGRDPAG+PHPETK+DLY+P HG +VL+MAPGLT LEIIPF+VAAY+++ + MD++D  R  +F FISGTKMR+LA++ E PPDGFM P AW++L +YY +L
Sbjct:   16 NVVYQAHHVSRSKRGQVVGTRGGFRGCTVWLTGLSGAGKTTIGFALEEYLVSHAIPCYSLDGDNIRHGLNKNLGFTSTDREENIRRIAEVAKLFADAGLVCITSFISPFTKDRKEARKIHESAGLPFFEVFVNAPLEVCESRDVKGLYKKARAGEIKGFTGIDSDYEKPEAPELVLKTGELTVNDCIHQVVDLLKEQDIVPTGVTEEVNELFVPENKLDLVLSDANILPTVTITELDLQWVQVLAEGWATPLRGFMREREFLQVLHFGTLLDGGIINMSVPIVLPVCKEDKERLDGCAAFVLEFNGQKVAIMRNPEFYEHRKEERCARQWGTTCPKHPYIKMVMESGDWLAGGELEVLERIKWNDGLDQYRLTPQQLRQKFKEMRADAIFAFQLRNPVHNGHALLMQDTKRRLLDRGYKKPVLLLHPLGGWTKEDDVPLDWRMRQHAAVLEEGVLDPENTIVAIFPSPMMYAGPTEVQWHCRARMIAGANFYIVGRDPAGMPHPETKQDLYEPTHGGKVLTMAPGLTSLEIIPFRVAAYNRVKRAMDFYDKERHGEFEFISGTKMRSLARSGENPPDGFMAPKAWKVLVEYYSSL 610          
BLAST of 3'-phosphoadenosine 5'-phosphosulfate synthase vs. Ensembl Zebrafish
Match: papss2a (3'-phosphoadenosine 5'-phosphosulfate synthase 2a [Source:ZFIN;Acc:ZDB-GENE-061110-85])

HSP 1 Score: 821.617 bits (2121), Expect = 0.000e+0
Identity = 374/600 (62.33%), Postives = 479/600 (79.83%), Query Frame = 3
Query: 1266 NENVFWQKKHVSRIKRGEILG-EGSFRGCTIWFTGLSGAGKTTLAFHLEHFLVAHGIPSYSLDGDNVRTGLNQNLGFTAEDREENIRRIAEVAKLFSDGGIVCLTSFISPFEKNRQQARELHSISGLPFFEVFIDTPIEICEERDVKGLYKKARAGEIKHFTGVDSAYEPPKNPDLVLKAGEKSVYECVDILVEFLRQKDILTDSIMMKYSELYVPENILDQARSEASNLPRINIKTIDCQWLQVLCEGWASPLTGFMKEREFLQCIHFNSLNKGL-YSQSIPIVLPINEEDKTAISNHPAIALCYDNRIVSIIRNPEIYKHRKEERCARTFGFVDKRHPSIKMIFESGDFLLGGDIEVLERFHWNDNLDKYRYTPKQIRQKMKEMNADTIFAFQLRNPIHNGHALLMQDARRKLIEMGYKNPVLLLHPLGGWTKDDDVPLNVRIKQHESVLDSGVLDRNSTILAIFPSPMIYAGPTEVQWHAKARMAAGVNYYIVGRDPAGIPHPETKEDLYDPFHGAEVLSMAPGLTKLEIIPFKVAAYDKLNKRMDYFDPNRKDDFIFISGTKMRNLAKNNECPPDGFMVPAAWEILRDYYQNLNNT 3059
            + NV +Q  HVSR KRG+++G  G FRGCT+W TGLSGAGKTT+ F LE +LV+H IP YSLDGDN+R GLN++L FT+EDREENIRRIAEVAKLF+D G+VC+TSFISPF K+R +AR +H  +GLPFFEVF++ P+++CE RDVKGLYKKARAG+IK FTG+DS YE P+ P+LVL+ GE +V E +  LVE L++  I+   ++ + +EL+VPEN L  A++EAS LP I+I  +D QW+QVL EGWASPL GFM+ERE+LQ IHF++L +G   + S+PIVLP+  E K  +    A+AL Y  + ++I+RNPE Y+HRKEERCAR +G    +HP IKM+ ESGD+L+GGD+EVLER  WND LD+YR TP++++Q+ KEM AD +FAFQLRNP+HNGHALLM D RR++ E GY+ PVLLLHPLGGWTKDDDVPL  R+KQH +V++ GVLD  S+I+AIFPSPM+YAGPTEVQWH +ARM AG N+YIVGRDPAG+PHPE+ +DLY+P HGA+VLSMAPGL  +EIIPF+VAAY+K  + MD++D +R  +F FISGTKMR LA++ E PPDGFM P AW++L +YY +L   
Sbjct:   13 STNVVYQDHHVSRSKRGQVVGTRGGFRGCTVWLTGLSGAGKTTVGFALEEYLVSHRIPCYSLDGDNIRHGLNKDLSFTSEDREENIRRIAEVAKLFADAGLVCITSFISPFTKDRAEARIIHEKAGLPFFEVFVNAPLDVCESRDVKGLYKKARAGQIKGFTGIDSEYEHPEAPELVLRTGELTVNESIQQLVELLKKHSIIPSGVVEEINELFVPENRLKLAQAEASTLPSISITKLDLQWVQVLAEGWASPLKGFMREREYLQAIHFDTLLEGCAINLSVPIVLPVATEIKERLQGTAAVALKYQEKPIAILRNPEFYEHRKEERCARQWGTTCPKHPYIKMVLESGDWLVGGDLEVLERIKWNDGLDQYRLTPRELKQRFKEMKADAVFAFQLRNPVHNGHALLMTDTRRRINERGYRRPVLLLHPLGGWTKDDDVPLEWRMKQHAAVMEDGVLDPKSSIVAIFPSPMMYAGPTEVQWHCRARMVAGCNFYIVGRDPAGMPHPESGQDLYEPTHGAKVLSMAPGLNSVEIIPFRVAAYNKTKRAMDFYDKDRHAEFEFISGTKMRKLARSGENPPDGFMAPKAWKVLTEYYTSLQKV 612          
BLAST of 3'-phosphoadenosine 5'-phosphosulfate synthase vs. Ensembl Zebrafish
Match: papss2a (3'-phosphoadenosine 5'-phosphosulfate synthase 2a [Source:ZFIN;Acc:ZDB-GENE-061110-85])

HSP 1 Score: 821.617 bits (2121), Expect = 0.000e+0
Identity = 374/600 (62.33%), Postives = 479/600 (79.83%), Query Frame = 3
Query: 1266 NENVFWQKKHVSRIKRGEILG-EGSFRGCTIWFTGLSGAGKTTLAFHLEHFLVAHGIPSYSLDGDNVRTGLNQNLGFTAEDREENIRRIAEVAKLFSDGGIVCLTSFISPFEKNRQQARELHSISGLPFFEVFIDTPIEICEERDVKGLYKKARAGEIKHFTGVDSAYEPPKNPDLVLKAGEKSVYECVDILVEFLRQKDILTDSIMMKYSELYVPENILDQARSEASNLPRINIKTIDCQWLQVLCEGWASPLTGFMKEREFLQCIHFNSLNKGL-YSQSIPIVLPINEEDKTAISNHPAIALCYDNRIVSIIRNPEIYKHRKEERCARTFGFVDKRHPSIKMIFESGDFLLGGDIEVLERFHWNDNLDKYRYTPKQIRQKMKEMNADTIFAFQLRNPIHNGHALLMQDARRKLIEMGYKNPVLLLHPLGGWTKDDDVPLNVRIKQHESVLDSGVLDRNSTILAIFPSPMIYAGPTEVQWHAKARMAAGVNYYIVGRDPAGIPHPETKEDLYDPFHGAEVLSMAPGLTKLEIIPFKVAAYDKLNKRMDYFDPNRKDDFIFISGTKMRNLAKNNECPPDGFMVPAAWEILRDYYQNLNNT 3059
            + NV +Q  HVSR KRG+++G  G FRGCT+W TGLSGAGKTT+ F LE +LV+H IP YSLDGDN+R GLN++L FT+EDREENIRRIAEVAKLF+D G+VC+TSFISPF K+R +AR +H  +GLPFFEVF++ P+++CE RDVKGLYKKARAG+IK FTG+DS YE P+ P+LVL+ GE +V E +  LVE L++  I+   ++ + +EL+VPEN L  A++EAS LP I+I  +D QW+QVL EGWASPL GFM+ERE+LQ IHF++L +G   + S+PIVLP+  E K  +    A+AL Y  + ++I+RNPE Y+HRKEERCAR +G    +HP IKM+ ESGD+L+GGD+EVLER  WND LD+YR TP++++Q+ KEM AD +FAFQLRNP+HNGHALLM D RR++ E GY+ PVLLLHPLGGWTKDDDVPL  R+KQH +V++ GVLD  S+I+AIFPSPM+YAGPTEVQWH +ARM AG N+YIVGRDPAG+PHPE+ +DLY+P HGA+VLSMAPGL  +EIIPF+VAAY+K  + MD++D +R  +F FISGTKMR LA++ E PPDGFM P AW++L +YY +L   
Sbjct:   13 STNVVYQDHHVSRSKRGQVVGTRGGFRGCTVWLTGLSGAGKTTVGFALEEYLVSHRIPCYSLDGDNIRHGLNKDLSFTSEDREENIRRIAEVAKLFADAGLVCITSFISPFTKDRAEARIIHEKAGLPFFEVFVNAPLDVCESRDVKGLYKKARAGQIKGFTGIDSEYEHPEAPELVLRTGELTVNESIQQLVELLKKHSIIPSGVVEEINELFVPENRLKLAQAEASTLPSISITKLDLQWVQVLAEGWASPLKGFMREREYLQAIHFDTLLEGCAINLSVPIVLPVATEIKERLQGTAAVALKYQEKPIAILRNPEFYEHRKEERCARQWGTTCPKHPYIKMVLESGDWLVGGDLEVLERIKWNDGLDQYRLTPRELKQRFKEMKADAVFAFQLRNPVHNGHALLMTDTRRRINERGYRRPVLLLHPLGGWTKDDDVPLEWRMKQHAAVMEDGVLDPKSSIVAIFPSPMMYAGPTEVQWHCRARMVAGCNFYIVGRDPAGMPHPESGQDLYEPTHGAKVLSMAPGLNSVEIIPFRVAAYNKTKRAMDFYDKDRHAEFEFISGTKMRKLARSGENPPDGFMAPKAWKVLTEYYTSLQKV 612          
BLAST of 3'-phosphoadenosine 5'-phosphosulfate synthase vs. Ensembl Zebrafish
Match: papss2a (3'-phosphoadenosine 5'-phosphosulfate synthase 2a [Source:ZFIN;Acc:ZDB-GENE-061110-85])

HSP 1 Score: 821.231 bits (2120), Expect = 0.000e+0
Identity = 374/600 (62.33%), Postives = 479/600 (79.83%), Query Frame = 3
Query: 1266 NENVFWQKKHVSRIKRGEILG-EGSFRGCTIWFTGLSGAGKTTLAFHLEHFLVAHGIPSYSLDGDNVRTGLNQNLGFTAEDREENIRRIAEVAKLFSDGGIVCLTSFISPFEKNRQQARELHSISGLPFFEVFIDTPIEICEERDVKGLYKKARAGEIKHFTGVDSAYEPPKNPDLVLKAGEKSVYECVDILVEFLRQKDILTDSIMMKYSELYVPENILDQARSEASNLPRINIKTIDCQWLQVLCEGWASPLTGFMKEREFLQCIHFNSLNKGL-YSQSIPIVLPINEEDKTAISNHPAIALCYDNRIVSIIRNPEIYKHRKEERCARTFGFVDKRHPSIKMIFESGDFLLGGDIEVLERFHWNDNLDKYRYTPKQIRQKMKEMNADTIFAFQLRNPIHNGHALLMQDARRKLIEMGYKNPVLLLHPLGGWTKDDDVPLNVRIKQHESVLDSGVLDRNSTILAIFPSPMIYAGPTEVQWHAKARMAAGVNYYIVGRDPAGIPHPETKEDLYDPFHGAEVLSMAPGLTKLEIIPFKVAAYDKLNKRMDYFDPNRKDDFIFISGTKMRNLAKNNECPPDGFMVPAAWEILRDYYQNLNNT 3059
            + NV +Q  HVSR KRG+++G  G FRGCT+W TGLSGAGKTT+ F LE +LV+H IP YSLDGDN+R GLN++L FT+EDREENIRRIAEVAKLF+D G+VC+TSFISPF K+R +AR +H  +GLPFFEVF++ P+++CE RDVKGLYKKARAG+IK FTG+DS YE P+ P+LVL+ GE +V E +  LVE L++  I+   ++ + +EL+VPEN L  A++EAS LP I+I  +D QW+QVL EGWASPL GFM+ERE+LQ IHF++L +G   + S+PIVLP+  E K  +    A+AL Y  + ++I+RNPE Y+HRKEERCAR +G    +HP IKM+ ESGD+L+GGD+EVLER  WND LD+YR TP++++Q+ KEM AD +FAFQLRNP+HNGHALLM D RR++ E GY+ PVLLLHPLGGWTKDDDVPL  R+KQH +V++ GVLD  S+I+AIFPSPM+YAGPTEVQWH +ARM AG N+YIVGRDPAG+PHPE+ +DLY+P HGA+VLSMAPGL  +EIIPF+VAAY+K  + MD++D +R  +F FISGTKMR LA++ E PPDGFM P AW++L +YY +L   
Sbjct:   12 STNVVYQDHHVSRSKRGQVVGTRGGFRGCTVWLTGLSGAGKTTVGFALEEYLVSHRIPCYSLDGDNIRHGLNKDLSFTSEDREENIRRIAEVAKLFADAGLVCITSFISPFTKDRAEARIIHEKAGLPFFEVFVNAPLDVCESRDVKGLYKKARAGQIKGFTGIDSEYEHPEAPELVLRTGELTVNESIQQLVELLKKHSIIPSGVVEEINELFVPENRLKLAQAEASTLPSISITKLDLQWVQVLAEGWASPLKGFMREREYLQAIHFDTLLEGCAINLSVPIVLPVATEIKERLQGTAAVALKYQEKPIAILRNPEFYEHRKEERCARQWGTTCPKHPYIKMVLESGDWLVGGDLEVLERIKWNDGLDQYRLTPRELKQRFKEMKADAVFAFQLRNPVHNGHALLMTDTRRRINERGYRRPVLLLHPLGGWTKDDDVPLEWRMKQHAAVMEDGVLDPKSSIVAIFPSPMMYAGPTEVQWHCRARMVAGCNFYIVGRDPAGMPHPESGQDLYEPTHGAKVLSMAPGLNSVEIIPFRVAAYNKTKRAMDFYDKDRHAEFEFISGTKMRKLARSGENPPDGFMAPKAWKVLTEYYTSLQKV 611          
BLAST of 3'-phosphoadenosine 5'-phosphosulfate synthase vs. Ensembl Xenopus
Match: PAPSS2 (3'-phosphoadenosine 5'-phosphosulfate synthase 2 [Source:NCBI gene;Acc:100494746])

HSP 1 Score: 828.165 bits (2138), Expect = 0.000e+0
Identity = 379/597 (63.48%), Postives = 477/597 (79.90%), Query Frame = 3
Query: 1272 NVFWQKKHVSRIKRGEILG-EGSFRGCTIWFTGLSGAGKTTLAFHLEHFLVAHGIPSYSLDGDNVRTGLNQNLGFTAEDREENIRRIAEVAKLFSDGGIVCLTSFISPFEKNRQQARELHSISGLPFFEVFIDTPIEICEERDVKGLYKKARAGEIKHFTGVDSAYEPPKNPDLVLKAGEKSVYECVDILVEFLRQKDILTDSIMMKYSELYVPENILDQARSEASNLPRINIKTIDCQWLQVLCEGWASPLTGFMKEREFLQCIHFNSL---NKGLYSQSIPIVLPINEEDKTAISNHPAIALCYDNRIVSIIRNPEIYKHRKEERCARTFGFVDKRHPSIKMIFESGDFLLGGDIEVLERFHWNDNLDKYRYTPKQIRQKMKEMNADTIFAFQLRNPIHNGHALLMQDARRKLIEMGYKNPVLLLHPLGGWTKDDDVPLNVRIKQHESVLDSGVLDRNSTILAIFPSPMIYAGPTEVQWHAKARMAAGVNYYIVGRDPAGIPHPETKEDLYDPFHGAEVLSMAPGLTKLEIIPFKVAAYDKLNKRMDYFDPNRKDDFIFISGTKMRNLAKNNECPPDGFMVPAAWEILRDYYQNL 3050
            NV +Q  HVSR KRG+++G  G FRGCT+W TGLSGAGKTTL F LE +LV H IP YSLDGDN+R GLN+NLGF++EDREENIRRIAEVAKLF+D G+VC+TSFISP+ K+R+ AR++H  +GLPFFE+F+D P+ ICE RDVKGLYKKARAGEIK FTG+DS YE P+ P+LVLK    SV +C+  +VE L+++ I+      +  EL+VPEN L++ + EA  LP + I  +D QW+QVL EGWA+PL GFM+E E+LQ +HF++L   N G  + SIPIVLP++ EDK  ++N  AIAL Y+ + V+I+RNPE ++HRKEERCAR +G    +HP IKMI ESGD+L+GGD+EVLER  W D LD+YR TP +++Q+ K+MNAD +F FQLRNP+HNGHALLMQD RR L+  GYK PVLLLHPLGGWTKDDDVPL+ R+KQH++VL+ GVLD  +TI+AIFPSPM+YAGPTEVQWH +ARM AG N+YIVGRDPAG+PHPETK+DLY+  HG +VLSMAPGLT +EIIPF+VAAY+K NK M+++D  R D+F FISGT+MR LA+  + PPDGFM P AW++L DYY +L
Sbjct:   14 NVVYQSHHVSRSKRGQVVGTRGGFRGCTVWLTGLSGAGKTTLGFALEEYLVTHAIPCYSLDGDNIRHGLNKNLGFSSEDREENIRRIAEVAKLFADAGLVCITSFISPYTKDREDARKVHESAGLPFFEIFVDAPLNICESRDVKGLYKKARAGEIKGFTGIDSLYEKPEAPELVLKTNVHSVNDCIQQIVELLQERAIVPSGATKEVHELFVPENKLNEVKREAETLPSVGINKVDLQWVQVLSEGWATPLRGFMRESEYLQVLHFDTLLDGNGGTINMSIPIVLPVSAEDKERLANVDAIALKYEGKNVAILRNPEFFEHRKEERCARVWGTTCAKHPHIKMIMESGDWLVGGDLEVLERIRWGDGLDQYRLTPLELKQRAKDMNADVVFCFQLRNPVHNGHALLMQDTRRHLLSRGYKCPVLLLHPLGGWTKDDDVPLDWRMKQHDAVLEEGVLDPKTTIVAIFPSPMLYAGPTEVQWHCRARMIAGSNFYIVGRDPAGMPHPETKQDLYEVTHGGKVLSMAPGLTSVEIIPFRVAAYNKKNKAMEFYDKERHDEFDFISGTRMRKLAREGQNPPDGFMAPKAWKVLTDYYCSL 610          
BLAST of 3'-phosphoadenosine 5'-phosphosulfate synthase vs. Ensembl Xenopus
Match: PAPSS2 (3'-phosphoadenosine 5'-phosphosulfate synthase 2 [Source:NCBI gene;Acc:100494746])

HSP 1 Score: 827.78 bits (2137), Expect = 0.000e+0
Identity = 378/597 (63.32%), Postives = 478/597 (80.07%), Query Frame = 3
Query: 1266 NENVFWQKKHVSRIKRGEILG-EGSFRGCTIWFTGLSGAGKTTLAFHLEHFLVAHGIPSYSLDGDNVRTGLNQNLGFTAEDREENIRRIAEVAKLFSDGGIVCLTSFISPFEKNRQQARELHSISGLPFFEVFIDTPIEICEERDVKGLYKKARAGEIKHFTGVDSAYEPPKNPDLVLKAGEKSVYECVDILVEFLRQKDILTDSIMMKYSELYVPENILDQARSEASNLPRINIKTIDCQWLQVLCEGWASPLTGFMKEREFLQCIHFNSL-NKGLYSQSIPIVLPINEEDKTAISNHPAIALCYDNRIVSIIRNPEIYKHRKEERCARTFGFVDKRHPSIKMIFESGDFLLGGDIEVLERFHWNDNLDKYRYTPKQIRQKMKEMNADTIFAFQLRNPIHNGHALLMQDARRKLIEMGYKNPVLLLHPLGGWTKDDDVPLNVRIKQHESVLDSGVLDRNSTILAIFPSPMIYAGPTEVQWHAKARMAAGVNYYIVGRDPAGIPHPETKEDLYDPFHGAEVLSMAPGLTKLEIIPFKVAAYDKLNKRMDYFDPNRKDDFIFISGTKMRNLAKNNECPPDGFMVPAAWEILRDYYQNL 3050
            + NV +Q  HVSR KRG+++G  G FRGCT+W TGLSGAGKTTL F LE +LV H IP YSLDGDN+R GLN+NLGF++EDREENIRRIAEVAKLF+D G+VC+TSFISP+ K+R+ AR++H  +GLPFFE+F+D P+ ICE RDVKGLYKKARAGEIK FTG+DS YE P+ P+LVLK    SV +C+  +VE L+++ I+      +  EL+VPEN L++ + EA  LP + I  +D QW+QVL EGWA+PL GFM+E E+LQ +HF++L + G  + SIPIVLP++ EDK  ++N  AIAL Y+ + V+I+RNPE ++HRKEERCAR +G    +HP IKMI ESGD+L+GGD+EVLER  W D LD+YR TP +++Q+ K+MNAD +F FQLRNP+HNGHALLMQD RR L+  GYK PVLLLHPLGGWTKDDDVPL+ R+KQH++VL+ GVLD  +TI+AIFPSPM+YAGPTEVQWH +ARM AG N+YIVGRDPAG+PHPETK+DLY+  HG +VLSMAPGLT +EIIPF+VAAY+K NK M+++D  R D+F FISGT+MR LA+  + PPDGFM P AW++L DYY +L
Sbjct:   56 STNVVYQSHHVSRSKRGQVVGTRGGFRGCTVWLTGLSGAGKTTLGFALEEYLVTHAIPCYSLDGDNIRHGLNKNLGFSSEDREENIRRIAEVAKLFADAGLVCITSFISPYTKDREDARKVHESAGLPFFEIFVDAPLNICESRDVKGLYKKARAGEIKGFTGIDSLYEKPEAPELVLKTNVHSVNDCIQQIVELLQERAIVPSGATKEVHELFVPENKLNEVKREAETLPSVGINKVDLQWVQVLSEGWATPLRGFMRESEYLQVLHFDTLLDGGTINMSIPIVLPVSAEDKERLANVDAIALKYEGKNVAILRNPEFFEHRKEERCARVWGTTCAKHPHIKMIMESGDWLVGGDLEVLERIRWGDGLDQYRLTPLELKQRAKDMNADVVFCFQLRNPVHNGHALLMQDTRRHLLSRGYKCPVLLLHPLGGWTKDDDVPLDWRMKQHDAVLEEGVLDPKTTIVAIFPSPMLYAGPTEVQWHCRARMIAGSNFYIVGRDPAGMPHPETKQDLYEVTHGGKVLSMAPGLTSVEIIPFRVAAYNKKNKAMEFYDKERHDEFDFISGTRMRKLAREGQNPPDGFMAPKAWKVLTDYYCSL 652          
BLAST of 3'-phosphoadenosine 5'-phosphosulfate synthase vs. Ensembl Xenopus
Match: PAPSS2 (3'-phosphoadenosine 5'-phosphosulfate synthase 2 [Source:NCBI gene;Acc:100494746])

HSP 1 Score: 827.395 bits (2136), Expect = 0.000e+0
Identity = 378/597 (63.32%), Postives = 478/597 (80.07%), Query Frame = 3
Query: 1266 NENVFWQKKHVSRIKRGEILG-EGSFRGCTIWFTGLSGAGKTTLAFHLEHFLVAHGIPSYSLDGDNVRTGLNQNLGFTAEDREENIRRIAEVAKLFSDGGIVCLTSFISPFEKNRQQARELHSISGLPFFEVFIDTPIEICEERDVKGLYKKARAGEIKHFTGVDSAYEPPKNPDLVLKAGEKSVYECVDILVEFLRQKDILTDSIMMKYSELYVPENILDQARSEASNLPRINIKTIDCQWLQVLCEGWASPLTGFMKEREFLQCIHFNSL-NKGLYSQSIPIVLPINEEDKTAISNHPAIALCYDNRIVSIIRNPEIYKHRKEERCARTFGFVDKRHPSIKMIFESGDFLLGGDIEVLERFHWNDNLDKYRYTPKQIRQKMKEMNADTIFAFQLRNPIHNGHALLMQDARRKLIEMGYKNPVLLLHPLGGWTKDDDVPLNVRIKQHESVLDSGVLDRNSTILAIFPSPMIYAGPTEVQWHAKARMAAGVNYYIVGRDPAGIPHPETKEDLYDPFHGAEVLSMAPGLTKLEIIPFKVAAYDKLNKRMDYFDPNRKDDFIFISGTKMRNLAKNNECPPDGFMVPAAWEILRDYYQNL 3050
            + NV +Q  HVSR KRG+++G  G FRGCT+W TGLSGAGKTTL F LE +LV H IP YSLDGDN+R GLN+NLGF++EDREENIRRIAEVAKLF+D G+VC+TSFISP+ K+R+ AR++H  +GLPFFE+F+D P+ ICE RDVKGLYKKARAGEIK FTG+DS YE P+ P+LVLK    SV +C+  +VE L+++ I+      +  EL+VPEN L++ + EA  LP + I  +D QW+QVL EGWA+PL GFM+E E+LQ +HF++L + G  + SIPIVLP++ EDK  ++N  AIAL Y+ + V+I+RNPE ++HRKEERCAR +G    +HP IKMI ESGD+L+GGD+EVLER  W D LD+YR TP +++Q+ K+MNAD +F FQLRNP+HNGHALLMQD RR L+  GYK PVLLLHPLGGWTKDDDVPL+ R+KQH++VL+ GVLD  +TI+AIFPSPM+YAGPTEVQWH +ARM AG N+YIVGRDPAG+PHPETK+DLY+  HG +VLSMAPGLT +EIIPF+VAAY+K NK M+++D  R D+F FISGT+MR LA+  + PPDGFM P AW++L DYY +L
Sbjct:   23 STNVVYQSHHVSRSKRGQVVGTRGGFRGCTVWLTGLSGAGKTTLGFALEEYLVTHAIPCYSLDGDNIRHGLNKNLGFSSEDREENIRRIAEVAKLFADAGLVCITSFISPYTKDREDARKVHESAGLPFFEIFVDAPLNICESRDVKGLYKKARAGEIKGFTGIDSLYEKPEAPELVLKTNVHSVNDCIQQIVELLQERAIVPSGATKEVHELFVPENKLNEVKREAETLPSVGINKVDLQWVQVLSEGWATPLRGFMRESEYLQVLHFDTLLDGGTINMSIPIVLPVSAEDKERLANVDAIALKYEGKNVAILRNPEFFEHRKEERCARVWGTTCAKHPHIKMIMESGDWLVGGDLEVLERIRWGDGLDQYRLTPLELKQRAKDMNADVVFCFQLRNPVHNGHALLMQDTRRHLLSRGYKCPVLLLHPLGGWTKDDDVPLDWRMKQHDAVLEEGVLDPKTTIVAIFPSPMLYAGPTEVQWHCRARMIAGSNFYIVGRDPAGMPHPETKQDLYEVTHGGKVLSMAPGLTSVEIIPFRVAAYNKKNKAMEFYDKERHDEFDFISGTRMRKLAREGQNPPDGFMAPKAWKVLTDYYCSL 619          
BLAST of 3'-phosphoadenosine 5'-phosphosulfate synthase vs. Ensembl Xenopus
Match: PAPSS2 (3'-phosphoadenosine 5'-phosphosulfate synthase 2 [Source:NCBI gene;Acc:100494746])

HSP 1 Score: 827.395 bits (2136), Expect = 0.000e+0
Identity = 380/606 (62.71%), Postives = 481/606 (79.37%), Query Frame = 3
Query: 1239 SPEMTSKILNENVFWQKKHVSRIKRGEILG-EGSFRGCTIWFTGLSGAGKTTLAFHLEHFLVAHGIPSYSLDGDNVRTGLNQNLGFTAEDREENIRRIAEVAKLFSDGGIVCLTSFISPFEKNRQQARELHSISGLPFFEVFIDTPIEICEERDVKGLYKKARAGEIKHFTGVDSAYEPPKNPDLVLKAGEKSVYECVDILVEFLRQKDILTDSIMMKYSELYVPENILDQARSEASNLPRINIKTIDCQWLQVLCEGWASPLTGFMKEREFLQCIHFNSL-NKGLYSQSIPIVLPINEEDKTAISNHPAIALCYDNRIVSIIRNPEIYKHRKEERCARTFGFVDKRHPSIKMIFESGDFLLGGDIEVLERFHWNDNLDKYRYTPKQIRQKMKEMNADTIFAFQLRNPIHNGHALLMQDARRKLIEMGYKNPVLLLHPLGGWTKDDDVPLNVRIKQHESVLDSGVLDRNSTILAIFPSPMIYAGPTEVQWHAKARMAAGVNYYIVGRDPAGIPHPETKEDLYDPFHGAEVLSMAPGLTKLEIIPFKVAAYDKLNKRMDYFDPNRKDDFIFISGTKMRNLAKNNECPPDGFMVPAAWEILRDYYQNL 3050
            S E    + + NV +Q  HVSR KRG+++G  G FRGCT+W TGLSGAGKTTL F LE +LV H IP YSLDGDN+R GLN+NLGF++EDREENIRRIAEVAKLF+D G+VC+TSFISP+ K+R+ AR++H  +GLPFFE+F+D P+ ICE RDVKGLYKKARAGEIK FTG+DS YE P+ P+LVLK    SV +C+  +VE L+++ I+      +  EL+VPEN L++ + EA  LP + I  +D QW+QVL EGWA+PL GFM+E E+LQ +HF++L + G  + SIPIVLP++ EDK  ++N  AIAL Y+ + V+I+RNPE ++HRKEERCAR +G    +HP IKMI ESGD+L+GGD+EVLER  W D LD+YR TP +++Q+ K+MNAD +F FQLRNP+HNGHALLMQD RR L+  GYK PVLLLHPLGGWTKDDDVPL+ R+KQH++VL+ GVLD  +TI+AIFPSPM+YAGPTEVQWH +ARM AG N+YIVGRDPAG+PHPETK+DLY+  HG +VLSMAPGLT +EIIPF+VAAY+K NK M+++D  R D+F FISGT+MR LA+  + PPDGFM P AW++L DYY +L
Sbjct:   24 SRECGHILRSTNVVYQSHHVSRSKRGQVVGTRGGFRGCTVWLTGLSGAGKTTLGFALEEYLVTHAIPCYSLDGDNIRHGLNKNLGFSSEDREENIRRIAEVAKLFADAGLVCITSFISPYTKDREDARKVHESAGLPFFEIFVDAPLNICESRDVKGLYKKARAGEIKGFTGIDSLYEKPEAPELVLKTNVHSVNDCIQQIVELLQERAIVPSGATKEVHELFVPENKLNEVKREAETLPSVGINKVDLQWVQVLSEGWATPLRGFMRESEYLQVLHFDTLLDGGTINMSIPIVLPVSAEDKERLANVDAIALKYEGKNVAILRNPEFFEHRKEERCARVWGTTCAKHPHIKMIMESGDWLVGGDLEVLERIRWGDGLDQYRLTPLELKQRAKDMNADVVFCFQLRNPVHNGHALLMQDTRRHLLSRGYKCPVLLLHPLGGWTKDDDVPLDWRMKQHDAVLEEGVLDPKTTIVAIFPSPMLYAGPTEVQWHCRARMIAGSNFYIVGRDPAGMPHPETKQDLYEVTHGGKVLSMAPGLTSVEIIPFRVAAYNKKNKAMEFYDKERHDEFDFISGTRMRKLAREGQNPPDGFMAPKAWKVLTDYYCSL 629          
BLAST of 3'-phosphoadenosine 5'-phosphosulfate synthase vs. Ensembl Xenopus
Match: PAPSS2 (3'-phosphoadenosine 5'-phosphosulfate synthase 2 [Source:NCBI gene;Acc:100494746])

HSP 1 Score: 827.395 bits (2136), Expect = 0.000e+0
Identity = 378/595 (63.53%), Postives = 477/595 (80.17%), Query Frame = 3
Query: 1272 NVFWQKKHVSRIKRGEILG-EGSFRGCTIWFTGLSGAGKTTLAFHLEHFLVAHGIPSYSLDGDNVRTGLNQNLGFTAEDREENIRRIAEVAKLFSDGGIVCLTSFISPFEKNRQQARELHSISGLPFFEVFIDTPIEICEERDVKGLYKKARAGEIKHFTGVDSAYEPPKNPDLVLKAGEKSVYECVDILVEFLRQKDILTDSIMMKYSELYVPENILDQARSEASNLPRINIKTIDCQWLQVLCEGWASPLTGFMKEREFLQCIHFNSL-NKGLYSQSIPIVLPINEEDKTAISNHPAIALCYDNRIVSIIRNPEIYKHRKEERCARTFGFVDKRHPSIKMIFESGDFLLGGDIEVLERFHWNDNLDKYRYTPKQIRQKMKEMNADTIFAFQLRNPIHNGHALLMQDARRKLIEMGYKNPVLLLHPLGGWTKDDDVPLNVRIKQHESVLDSGVLDRNSTILAIFPSPMIYAGPTEVQWHAKARMAAGVNYYIVGRDPAGIPHPETKEDLYDPFHGAEVLSMAPGLTKLEIIPFKVAAYDKLNKRMDYFDPNRKDDFIFISGTKMRNLAKNNECPPDGFMVPAAWEILRDYYQNL 3050
            NV +Q  HVSR KRG+++G  G FRGCT+W TGLSGAGKTTL F LE +LV H IP YSLDGDN+R GLN+NLGF++EDREENIRRIAEVAKLF+D G+VC+TSFISP+ K+R+ AR++H  +GLPFFE+F+D P+ ICE RDVKGLYKKARAGEIK FTG+DS YE P+ P+LVLK    SV +C+  +VE L+++ I+      +  EL+VPEN L++ + EA  LP + I  +D QW+QVL EGWA+PL GFM+E E+LQ +HF++L + G  + SIPIVLP++ EDK  ++N  AIAL Y+ + V+I+RNPE ++HRKEERCAR +G    +HP IKMI ESGD+L+GGD+EVLER  W D LD+YR TP +++Q+ K+MNAD +F FQLRNP+HNGHALLMQD RR L+  GYK PVLLLHPLGGWTKDDDVPL+ R+KQH++VL+ GVLD  +TI+AIFPSPM+YAGPTEVQWH +ARM AG N+YIVGRDPAG+PHPETK+DLY+  HG +VLSMAPGLT +EIIPF+VAAY+K NK M+++D  R D+F FISGT+MR LA+  + PPDGFM P AW++L DYY +L
Sbjct:   14 NVVYQSHHVSRSKRGQVVGTRGGFRGCTVWLTGLSGAGKTTLGFALEEYLVTHAIPCYSLDGDNIRHGLNKNLGFSSEDREENIRRIAEVAKLFADAGLVCITSFISPYTKDREDARKVHESAGLPFFEIFVDAPLNICESRDVKGLYKKARAGEIKGFTGIDSLYEKPEAPELVLKTNVHSVNDCIQQIVELLQERAIVPSGATKEVHELFVPENKLNEVKREAETLPSVGINKVDLQWVQVLSEGWATPLRGFMRESEYLQVLHFDTLLDGGTINMSIPIVLPVSAEDKERLANVDAIALKYEGKNVAILRNPEFFEHRKEERCARVWGTTCAKHPHIKMIMESGDWLVGGDLEVLERIRWGDGLDQYRLTPLELKQRAKDMNADVVFCFQLRNPVHNGHALLMQDTRRHLLSRGYKCPVLLLHPLGGWTKDDDVPLDWRMKQHDAVLEEGVLDPKTTIVAIFPSPMLYAGPTEVQWHCRARMIAGSNFYIVGRDPAGMPHPETKQDLYEVTHGGKVLSMAPGLTSVEIIPFRVAAYNKKNKAMEFYDKERHDEFDFISGTRMRKLAREGQNPPDGFMAPKAWKVLTDYYCSL 608          
BLAST of 3'-phosphoadenosine 5'-phosphosulfate synthase vs. Ensembl Mouse
Match: Papss2 (3'-phosphoadenosine 5'-phosphosulfate synthase 2 [Source:MGI Symbol;Acc:MGI:1330223])

HSP 1 Score: 833.558 bits (2152), Expect = 0.000e+0
Identity = 376/607 (61.94%), Postives = 487/607 (80.23%), Query Frame = 3
Query: 1245 EMTSKILNENVFWQKKHVSRIKRGEILG-EGSFRGCTIWFTGLSGAGKTTLAFHLEHFLVAHGIPSYSLDGDNVRTGLNQNLGFTAEDREENIRRIAEVAKLFSDGGIVCLTSFISPFEKNRQQARELHSISGLPFFEVFIDTPIEICEERDVKGLYKKARAGEIKHFTGVDSAYEPPKNPDLVLKAGEKSVYECVDILVEFLRQKDILTDSIMMKYSELYVPENILDQARSEASNLPRINIKTIDCQWLQVLCEGWASPLTGFMKEREFLQCIHFNSL-NKGLYSQSIPIVLPINEEDKTAISNHPAIALCYDNRIVSIIRNPEIYKHRKEERCARTFGFVDKRHPSIKMIFESGDFLLGGDIEVLERFHWNDNLDKYRYTPKQIRQKMKEMNADTIFAFQLRNPIHNGHALLMQDARRKLIEMGYKNPVLLLHPLGGWTKDDDVPLNVRIKQHESVLDSGVLDRNSTILAIFPSPMIYAGPTEVQWHAKARMAAGVNYYIVGRDPAGIPHPETKEDLYDPFHGAEVLSMAPGLTKLEIIPFKVAAYDKLNKRMDYFDPNRKDDFIFISGTKMRNLAKNNECPPDGFMVPAAWEILRDYYQNLNNT 3059
            + T +  + NV +Q  HVSR KRG+++G  G FRGCT+W TGLSGAGKTT++F LE +LV+H IP YSLDGDNVR GLN+NLGF+A DREENIRRIAEVA+LF+D G+VC+TSFISPF K+R+ AR++H  +GLPFFE+F+D P+ ICE RDVKGLYK+ARAGEIK FTG+DS YE P+ P+ VLK    SV +CV  +VE L++++I+  + +    EL+VPEN +DQ R+EA  LP + I  +D QW+Q+L EGWA+PL GFM+E+E+LQ +HF++L + G+ + SIPIVLP++ +DK  +      AL Y+ R V+++++PE Y+HRKEERC+R +G    +HP IKM+ ESGD+L+GGD++VLER  W+D LD+YR TP +++QK K+MNAD +FAFQLRNP+HNGHALLMQD RR+L+E GYK+PVLLLHPLGGWTKDDDVPL  R+KQH +VL+  VLD  STI+AIFPSPM+YAGPTEVQWH + RM AG N+YIVGRDPAG+PHPETK+DLY+P HG +VLSMAPGLT +EIIPF+VAAY+K+ K MD++DP R ++F FISGT+MR LA+  E PPDGFM P AW++L DYY++L  T
Sbjct:    7 QKTDQQKSTNVVYQAHHVSRNKRGQVVGTRGGFRGCTVWLTGLSGAGKTTISFALEEYLVSHAIPCYSLDGDNVRHGLNKNLGFSAGDREENIRRIAEVARLFADAGLVCITSFISPFAKDRENARKIHESAGLPFFEIFVDAPLNICESRDVKGLYKRARAGEIKGFTGIDSDYEKPETPECVLKTNLSSVSDCVQQVVELLQEQNIVPHTTIKGIHELFVPENKVDQIRAEAETLPSLPITKLDLQWVQILSEGWATPLKGFMREKEYLQTLHFDTLLDDGVINMSIPIVLPVSADDKARLEGCSKFALMYEGRRVALLQDPEFYEHRKEERCSRVWGTATAKHPHIKMVMESGDWLVGGDLQVLERIRWDDGLDQYRLTPLELKQKCKDMNADAVFAFQLRNPVHNGHALLMQDTRRRLLERGYKHPVLLLHPLGGWTKDDDVPLEWRMKQHAAVLEERVLDPKSTIVAIFPSPMLYAGPTEVQWHCRCRMIAGANFYIVGRDPAGMPHPETKKDLYEPTHGGKVLSMAPGLTSVEIIPFRVAAYNKIKKAMDFYDPARHEEFDFISGTRMRKLAREGEDPPDGFMAPKAWKVLTDYYRSLEKT 613          
BLAST of 3'-phosphoadenosine 5'-phosphosulfate synthase vs. Ensembl Mouse
Match: Papss2 (3'-phosphoadenosine 5'-phosphosulfate synthase 2 [Source:MGI Symbol;Acc:MGI:1330223])

HSP 1 Score: 831.632 bits (2147), Expect = 0.000e+0
Identity = 375/600 (62.50%), Postives = 484/600 (80.67%), Query Frame = 3
Query: 1266 NENVFWQKKHVSRIKRGEILG-EGSFRGCTIWFTGLSGAGKTTLAFHLEHFLVAHGIPSYSLDGDNVRTGLNQNLGFTAEDREENIRRIAEVAKLFSDGGIVCLTSFISPFEKNRQQARELHSISGLPFFEVFIDTPIEICEERDVKGLYKKARAGEIKHFTGVDSAYEPPKNPDLVLKAGEKSVYECVDILVEFLRQKDILTDSIMMKYSELYVPENILDQARSEASNLPRINIKTIDCQWLQVLCEGWASPLTGFMKEREFLQCIHFNSL-NKGLYSQSIPIVLPINEEDKTAISNHPAIALCYDNRIVSIIRNPEIYKHRKEERCARTFGFVDKRHPSIKMIFESGDFLLGGDIEVLERFHWNDNLDKYRYTPKQIRQKMKEMNADTIFAFQLRNPIHNGHALLMQDARRKLIEMGYKNPVLLLHPLGGWTKDDDVPLNVRIKQHESVLDSGVLDRNSTILAIFPSPMIYAGPTEVQWHAKARMAAGVNYYIVGRDPAGIPHPETKEDLYDPFHGAEVLSMAPGLTKLEIIPFKVAAYDKLNKRMDYFDPNRKDDFIFISGTKMRNLAKNNECPPDGFMVPAAWEILRDYYQNLNNT 3059
            + NV +Q  HVSR KRG+++G  G FRGCT+W TGLSGAGKTT++F LE +LV+H IP YSLDGDNVR GLN+NLGF+A DREENIRRIAEVA+LF+D G+VC+TSFISPF K+R+ AR++H  +GLPFFE+F+D P+ ICE RDVKGLYK+ARAGEIK FTG+DS YE P+ P+ VLK    SV +CV  +VE L++++I+  + +    EL+VPEN +DQ R+EA  LP + I  +D QW+Q+L EGWA+PL GFM+E+E+LQ +HF++L + G+ + SIPIVLP++ +DK  +      AL Y+ R V+++++PE Y+HRKEERC+R +G    +HP IKM+ ESGD+L+GGD++VLER  W+D LD+YR TP +++QK K+MNAD +FAFQLRNP+HNGHALLMQD RR+L+E GYK+PVLLLHPLGGWTKDDDVPL  R+KQH +VL+  VLD  STI+AIFPSPM+YAGPTEVQWH + RM AG N+YIVGRDPAG+PHPETK+DLY+P HG +VLSMAPGLT +EIIPF+VAAY+K+ K MD++DP R ++F FISGT+MR LA+  E PPDGFM P AW++L DYY++L  T
Sbjct:   16 STNVVYQAHHVSRNKRGQVVGTRGGFRGCTVWLTGLSGAGKTTISFALEEYLVSHAIPCYSLDGDNVRHGLNKNLGFSAGDREENIRRIAEVARLFADAGLVCITSFISPFAKDRENARKIHESAGLPFFEIFVDAPLNICESRDVKGLYKRARAGEIKGFTGIDSDYEKPETPECVLKTNLSSVSDCVQQVVELLQEQNIVPHTTIKGIHELFVPENKVDQIRAEAETLPSLPITKLDLQWVQILSEGWATPLKGFMREKEYLQTLHFDTLLDDGVINMSIPIVLPVSADDKARLEGCSKFALMYEGRRVALLQDPEFYEHRKEERCSRVWGTATAKHPHIKMVMESGDWLVGGDLQVLERIRWDDGLDQYRLTPLELKQKCKDMNADAVFAFQLRNPVHNGHALLMQDTRRRLLERGYKHPVLLLHPLGGWTKDDDVPLEWRMKQHAAVLEERVLDPKSTIVAIFPSPMLYAGPTEVQWHCRCRMIAGANFYIVGRDPAGMPHPETKKDLYEPTHGGKVLSMAPGLTSVEIIPFRVAAYNKIKKAMDFYDPARHEEFDFISGTRMRKLAREGEDPPDGFMAPKAWKVLTDYYRSLEKT 615          
BLAST of 3'-phosphoadenosine 5'-phosphosulfate synthase vs. Ensembl Mouse
Match: Papss2 (3'-phosphoadenosine 5'-phosphosulfate synthase 2 [Source:MGI Symbol;Acc:MGI:1330223])

HSP 1 Score: 829.706 bits (2142), Expect = 0.000e+0
Identity = 375/605 (61.98%), Postives = 483/605 (79.83%), Query Frame = 3
Query: 1266 NENVFWQKKHVSRIKRGEILG-EGSFRGCTIWFTGLSGAGKTTLAFHLEHFLVAHGIPSYSLDGDNVRTGLNQNLGFTAEDREENIRRIAEVAKLFSDGGIVCLTSFISPFEKNRQQARELHSISGLPFFEVFIDTPIEICEERDVKGLYKKARAGEIKHFTGVDSAYEPPKNPDLVLKAGEKSVYECVDILVEFLRQKDILTDSIMMKYSELYVPENILDQARSEASNLPRINIKTIDCQWLQVLCEGWASPLTGFMKEREFLQCIHFNSL------NKGLYSQSIPIVLPINEEDKTAISNHPAIALCYDNRIVSIIRNPEIYKHRKEERCARTFGFVDKRHPSIKMIFESGDFLLGGDIEVLERFHWNDNLDKYRYTPKQIRQKMKEMNADTIFAFQLRNPIHNGHALLMQDARRKLIEMGYKNPVLLLHPLGGWTKDDDVPLNVRIKQHESVLDSGVLDRNSTILAIFPSPMIYAGPTEVQWHAKARMAAGVNYYIVGRDPAGIPHPETKEDLYDPFHGAEVLSMAPGLTKLEIIPFKVAAYDKLNKRMDYFDPNRKDDFIFISGTKMRNLAKNNECPPDGFMVPAAWEILRDYYQNLNNT 3059
            + NV +Q  HVSR KRG+++G  G FRGCT+W TGLSGAGKTT++F LE +LV+H IP YSLDGDNVR GLN+NLGF+A DREENIRRIAEVA+LF+D G+VC+TSFISPF K+R+ AR++H  +GLPFFE+F+D P+ ICE RDVKGLYK+ARAGEIK FTG+DS YE P+ P+ VLK    SV +CV  +VE L++++I+  + +    EL+VPEN +DQ R+EA  LP + I  +D QW+Q+L EGWA+PL GFM+E+E+LQ +HF++L        G+ + SIPIVLP++ +DK  +      AL Y+ R V+++++PE Y+HRKEERC+R +G    +HP IKM+ ESGD+L+GGD++VLER  W+D LD+YR TP +++QK K+MNAD +FAFQLRNP+HNGHALLMQD RR+L+E GYK+PVLLLHPLGGWTKDDDVPL  R+KQH +VL+  VLD  STI+AIFPSPM+YAGPTEVQWH + RM AG N+YIVGRDPAG+PHPETK+DLY+P HG +VLSMAPGLT +EIIPF+VAAY+K+ K MD++DP R ++F FISGT+MR LA+  E PPDGFM P AW++L DYY++L  T
Sbjct:   16 STNVVYQAHHVSRNKRGQVVGTRGGFRGCTVWLTGLSGAGKTTISFALEEYLVSHAIPCYSLDGDNVRHGLNKNLGFSAGDREENIRRIAEVARLFADAGLVCITSFISPFAKDRENARKIHESAGLPFFEIFVDAPLNICESRDVKGLYKRARAGEIKGFTGIDSDYEKPETPECVLKTNLSSVSDCVQQVVELLQEQNIVPHTTIKGIHELFVPENKVDQIRAEAETLPSLPITKLDLQWVQILSEGWATPLKGFMREKEYLQTLHFDTLLDGVVPRDGVINMSIPIVLPVSADDKARLEGCSKFALMYEGRRVALLQDPEFYEHRKEERCSRVWGTATAKHPHIKMVMESGDWLVGGDLQVLERIRWDDGLDQYRLTPLELKQKCKDMNADAVFAFQLRNPVHNGHALLMQDTRRRLLERGYKHPVLLLHPLGGWTKDDDVPLEWRMKQHAAVLEERVLDPKSTIVAIFPSPMLYAGPTEVQWHCRCRMIAGANFYIVGRDPAGMPHPETKKDLYEPTHGGKVLSMAPGLTSVEIIPFRVAAYNKIKKAMDFYDPARHEEFDFISGTRMRKLAREGEDPPDGFMAPKAWKVLTDYYRSLEKT 620          
BLAST of 3'-phosphoadenosine 5'-phosphosulfate synthase vs. Ensembl Mouse
Match: Papss1 (3'-phosphoadenosine 5'-phosphosulfate synthase 1 [Source:MGI Symbol;Acc:MGI:1330587])

HSP 1 Score: 815.839 bits (2106), Expect = 0.000e+0
Identity = 368/595 (61.85%), Postives = 472/595 (79.33%), Query Frame = 3
Query: 1272 NVFWQKKHVSRIKRGEILG-EGSFRGCTIWFTGLSGAGKTTLAFHLEHFLVAHGIPSYSLDGDNVRTGLNQNLGFTAEDREENIRRIAEVAKLFSDGGIVCLTSFISPFEKNRQQARELHSISGLPFFEVFIDTPIEICEERDVKGLYKKARAGEIKHFTGVDSAYEPPKNPDLVLKAGEKSVYECVDILVEFLRQKDILTDSIMMKYSELYVPENILDQARSEASNLPRINIKTIDCQWLQVLCEGWASPLTGFMKEREFLQCIHFNSL-NKGLYSQSIPIVLPINEEDKTAISNHPAIALCYDNRIVSIIRNPEIYKHRKEERCARTFGFVDKRHPSIKMIFESGDFLLGGDIEVLERFHWNDNLDKYRYTPKQIRQKMKEMNADTIFAFQLRNPIHNGHALLMQDARRKLIEMGYKNPVLLLHPLGGWTKDDDVPLNVRIKQHESVLDSGVLDRNSTILAIFPSPMIYAGPTEVQWHAKARMAAGVNYYIVGRDPAGIPHPETKEDLYDPFHGAEVLSMAPGLTKLEIIPFKVAAYDKLNKRMDYFDPNRKDDFIFISGTKMRNLAKNNECPPDGFMVPAAWEILRDYYQNL 3050
            NV +Q  HVSR KRG+++G  G FRGCT+W TGLSGAGKTT++  LE +LV HGIP Y+LDGDN+R GLN+NLGF+ EDREEN+RRIAEVAKLF+D G+VC+TSFISP+ ++R  AR++H  + LPFFEVF+D P+ +CE+RDVKGLYKKARAGEIK FTG+DS YE P+ P+LVLK     V +CV  +VE L+++DI+      +  ELYVPEN L  A+++A  LP + I  +D QW+QVL EGWA+PL GFM+ERE+LQC+HF+ L + G+ + S+PIVL    EDK  +    A AL Y+ R V+I+RNPE ++HRKEERCAR +G   K HP IKM+ E GD+L+GGD++VL+R +WND LD+YR TP +++QK K+MNAD +FAFQLRNP+HNGHALLMQD  ++L+E GY+ PVLLLHPLGGWTKDDDVPL  R+KQH +VL+ G+LD  +T++AIFPSPM+YAGPTEVQWH +ARM AG N+YIVGRDPAG+PHPET +DLY+P HGA+VL+MAPGL  LEI+PF+VAAY+K  KRMDY+D    +DF FISGT+MR LA+  + PP+GFM P AW +L +YY++L
Sbjct:    6 NVTYQAHHVSRNKRGQVVGTRGGFRGCTVWLTGLSGAGKTTVSMALEEYLVCHGIPCYTLDGDNIRQGLNKNLGFSPEDREENVRRIAEVAKLFADAGLVCITSFISPYTQDRNNARQIHEGASLPFFEVFVDAPLHVCEQRDVKGLYKKARAGEIKGFTGIDSEYEKPEAPELVLKTDSCDVNDCVQQVVELLQERDIVPVDASYEVKELYVPENKLHLAKTDAEALPALKINKVDMQWVQVLAEGWATPLNGFMREREYLQCLHFDCLLDGGVINLSVPIVLTATHEDKERLDGCTAFALVYEGRRVAILRNPEFFEHRKEERCARQWGTTCKNHPYIKMVLEQGDWLIGGDLQVLDRIYWNDGLDQYRLTPTELKQKFKDMNADAVFAFQLRNPVHNGHALLMQDTHKQLLERGYRRPVLLLHPLGGWTKDDDVPLMWRMKQHAAVLEEGILDPETTVVAIFPSPMMYAGPTEVQWHCRARMVAGANFYIVGRDPAGMPHPETGKDLYEPTHGAKVLTMAPGLITLEIVPFRVAAYNKKKKRMDYYDSEHHEDFEFISGTRMRKLAREGQKPPEGFMAPKAWTVLVEYYKSL 600          
BLAST of 3'-phosphoadenosine 5'-phosphosulfate synthase vs. Ensembl Mouse
Match: Papss1 (3'-phosphoadenosine 5'-phosphosulfate synthase 1 [Source:MGI Symbol;Acc:MGI:1330587])

HSP 1 Score: 815.839 bits (2106), Expect = 0.000e+0
Identity = 368/595 (61.85%), Postives = 472/595 (79.33%), Query Frame = 3
Query: 1272 NVFWQKKHVSRIKRGEILG-EGSFRGCTIWFTGLSGAGKTTLAFHLEHFLVAHGIPSYSLDGDNVRTGLNQNLGFTAEDREENIRRIAEVAKLFSDGGIVCLTSFISPFEKNRQQARELHSISGLPFFEVFIDTPIEICEERDVKGLYKKARAGEIKHFTGVDSAYEPPKNPDLVLKAGEKSVYECVDILVEFLRQKDILTDSIMMKYSELYVPENILDQARSEASNLPRINIKTIDCQWLQVLCEGWASPLTGFMKEREFLQCIHFNSL-NKGLYSQSIPIVLPINEEDKTAISNHPAIALCYDNRIVSIIRNPEIYKHRKEERCARTFGFVDKRHPSIKMIFESGDFLLGGDIEVLERFHWNDNLDKYRYTPKQIRQKMKEMNADTIFAFQLRNPIHNGHALLMQDARRKLIEMGYKNPVLLLHPLGGWTKDDDVPLNVRIKQHESVLDSGVLDRNSTILAIFPSPMIYAGPTEVQWHAKARMAAGVNYYIVGRDPAGIPHPETKEDLYDPFHGAEVLSMAPGLTKLEIIPFKVAAYDKLNKRMDYFDPNRKDDFIFISGTKMRNLAKNNECPPDGFMVPAAWEILRDYYQNL 3050
            NV +Q  HVSR KRG+++G  G FRGCT+W TGLSGAGKTT++  LE +LV HGIP Y+LDGDN+R GLN+NLGF+ EDREEN+RRIAEVAKLF+D G+VC+TSFISP+ ++R  AR++H  + LPFFEVF+D P+ +CE+RDVKGLYKKARAGEIK FTG+DS YE P+ P+LVLK     V +CV  +VE L+++DI+      +  ELYVPEN L  A+++A  LP + I  +D QW+QVL EGWA+PL GFM+ERE+LQC+HF+ L + G+ + S+PIVL    EDK  +    A AL Y+ R V+I+RNPE ++HRKEERCAR +G   K HP IKM+ E GD+L+GGD++VL+R +WND LD+YR TP +++QK K+MNAD +FAFQLRNP+HNGHALLMQD  ++L+E GY+ PVLLLHPLGGWTKDDDVPL  R+KQH +VL+ G+LD  +T++AIFPSPM+YAGPTEVQWH +ARM AG N+YIVGRDPAG+PHPET +DLY+P HGA+VL+MAPGL  LEI+PF+VAAY+K  KRMDY+D    +DF FISGT+MR LA+  + PP+GFM P AW +L +YY++L
Sbjct:    6 NVTYQAHHVSRNKRGQVVGTRGGFRGCTVWLTGLSGAGKTTVSMALEEYLVCHGIPCYTLDGDNIRQGLNKNLGFSPEDREENVRRIAEVAKLFADAGLVCITSFISPYTQDRNNARQIHEGASLPFFEVFVDAPLHVCEQRDVKGLYKKARAGEIKGFTGIDSEYEKPEAPELVLKTDSCDVNDCVQQVVELLQERDIVPVDASYEVKELYVPENKLHLAKTDAEALPALKINKVDMQWVQVLAEGWATPLNGFMREREYLQCLHFDCLLDGGVINLSVPIVLTATHEDKERLDGCTAFALVYEGRRVAILRNPEFFEHRKEERCARQWGTTCKNHPYIKMVLEQGDWLIGGDLQVLDRIYWNDGLDQYRLTPTELKQKFKDMNADAVFAFQLRNPVHNGHALLMQDTHKQLLERGYRRPVLLLHPLGGWTKDDDVPLMWRMKQHAAVLEEGILDPETTVVAIFPSPMMYAGPTEVQWHCRARMVAGANFYIVGRDPAGMPHPETGKDLYEPTHGAKVLTMAPGLITLEIVPFRVAAYNKKKKRMDYYDSEHHEDFEFISGTRMRKLAREGQKPPEGFMAPKAWTVLVEYYKSL 600          
BLAST of 3'-phosphoadenosine 5'-phosphosulfate synthase vs. UniProt/SwissProt
Match: sp|Q27128|PAPSS_URECA (Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase OS=Urechis caupo OX=6431 PE=2 SV=1)

HSP 1 Score: 836.639 bits (2160), Expect = 0.000e+0
Identity = 377/597 (63.15%), Postives = 481/597 (80.57%), Query Frame = 3
Query: 1263 LNENVFWQKKHVSRIKRGEILGE-GSFRGCTIWFTGLSGAGKTTLAFHLEHFLVAHGIPSYSLDGDNVRTGLNQNLGFTAEDREENIRRIAEVAKLFSDGGIVCLTSFISPFEKNRQQARELHSISGLPFFEVFIDTPIEICEERDVKGLYKKARAGEIKHFTGVDSAYEPPKNPDLVLKAGEKSVYECVDILVEFLRQKDILTDSIMMKYSELYVPENILDQARSEASNLPRINIKTIDCQWLQVLCEGWASPLTGFMKEREFLQCIHFNSL-NKGLYSQSIPIVLPINEEDKTAISNHPAIALCYDNRIVSIIRNPEIYKHRKEERCARTFGFVDKRHPSIKMIFESGDFLLGGDIEVLERFHWNDNLDKYRYTPKQIRQKMKEMNADTIFAFQLRNPIHNGHALLMQDARRKLIEMGYKNPVLLLHPLGGWTKDDDVPLNVRIKQHESVLDSGVLDRNSTILAIFPSPMIYAGPTEVQWHAKARMAAGVNYYIVGRDPAGIPHPETKEDLYDPFHGAEVLSMAPGLTKLEIIPFKVAAYDKLNKRMDYFDPNRKDDFIFISGTKMRNLAKNNECPPDGFMVPAAWEILRDYYQN 3047
            L  NV +Q +HVSR KRG++LG+ G FRGCT+WFTGLSGAGKTT++F LE +LV+ GIP+YSLDGDNVR GLN+NLGFT EDREENIRRI+EVAKLF+DGGIVCLTSFISPF+++R  AR LH  +GLPFFE F+DTP+++CE+RDVKGLYKKARAG+IK FTG+D  YE P  P++ L AG KS+ ECV  +V  L++  ++ +S +    EL+VPE+ L+ A++E  +LP + I  +D QW+QVL EGWA+PLTGFM+ERE+LQ  HF  L + G+ +QSIPIVLP++  DK  +    A AL Y+ + ++I+R PE Y+HRKEERC+R FG  +   P +KMI ESGD+L+GGD+EVLER  WND LD+YR TP ++R K + +NAD +FAFQLRNP+HNGHALLM D RR+L E GYK PVLLLHPLGGWTKDDDVPL  R+KQH+++LD  VLD + T++AIFPSPM+YAGPTEVQWHAKARM+ G N+YIVGRDPAG+PHPETK+DLY+  HGA+VL+MAPGLT+LEI+PF+VAAY+K    MD++DP R D+F+FISGTKMR +A+  E PP+GFM P+AW+I+ +YY+ 
Sbjct:    9 LATNVTFQTQHVSRAKRGQVLGQRGGFRGCTVWFTGLSGAGKTTISFALEEYLVSQGIPTYSLDGDNVRHGLNKNLGFTQEDREENIRRISEVAKLFADGGIVCLTSFISPFKRDRDLARSLHEQAGLPFFECFVDTPLDVCEQRDVKGLYKKARAGQIKGFTGIDQQYESPDAPEIQLYAGNKSIDECVQEVVSLLQKNGVVPESAVNIVKELFVPESGLEHAKAEIVDLPTMEITKLDTQWVQVLSEGWATPLTGFMREREYLQSQHFGCLLDGGVTNQSIPIVLPVHTADKDRLEGSSAFALSYEGKRIAILRTPEFYEHRKEERCSRQFGTSNAGQPYVKMIMESGDWLVGGDLEVLERITWNDGLDEYRLTPNELRAKFRALNADAVFAFQLRNPVHNGHALLMTDTRRRLTERGYKKPVLLLHPLGGWTKDDDVPLAWRMKQHQAILDEKVLDPDYTVMAIFPSPMMYAGPTEVQWHAKARMSTGANFYIVGRDPAGMPHPETKQDLYNATHGAKVLTMAPGLTQLEIVPFRVAAYNKTKSAMDFYDPERHDEFMFISGTKMRGMARAGETPPNGFMAPSAWKIMVEYYKT 605          
BLAST of 3'-phosphoadenosine 5'-phosphosulfate synthase vs. UniProt/SwissProt
Match: sp|O95340|PAPS2_HUMAN (Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 2 OS=Homo sapiens OX=9606 GN=PAPSS2 PE=1 SV=2)

HSP 1 Score: 832.787 bits (2150), Expect = 0.000e+0
Identity = 378/597 (63.32%), Postives = 483/597 (80.90%), Query Frame = 3
Query: 1266 NENVFWQKKHVSRIKRGEILG-EGSFRGCTIWFTGLSGAGKTTLAFHLEHFLVAHGIPSYSLDGDNVRTGLNQNLGFTAEDREENIRRIAEVAKLFSDGGIVCLTSFISPFEKNRQQARELHSISGLPFFEVFIDTPIEICEERDVKGLYKKARAGEIKHFTGVDSAYEPPKNPDLVLKAGEKSVYECVDILVEFLRQKDILTDSIMMKYSELYVPENILDQARSEASNLPRINIKTIDCQWLQVLCEGWASPLTGFMKEREFLQCIHFNSL-NKGLYSQSIPIVLPINEEDKTAISNHPAIALCYDNRIVSIIRNPEIYKHRKEERCARTFGFVDKRHPSIKMIFESGDFLLGGDIEVLERFHWNDNLDKYRYTPKQIRQKMKEMNADTIFAFQLRNPIHNGHALLMQDARRKLIEMGYKNPVLLLHPLGGWTKDDDVPLNVRIKQHESVLDSGVLDRNSTILAIFPSPMIYAGPTEVQWHAKARMAAGVNYYIVGRDPAGIPHPETKEDLYDPFHGAEVLSMAPGLTKLEIIPFKVAAYDKLNKRMDYFDPNRKDDFIFISGTKMRNLAKNNECPPDGFMVPAAWEILRDYYQNL 3050
            + NV +Q  HVSR KRG+++G  G FRGCT+W TGLSGAGKTT++F LE +LV+H IP YSLDGDNVR GLN+NLGF+  DREENIRRIAEVAKLF+D G+VC+TSFISPF K+R+ AR++H  +GLPFFE+F+D P+ ICE RDVKGLYK+ARAGEIK FTG+DS YE P+ P+ VLK    +V +CV  +VE L++++I+  +I+    EL+VPEN LD  R+EA  LP ++I  +D QW+QVL EGWA+PL GFM+E+E+LQ +HF++L + G+ + SIPIVLP++ EDKT +       L +  R V+I+R+ E Y+HRKEERC+R +G    +HP IKM+ ESGD+L+GGD++VLE+  WND LD+YR TP +++QK KEMNAD +FAFQLRNP+HNGHALLMQD RR+L+E GYK+PVLLLHPLGGWTKDDDVPL+ R+KQH +VL+ GVLD  STI+AIFPSPM+YAGPTEVQWH ++RM AG N+YIVGRDPAG+PHPETK+DLY+P HG +VLSMAPGLT +EIIPF+VAAY+K  K MD++DP R ++F FISGT+MR LA+  E PPDGFM P AW++L DYY++L
Sbjct:   15 STNVVYQAHHVSRNKRGQVVGTRGGFRGCTVWLTGLSGAGKTTISFALEEYLVSHAIPCYSLDGDNVRHGLNRNLGFSPGDREENIRRIAEVAKLFADAGLVCITSFISPFAKDRENARKIHESAGLPFFEIFVDAPLNICESRDVKGLYKRARAGEIKGFTGIDSDYEKPETPERVLKTNLSTVSDCVHQVVELLQEQNIVPYTIIKDIHELFVPENKLDHVRAEAETLPSLSITKLDLQWVQVLSEGWATPLKGFMREKEYLQVMHFDTLLDDGVINMSIPIVLPVSAEDKTRLEGCSKFVLAHGGRRVAILRDAEFYEHRKEERCSRVWGTTCTKHPHIKMVMESGDWLVGGDLQVLEKIRWNDGLDQYRLTPLELKQKCKEMNADAVFAFQLRNPVHNGHALLMQDTRRRLLERGYKHPVLLLHPLGGWTKDDDVPLDWRMKQHAAVLEEGVLDPKSTIVAIFPSPMLYAGPTEVQWHCRSRMIAGANFYIVGRDPAGMPHPETKKDLYEPTHGGKVLSMAPGLTSVEIIPFRVAAYNKAKKAMDFYDPARHNEFDFISGTRMRKLAREGENPPDGFMAPKAWKVLTDYYRSL 611          
BLAST of 3'-phosphoadenosine 5'-phosphosulfate synthase vs. UniProt/SwissProt
Match: sp|O88428|PAPS2_MOUSE (Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 2 OS=Mus musculus OX=10090 GN=Papss2 PE=1 SV=2)

HSP 1 Score: 829.706 bits (2142), Expect = 0.000e+0
Identity = 375/605 (61.98%), Postives = 483/605 (79.83%), Query Frame = 3
Query: 1266 NENVFWQKKHVSRIKRGEILG-EGSFRGCTIWFTGLSGAGKTTLAFHLEHFLVAHGIPSYSLDGDNVRTGLNQNLGFTAEDREENIRRIAEVAKLFSDGGIVCLTSFISPFEKNRQQARELHSISGLPFFEVFIDTPIEICEERDVKGLYKKARAGEIKHFTGVDSAYEPPKNPDLVLKAGEKSVYECVDILVEFLRQKDILTDSIMMKYSELYVPENILDQARSEASNLPRINIKTIDCQWLQVLCEGWASPLTGFMKEREFLQCIHFNSL------NKGLYSQSIPIVLPINEEDKTAISNHPAIALCYDNRIVSIIRNPEIYKHRKEERCARTFGFVDKRHPSIKMIFESGDFLLGGDIEVLERFHWNDNLDKYRYTPKQIRQKMKEMNADTIFAFQLRNPIHNGHALLMQDARRKLIEMGYKNPVLLLHPLGGWTKDDDVPLNVRIKQHESVLDSGVLDRNSTILAIFPSPMIYAGPTEVQWHAKARMAAGVNYYIVGRDPAGIPHPETKEDLYDPFHGAEVLSMAPGLTKLEIIPFKVAAYDKLNKRMDYFDPNRKDDFIFISGTKMRNLAKNNECPPDGFMVPAAWEILRDYYQNLNNT 3059
            + NV +Q  HVSR KRG+++G  G FRGCT+W TGLSGAGKTT++F LE +LV+H IP YSLDGDNVR GLN+NLGF+A DREENIRRIAEVA+LF+D G+VC+TSFISPF K+R+ AR++H  +GLPFFE+F+D P+ ICE RDVKGLYK+ARAGEIK FTG+DS YE P+ P+ VLK    SV +CV  +VE L++++I+  + +    EL+VPEN +DQ R+EA  LP + I  +D QW+Q+L EGWA+PL GFM+E+E+LQ +HF++L        G+ + SIPIVLP++ +DK  +      AL Y+ R V+++++PE Y+HRKEERC+R +G    +HP IKM+ ESGD+L+GGD++VLER  W+D LD+YR TP +++QK K+MNAD +FAFQLRNP+HNGHALLMQD RR+L+E GYK+PVLLLHPLGGWTKDDDVPL  R+KQH +VL+  VLD  STI+AIFPSPM+YAGPTEVQWH + RM AG N+YIVGRDPAG+PHPETK+DLY+P HG +VLSMAPGLT +EIIPF+VAAY+K+ K MD++DP R ++F FISGT+MR LA+  E PPDGFM P AW++L DYY++L  T
Sbjct:   16 STNVVYQAHHVSRNKRGQVVGTRGGFRGCTVWLTGLSGAGKTTISFALEEYLVSHAIPCYSLDGDNVRHGLNKNLGFSAGDREENIRRIAEVARLFADAGLVCITSFISPFAKDRENARKIHESAGLPFFEIFVDAPLNICESRDVKGLYKRARAGEIKGFTGIDSDYEKPETPECVLKTNLSSVSDCVQQVVELLQEQNIVPHTTIKGIHELFVPENKVDQIRAEAETLPSLPITKLDLQWVQILSEGWATPLKGFMREKEYLQTLHFDTLLDGVVPRDGVINMSIPIVLPVSADDKARLEGCSKFALMYEGRRVALLQDPEFYEHRKEERCSRVWGTATAKHPHIKMVMESGDWLVGGDLQVLERIRWDDGLDQYRLTPLELKQKCKDMNADAVFAFQLRNPVHNGHALLMQDTRRRLLERGYKHPVLLLHPLGGWTKDDDVPLEWRMKQHAAVLEERVLDPKSTIVAIFPSPMLYAGPTEVQWHCRCRMIAGANFYIVGRDPAGMPHPETKKDLYEPTHGGKVLSMAPGLTSVEIIPFRVAAYNKIKKAMDFYDPARHEEFDFISGTRMRKLAREGEDPPDGFMAPKAWKVLTDYYRSLEKT 620          
BLAST of 3'-phosphoadenosine 5'-phosphosulfate synthase vs. UniProt/SwissProt
Match: sp|Q60967|PAPS1_MOUSE (Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 1 OS=Mus musculus OX=10090 GN=Papss1 PE=1 SV=1)

HSP 1 Score: 815.068 bits (2104), Expect = 0.000e+0
Identity = 368/595 (61.85%), Postives = 472/595 (79.33%), Query Frame = 3
Query: 1272 NVFWQKKHVSRIKRGEILG-EGSFRGCTIWFTGLSGAGKTTLAFHLEHFLVAHGIPSYSLDGDNVRTGLNQNLGFTAEDREENIRRIAEVAKLFSDGGIVCLTSFISPFEKNRQQARELHSISGLPFFEVFIDTPIEICEERDVKGLYKKARAGEIKHFTGVDSAYEPPKNPDLVLKAGEKSVYECVDILVEFLRQKDILTDSIMMKYSELYVPENILDQARSEASNLPRINIKTIDCQWLQVLCEGWASPLTGFMKEREFLQCIHFNSL-NKGLYSQSIPIVLPINEEDKTAISNHPAIALCYDNRIVSIIRNPEIYKHRKEERCARTFGFVDKRHPSIKMIFESGDFLLGGDIEVLERFHWNDNLDKYRYTPKQIRQKMKEMNADTIFAFQLRNPIHNGHALLMQDARRKLIEMGYKNPVLLLHPLGGWTKDDDVPLNVRIKQHESVLDSGVLDRNSTILAIFPSPMIYAGPTEVQWHAKARMAAGVNYYIVGRDPAGIPHPETKEDLYDPFHGAEVLSMAPGLTKLEIIPFKVAAYDKLNKRMDYFDPNRKDDFIFISGTKMRNLAKNNECPPDGFMVPAAWEILRDYYQNL 3050
            NV +Q  HVSR KRG+++G  G FRGCT+W TGLSGAGKTT++  LE +LV HGIP Y+LDGDN+R GLN+NLGF+ EDREEN+RRIAEVAKLF+D G+VC+TSFISP+ ++R  AR++H  + LPFFEVF+D P+ +CE+RDVKGLYKKARAGEIK FTG+DS YE P+ P+LVLK     V +CV  +VE L+++DI+      +  ELYVPEN L  A+++A  LP + I  +D QW+QVL EGWA+PL GFM+ERE+LQC+HF+ L + G+ + S+PIVL    EDK  +    A AL Y+ R V+I+RNPE ++HRKEERCAR +G   K HP IKM+ E GD+L+GGD++VL+R +WND LD+YR TP +++QK K+MNAD +FAFQLRNP+HNGHALLMQD  ++L+E GY+ PVLLLHPLGGWTKDDDVPL  R+KQH +VL+ G+LD  +T++AIFPSPM+YAGPTEVQWH +ARM AG N+YIVGRDPAG+PHPET +DLY+P HGA+VL+MAPGL  LEI+PF+VAAY+K  KRMDY+D    +DF FISGT+MR LA+  + PP+GFM P AW +L +YY++L
Sbjct:   27 NVTYQAHHVSRNKRGQVVGTRGGFRGCTVWLTGLSGAGKTTVSMALEEYLVCHGIPCYTLDGDNIRQGLNKNLGFSPEDREENVRRIAEVAKLFADAGLVCITSFISPYTQDRNNARQIHEGASLPFFEVFVDAPLHVCEQRDVKGLYKKARAGEIKGFTGIDSEYEKPEAPELVLKTDSCDVNDCVQQVVELLQERDIVPVDASYEVKELYVPENKLHLAKTDAEALPALKINKVDMQWVQVLAEGWATPLNGFMREREYLQCLHFDCLLDGGVINLSVPIVLTATHEDKERLDGCTAFALVYEGRRVAILRNPEFFEHRKEERCARQWGTTCKNHPYIKMVLEQGDWLIGGDLQVLDRIYWNDGLDQYRLTPTELKQKFKDMNADAVFAFQLRNPVHNGHALLMQDTHKQLLERGYRRPVLLLHPLGGWTKDDDVPLMWRMKQHAAVLEEGILDPETTVVAIFPSPMMYAGPTEVQWHCRARMVAGANFYIVGRDPAGMPHPETGKDLYEPTHGAKVLTMAPGLITLEIVPFRVAAYNKKKKRMDYYDSEHHEDFEFISGTRMRKLAREGQKPPEGFMAPKAWTVLVEYYKSL 621          
BLAST of 3'-phosphoadenosine 5'-phosphosulfate synthase vs. UniProt/SwissProt
Match: sp|O43252|PAPS1_HUMAN (Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 1 OS=Homo sapiens OX=9606 GN=PAPSS1 PE=1 SV=2)

HSP 1 Score: 815.068 bits (2104), Expect = 0.000e+0
Identity = 368/595 (61.85%), Postives = 472/595 (79.33%), Query Frame = 3
Query: 1272 NVFWQKKHVSRIKRGEILG-EGSFRGCTIWFTGLSGAGKTTLAFHLEHFLVAHGIPSYSLDGDNVRTGLNQNLGFTAEDREENIRRIAEVAKLFSDGGIVCLTSFISPFEKNRQQARELHSISGLPFFEVFIDTPIEICEERDVKGLYKKARAGEIKHFTGVDSAYEPPKNPDLVLKAGEKSVYECVDILVEFLRQKDILTDSIMMKYSELYVPENILDQARSEASNLPRINIKTIDCQWLQVLCEGWASPLTGFMKEREFLQCIHFNSL-NKGLYSQSIPIVLPINEEDKTAISNHPAIALCYDNRIVSIIRNPEIYKHRKEERCARTFGFVDKRHPSIKMIFESGDFLLGGDIEVLERFHWNDNLDKYRYTPKQIRQKMKEMNADTIFAFQLRNPIHNGHALLMQDARRKLIEMGYKNPVLLLHPLGGWTKDDDVPLNVRIKQHESVLDSGVLDRNSTILAIFPSPMIYAGPTEVQWHAKARMAAGVNYYIVGRDPAGIPHPETKEDLYDPFHGAEVLSMAPGLTKLEIIPFKVAAYDKLNKRMDYFDPNRKDDFIFISGTKMRNLAKNNECPPDGFMVPAAWEILRDYYQNL 3050
            NV +Q  HVSR KRG+++G  G FRGCT+W TGLSGAGKTT++  LE +LV HGIP Y+LDGDN+R GLN+NLGF+ EDREEN+RRIAEVAKLF+D G+VC+TSFISP+ ++R  AR++H  + LPFFEVF+D P+ +CE+RDVKGLYKKARAGEIK FTG+DS YE P+ P+LVLK     V +CV  +VE L+++DI+      +  ELYVPEN L  A+++A  LP + I  +D QW+QVL EGWA+PL GFM+ERE+LQC+HF+ L + G+ + S+PIVL    EDK  +    A AL Y+ R V+I+RNPE ++HRKEERCAR +G   K HP IKM+ E GD+L+GGD++VL+R +WND LD+YR TP +++QK K+MNAD +FAFQLRNP+HNGHALLMQD  ++L+E GY+ PVLLLHPLGGWTKDDDVPL  R+KQH +VL+ GVL+  +T++AIFPSPM+YAGPTEVQWH +ARM AG N+YIVGRDPAG+PHPET +DLY+P HGA+VL+MAPGL  LEI+PF+VAAY+K  KRMDY+D    +DF FISGT+MR LA+  + PP+GFM P AW +L +YY++L
Sbjct:   27 NVTYQAHHVSRNKRGQVVGTRGGFRGCTVWLTGLSGAGKTTVSMALEEYLVCHGIPCYTLDGDNIRQGLNKNLGFSPEDREENVRRIAEVAKLFADAGLVCITSFISPYTQDRNNARQIHEGASLPFFEVFVDAPLHVCEQRDVKGLYKKARAGEIKGFTGIDSEYEKPEAPELVLKTDSCDVNDCVQQVVELLQERDIVPVDASYEVKELYVPENKLHLAKTDAETLPALKINKVDMQWVQVLAEGWATPLNGFMREREYLQCLHFDCLLDGGVINLSVPIVLTATHEDKERLDGCTAFALMYEGRRVAILRNPEFFEHRKEERCARQWGTTCKNHPYIKMVMEQGDWLIGGDLQVLDRVYWNDGLDQYRLTPTELKQKFKDMNADAVFAFQLRNPVHNGHALLMQDTHKQLLERGYRRPVLLLHPLGGWTKDDDVPLMWRMKQHAAVLEEGVLNPETTVVAIFPSPMMYAGPTEVQWHCRARMVAGANFYIVGRDPAGMPHPETGKDLYEPSHGAKVLTMAPGLITLEIVPFRVAAYNKKKKRMDYYDSEHHEDFEFISGTRMRKLAREGQKPPEGFMAPKAWTVLTEYYKSL 621          
BLAST of 3'-phosphoadenosine 5'-phosphosulfate synthase vs. TrEMBL
Match: A0A423U0M4 (Putative bifunctional 3 OS=Penaeus vannamei OX=6689 GN=C7M84_024579 PE=3 SV=1)

HSP 1 Score: 851.277 bits (2198), Expect = 0.000e+0
Identity = 394/598 (65.89%), Postives = 483/598 (80.77%), Query Frame = 3
Query: 1272 NVFWQKKHVSRIKRGEILGE-GSFRGCTIWFTGLSGAGKTTLAFHLEHFLVAHGIPSYSLDGDNVRTGLNQNLGFTAEDREENIRRIAEVAKLFSDGGIVCLTSFISPFEKNRQQARELHSISGLPFFEVFIDTPIEICEERDVKGLYKKARAGEIKHFTGVDSAYEPPKNPDLVLKAGEKSVYECVDILVEFLRQKDILTDSIMMKYSELYVPENILDQARSEASNLPRINIKTIDCQWLQVLCEGWASPLTGFMKEREFLQCIHFNSL-NKGLYSQSIPIVLPINEEDKTAISNHPAIALCYDNRIVSIIRNPEIYKHRKEERCARTFGFVDKRHPSIKMIFESGDFLLGGDIEVLERFHWNDNLDKYRYTPKQIRQKMKEMNADTIFAFQLRNPIHNGHALLMQDARRKLIEMGYKNPVLLLHPLGGWTKDDDVPLNVRIKQHESVLDSGVLDRNSTILAIFPSPMIYAGPTEVQWHAKARMAAGVNYYIVGRDPAGIPHPETKEDLYDPFHGAEVLSMAPGLTKLEIIPFKVAAYDKLNKRMDYFDPNRKDDFIFISGTKMRNLAKNNECPPDGFMVPAAWEILRDYYQNLNNT 3059
            NV +Q  HV+R KRG+ILG+ G FRGCT+WFTGLSGAGKTT++F LE +LV+ GIP+Y LDGDN+R GLN+NLGF+ EDREENIRR+AEVAKLF+D G+V L SF+SPF K+R+QAR++H  SGL FFEVF+DTP+E+CE+RDVKGLYKKARAG IK FTG+DS YE P+ P++VLK  + +V ECV  ++E L++  I+ +++     EL+VPEN L  AR+EA +LP +NI  +D QW+QVL EGWASPL GFM+E+EFLQC HF  L + G+ +QSIPIVLPI+  DK  +    A  L YD R V+IIR PE Y+HRKEERCAR FG   K HP IKMI ESGD+L GGDIEVLER  WND LD+YR TP ++R K ++M AD +FAFQLRNP+HNGHALLMQD RR+L+E GY NPVLLLHPLGGWTKDDDVPL  R++QH +VL+ GVLD  ST+LAIFPSPM+YAGPTEVQWHAKARM+ G N+YIVGRDPAG+PHPETK+D+Y+  HG +VL+MAPGLT+LEIIPF+VAAYDK+  RM +FDP RK++F FISGTKMR LA+  E PPDGFM P+AW+IL  YYQ+L+  
Sbjct:   53 NVTYQNNHVTRNKRGQILGQRGGFRGCTVWFTGLSGAGKTTVSFALEEYLVSRGIPAYCLDGDNMRHGLNKNLGFSDEDREENIRRVAEVAKLFADSGVVALCSFVSPFTKDREQARKIHEDSGLRFFEVFVDTPLEVCEQRDVKGLYKKARAGIIKGFTGIDSQYEKPEAPNVVLKTAQCTVDECVQQVLEILQEWSIIPEAVRDNLKELFVPENKLTAARAEAESLPSVNITKLDLQWVQVLSEGWASPLDGFMREKEFLQCQHFGCLLDYGITNQSIPIVLPIHTSDKEQLDGCSAFTLRYDGRAVAIIRKPEFYEHRKEERCARQFGTTCKDHPYIKMILESGDWLCGGDIEVLERIKWNDGLDEYRLTPMELRAKFRQMGADAVFAFQLRNPVHNGHALLMQDTRRQLLERGYHNPVLLLHPLGGWTKDDDVPLKTRMEQHHAVLNEGVLDPASTVLAIFPSPMMYAGPTEVQWHAKARMSTGANFYIVGRDPAGMPHPETKKDIYEATHGRKVLTMAPGLTQLEIIPFRVAAYDKMASRMAFFDPARKEEFEFISGTKMRTLARTGENPPDGFMAPSAWKILSTYYQSLSKA 650          
BLAST of 3'-phosphoadenosine 5'-phosphosulfate synthase vs. TrEMBL
Match: T1FXP6 (Uncharacterized protein OS=Helobdella robusta OX=6412 GN=20213594 PE=3 SV=1)

HSP 1 Score: 851.277 bits (2198), Expect = 0.000e+0
Identity = 397/595 (66.72%), Postives = 483/595 (81.18%), Query Frame = 3
Query: 1272 NVFWQKKHVSRIKRGEILG-EGSFRGCTIWFTGLSGAGKTTLAFHLEHFLVAHGIPSYSLDGDNVRTGLNQNLGFTAEDREENIRRIAEVAKLFSDGGIVCLTSFISPFEKNRQQARELHSISGLPFFEVFIDTPIEICEERDVKGLYKKARAGEIKHFTGVDSAYEPPKNPDLVLKAGEKSVYECVDILVEFLRQKDILTDSIMMKYSELYVPENILDQARSEASNLPRINIKTIDCQWLQVLCEGWASPLTGFMKEREFLQCIHFNSL-NKGLYSQSIPIVLPINEEDKTAISNHPAIALCYDNRIVSIIRNPEIYKHRKEERCARTFGFVDKRHPSIKMIFESGDFLLGGDIEVLERFHWNDNLDKYRYTPKQIRQKMKEMNADTIFAFQLRNPIHNGHALLMQDARRKLIEMGYKNPVLLLHPLGGWTKDDDVPLNVRIKQHESVLDSGVLDRNSTILAIFPSPMIYAGPTEVQWHAKARMAAGVNYYIVGRDPAGIPHPETKEDLYDPFHGAEVLSMAPGLTKLEIIPFKVAAYDKLNKRMDYFDPNRKDDFIFISGTKMRNLAKNNECPPDGFMVPAAWEILRDYYQNL 3050
            NV +Q   VSR KRG++LG +G FRGCTIWFTGLSGAGKTT+AF LE +LV+ GIPSYSLDGDN+R GLN+NLGF+ EDR ENIRRI+EVAKLF+DGGIVCLTSFISPF+K+R+ AR+LH  +GLPFFE F+DTP+EICE+RDVKGLYKKARAG+IK FTG+D  YE P  P++ LKAGE +V ECV  +VE L  K +L  S+M    EL++PE  +  AR EA +L  ++I T+D QW+QVL EGWASPLTGFM+E+EFLQ  HF  L   G  +QS+PIVLP++ +DK  + +  AI+L Y+ +IV+I+R PE Y HRKEERCAR FG   K HP I+MI ESGD+L GGD+EV+ER  WND LD YR TP ++R + K+MNAD +FAFQLRNP+HNGHALLM D + KL   GYKNPVLLLHPLGGWTKDDDVPL  RIKQH+++LD GVLD  ST++AIFPSPM+YAGPTEVQWH KARMA G N+YIVGRDPAG+PHP+TKEDLYDP HGA+VL+MAPGLT+LEI+PFKVAAY+   K MD+FDP++KDDF+FISGTKMR LA+  + PP+GFM P AW+I+ DYYQ++
Sbjct:    4 NVTYQANQVSRAKRGQVLGTKGGFRGCTIWFTGLSGAGKTTIAFALEEYLVSQGIPSYSLDGDNIRHGLNKNLGFSQEDRMENIRRISEVAKLFADGGIVCLTSFISPFKKDREMARKLHEEAGLPFFECFVDTPLEICEKRDVKGLYKKARAGQIKGFTGIDQQYENPPTPEISLKAGELTVDECVQQMVEMLYTKGLLPVSVMSTVKELFLPEAAVLTARMEARDLQCLDINTLDFQWVQVLSEGWASPLTGFMREKEFLQSQHFGCLLEGGTINQSVPIVLPVSTKDKERLEDCTAISLKYEGKIVAILRTPEFYPHRKEERCARQFGTTHKGHPYIQMINESGDWLCGGDLEVMERIRWNDGLDDYRLTPAELRAQFKKMNADAVFAFQLRNPVHNGHALLMHDTKNKLKAKGYKNPVLLLHPLGGWTKDDDVPLPWRIKQHQALLDEGVLDPKSTVMAIFPSPMMYAGPTEVQWHCKARMATGSNFYIVGRDPAGMPHPDTKEDLYDPTHGAKVLTMAPGLTQLEIVPFKVAAYNLKKKAMDFFDPSKKDDFLFISGTKMRALARAGDTPPEGFMPPKAWKIMVDYYQSI 598          
BLAST of 3'-phosphoadenosine 5'-phosphosulfate synthase vs. TrEMBL
Match: A0A2I2UIU6 (3'-phosphoadenosine 5'-phosphosulfate synthase 2 OS=Felis catus OX=9685 GN=PAPSS2 PE=3 SV=3)

HSP 1 Score: 850.121 bits (2195), Expect = 0.000e+0
Identity = 388/601 (64.56%), Postives = 488/601 (81.20%), Query Frame = 3
Query: 1254 SKILNENVFWQKKHVSRIKRGEILG-EGSFRGCTIWFTGLSGAGKTTLAFHLEHFLVAHGIPSYSLDGDNVRTGLNQNLGFTAEDREENIRRIAEVAKLFSDGGIVCLTSFISPFEKNRQQARELHSISGLPFFEVFIDTPIEICEERDVKGLYKKARAGEIKHFTGVDSAYEPPKNPDLVLKAGEKSVYECVDILVEFLRQKDILTDSIMMKYSELYVPENILDQARSEASNLPRINIKTIDCQWLQVLCEGWASPLTGFMKEREFLQCIHFNSL-NKGLYSQSIPIVLPINEEDKTAISNHPAIALCYDNRIVSIIRNPEIYKHRKEERCARTFGFVDKRHPSIKMIFESGDFLLGGDIEVLERFHWNDNLDKYRYTPKQIRQKMKEMNADTIFAFQLRNPIHNGHALLMQDARRKLIEMGYKNPVLLLHPLGGWTKDDDVPLNVRIKQHESVLDSGVLDRNSTILAIFPSPMIYAGPTEVQWHAKARMAAGVNYYIVGRDPAGIPHPETKEDLYDPFHGAEVLSMAPGLTKLEIIPFKVAAYDKLNKRMDYFDPNRKDDFIFISGTKMRNLAKNNECPPDGFMVPAAWEILRDYYQNL 3050
            S+  + NV +Q  HVSR KRG+++G  G FRGCT+W TGLSGAGKTT++F LE +LV+HGIP YSLDGDNVR GLN+NLGF+  DREENIRRIAEVAKLF+D G+VC+TSFISPF K+R+ AR++H  +GLPFFE+F+D P+ ICE RDVKGLYK+ARAGEIK FTG+DS YE P+ P+LVLK     V +CV  +VE L++++I+  +IM    EL+VPEN LDQ R+EA  LP + I  +D QW+QVL EGWA+PL GFM+E+E+LQ IHF++L + G+ S SIPIVLP++ +DKT +       L YD R V+I+R+PE Y+HRKEERC+R +G    +HP IKM+ ESGD+L+GGD++VLER  WND LD+YR TP +++QK KEMNAD +FAFQLRNP+HNGHALLMQD RR+L+E GYK+PVLLLHPLGGWTKDDDVPL+ R+KQH +VL+ GVLD  STI+AIFPSPM+YAGPTEVQWH ++RM AG N+YIVGRDPAG+PHPETK+DLY+P HG +VLSMAPGLT +EIIPF+VAAY+K  K MD++DP R ++F FISGT+MR LA+  E PPDGFM P AW++L DYY++L
Sbjct:   10 SQQKSTNVVYQAHHVSRNKRGQVVGTRGGFRGCTVWLTGLSGAGKTTISFALEEYLVSHGIPCYSLDGDNVRHGLNKNLGFSPGDREENIRRIAEVAKLFADAGLVCITSFISPFTKDRENARKIHESAGLPFFEIFVDAPLNICESRDVKGLYKRARAGEIKGFTGIDSDYEKPETPELVLKTNLSPVSDCVQQVVELLQEQNIVPHTIMKGIHELFVPENKLDQVRAEAEALPSLAITKLDLQWVQVLSEGWATPLKGFMREKEYLQAIHFDTLLDDGVISMSIPIVLPVSADDKTRLEGRSEFVLTYDGRRVAILRDPEFYEHRKEERCSRVWGTACAKHPHIKMVMESGDWLVGGDLQVLERIRWNDGLDQYRLTPLELKQKCKEMNADAVFAFQLRNPVHNGHALLMQDTRRRLLERGYKHPVLLLHPLGGWTKDDDVPLDWRMKQHAAVLEEGVLDPKSTIVAIFPSPMLYAGPTEVQWHCRSRMIAGANFYIVGRDPAGMPHPETKKDLYEPTHGGKVLSMAPGLTSVEIIPFRVAAYNKAKKAMDFYDPARHNEFDFISGTRMRKLAREGENPPDGFMAPKAWKVLTDYYRSL 610          
BLAST of 3'-phosphoadenosine 5'-phosphosulfate synthase vs. TrEMBL
Match: A0A2I0U9E7 (Uncharacterized protein OS=Limosa lapponica baueri OX=1758121 GN=llap_6986 PE=3 SV=1)

HSP 1 Score: 848.966 bits (2192), Expect = 0.000e+0
Identity = 394/605 (65.12%), Postives = 483/605 (79.83%), Query Frame = 3
Query: 1248 MTSKILNE--NVFWQKKHVSRIKRGEILG-EGSFRGCTIWFTGLSGAGKTTLAFHLEHFLVAHGIPSYSLDGDNVRTGLNQNLGFTAEDREENIRRIAEVAKLFSDGGIVCLTSFISPFEKNRQQARELHSISGLPFFEVFIDTPIEICEERDVKGLYKKARAGEIKHFTGVDSAYEPPKNPDLVLKAGEKSVYECVDILVEFLRQKDILTDSIMMKYSELYVPENILDQARSEASNLPRINIKTIDCQWLQVLCEGWASPLTGFMKEREFLQCIHFNSL-NKGLYSQSIPIVLPINEEDKTAISNHPAIALCYDNRIVSIIRNPEIYKHRKEERCARTFGFVDKRHPSIKMIFESGDFLLGGDIEVLERFHWNDNLDKYRYTPKQIRQKMKEMNADTIFAFQLRNPIHNGHALLMQDARRKLIEMGYKNPVLLLHPLGGWTKDDDVPLNVRIKQHESVLDSGVLDRNSTILAIFPSPMIYAGPTEVQWHAKARMAAGVNYYIVGRDPAGIPHPETKEDLYDPFHGAEVLSMAPGLTKLEIIPFKVAAYDKLNKRMDYFDPNRKDDFIFISGTKMRNLAKNNECPPDGFMVPAAWEILRDYYQNL 3050
            M+S+   E  NV +Q  HVSR KRG+++G  G FRGCT+W TGLSGAGKTT+ F LE +LV+HGIP YSLDGDNVR GLN+NLGF+A DREENIRRIAEVAKLF+D G+VC+TSFISPF K+RQ AR++H  +GLPFFE+F+D P+ ICE RDVKGLYKKARAGEIK FTG+DS YE P++P+LVLK    SV EC+  +VE L+ ++I+  S +    EL+VPEN     R+EA  LP + I  +D QW+QVL EGWASPLTGFM+E E+LQ IHF +L N G+ + SIPIVLPI+ EDK  +    A+AL Y  R V+I+++PE ++HRKEERCAR +G    +HP +KM+ ESGD+L+GGD+ VLE+  WND LD+YR TP  ++QK +EMNAD IFAFQLRNP+HNGHALLMQD RR+L+E GYKNPVLLLHPLGGWTKDDDVPL  R+KQH +VL+  VLD  STI+AIFPSPM+YAGPTEVQWH +ARM AG N+YIVGRDPAG+PHPETK+DLY+P  G +VLSMAPGLT +EIIPF+VAAY+KL K MD++DP R DDF FISGT+MR LA+  E PPDGFM P AW++L +YYQ+L
Sbjct:    1 MSSRQQTESTNVVYQAHHVSRSKRGQVVGTRGGFRGCTVWLTGLSGAGKTTIGFALEEYLVSHGIPCYSLDGDNVRHGLNKNLGFSAGDREENIRRIAEVAKLFADAGLVCITSFISPFAKDRQNARKIHEAAGLPFFEIFVDAPLNICESRDVKGLYKKARAGEIKGFTGIDSEYEKPESPELVLKTNVASVSECIQQVVELLQTQNIVPHSSIKDILELFVPENKFQSVRAEAEMLPSVEITKLDLQWVQVLSEGWASPLTGFMREAEYLQAIHFGTLLNDGVVNLSIPIVLPISAEDKERLEGCEALALSYAGRRVAILKDPEFFEHRKEERCARVWGTTCAKHPHVKMVMESGDWLVGGDLLVLEKIKWNDGLDQYRLTPLALKQKFREMNADAIFAFQLRNPVHNGHALLMQDTRRQLLERGYKNPVLLLHPLGGWTKDDDVPLEWRMKQHAAVLEEQVLDPKSTIVAIFPSPMLYAGPTEVQWHCRARMIAGANFYIVGRDPAGMPHPETKKDLYEPTQGGKVLSMAPGLTSVEIIPFRVAAYNKLKKAMDFYDPKRHDDFDFISGTRMRKLAREGENPPDGFMAPKAWKVLTEYYQSL 605          
BLAST of 3'-phosphoadenosine 5'-phosphosulfate synthase vs. TrEMBL
Match: A0A091PU62 (Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 2 (Fragment) OS=Leptosomus discolor OX=188344 GN=N330_14524 PE=3 SV=1)

HSP 1 Score: 848.966 bits (2192), Expect = 0.000e+0
Identity = 388/595 (65.21%), Postives = 480/595 (80.67%), Query Frame = 3
Query: 1272 NVFWQKKHVSRIKRGEILG-EGSFRGCTIWFTGLSGAGKTTLAFHLEHFLVAHGIPSYSLDGDNVRTGLNQNLGFTAEDREENIRRIAEVAKLFSDGGIVCLTSFISPFEKNRQQARELHSISGLPFFEVFIDTPIEICEERDVKGLYKKARAGEIKHFTGVDSAYEPPKNPDLVLKAGEKSVYECVDILVEFLRQKDILTDSIMMKYSELYVPENILDQARSEASNLPRINIKTIDCQWLQVLCEGWASPLTGFMKEREFLQCIHFNSL-NKGLYSQSIPIVLPINEEDKTAISNHPAIALCYDNRIVSIIRNPEIYKHRKEERCARTFGFVDKRHPSIKMIFESGDFLLGGDIEVLERFHWNDNLDKYRYTPKQIRQKMKEMNADTIFAFQLRNPIHNGHALLMQDARRKLIEMGYKNPVLLLHPLGGWTKDDDVPLNVRIKQHESVLDSGVLDRNSTILAIFPSPMIYAGPTEVQWHAKARMAAGVNYYIVGRDPAGIPHPETKEDLYDPFHGAEVLSMAPGLTKLEIIPFKVAAYDKLNKRMDYFDPNRKDDFIFISGTKMRNLAKNNECPPDGFMVPAAWEILRDYYQNL 3050
            NV +Q  HVSR KRG+++G  G FRGCT+W TGLSGAGKTT+ F LE +LV+HGIP YSLDGDNVR GLN+NLGF+A DREENIRRIAEVA+LF+D G+VC+TSFISPF K+RQ AR++H  +GLPFFE+F+D P+ ICE RDVKGLYKKARAGEIK FTG+DS YE P++P+LVLK    SV EC+  LVE L+ ++I+   ++    EL+VPEN L+  R+EA  LP + I  +D QW+QVL EGWA+PLTGFM+E E+LQ IHF +L N G+ + SIPIVLPI+ EDK  +    A+AL Y  R V++++NPE ++HRKEERCAR +G    +HP +KM+ ESGD+L+GGD+ VLE+  WND LD+YR TP  ++QK +EMNAD +FAFQLRNP+HNGHALLMQD RR+L+E GYKNPVLLLHPLGGWTKDDDVPL  R+KQH +VL+  VLD  STI+AIFPSPM+YAGPTEVQWH +ARM AG N+YIVGRDPAG+PHPETK+DLY+P  G +VLSMAPGLT +EIIPF+VAAY+KL + MD++DP R DDF FISGT+MR LA+  E PPDGFM P AW++L +YYQ+L
Sbjct:    3 NVVYQAHHVSRSKRGQVVGTRGGFRGCTVWLTGLSGAGKTTIGFALEEYLVSHGIPCYSLDGDNVRHGLNKNLGFSAGDREENIRRIAEVARLFADAGLVCITSFISPFAKDRQNARKIHEAAGLPFFEIFVDAPLNICESRDVKGLYKKARAGEIKGFTGIDSEYEKPESPELVLKTNVASVSECIQQLVELLQTQNIVPQGLIKDVLELFVPENKLNSVRAEAEMLPSVEITKLDLQWVQVLSEGWATPLTGFMREAEYLQVIHFGTLLNDGVVNLSIPIVLPISTEDKERLEGCEALALSYAGRRVAVLKNPEYFEHRKEERCARVWGTTCTKHPHVKMVVESGDWLVGGDLLVLEKIKWNDGLDQYRLTPLNLKQKFREMNADAVFAFQLRNPVHNGHALLMQDTRRQLLERGYKNPVLLLHPLGGWTKDDDVPLEWRMKQHSAVLEEQVLDPKSTIVAIFPSPMLYAGPTEVQWHCRARMIAGANFYIVGRDPAGMPHPETKKDLYEPTQGGKVLSMAPGLTSVEIIPFRVAAYNKLKRAMDFYDPKRHDDFDFISGTRMRKLAREGENPPDGFMAPKAWKVLTEYYQSL 597          
BLAST of 3'-phosphoadenosine 5'-phosphosulfate synthase vs. Ensembl Cavefish
Match: papss2b (3'-phosphoadenosine 5'-phosphosulfate synthase 2 [Source:NCBI gene;Acc:103024547])

HSP 1 Score: 835.099 bits (2156), Expect = 0.000e+0
Identity = 381/597 (63.82%), Postives = 478/597 (80.07%), Query Frame = 3
Query: 1272 NVFWQKKHVSRIKRGEILG-EGSFRGCTIWFTGLSGAGKTTLAFHLEHFLVAHGIPSYSLDGDNVRTGLNQNLGFTAEDREENIRRIAEVAKLFSDGGIVCLTSFISPFEKNRQQARELHSISGLPFFEVFIDTPIEICEERDVKGLYKKARAGEIKHFTGVDSAYEPPKNPDLVLKAGEKSVYECVDILVEFLRQKDILTDSIMMKYSELYVPENILDQARSEASNLPRINIKTIDCQWLQVLCEGWASPLTGFMKEREFLQCIHFNSL-NKGLYSQSIPIVLPINEEDKTAISNHPAIALCYDNRIVSIIRNPEIYKHRKEERCARTFGFVDKRHPSIKMIFESGDFLLGGDIEVLERFHWNDNLDKYRYTPKQIRQKMKEMNADTIFAFQLRNPIHNGHALLMQDARRKLIEMGYKNPVLLLHPLGGWTKDDDVPLNVRIKQHESVLDSGVLDRNSTILAIFPSPMIYAGPTEVQWHAKARMAAGVNYYIVGRDPAGIPHPETKEDLYDPFHGAEVLSMAPGLTKLEIIPFKVAAYDKLNKRMDYFDPNRKDDFIFISGTKMRNLAKNNECPPDGFMVPAAWEILRDYYQNLNN 3056
            N+ +Q  HVSR KRG+++G  G FRGCT+W TGLSGAGKTT+ F LE +LV+H IP YSLDGDN+R GLN+NLGFT+ DREENIRRIAEVAKLF+D G+VC+TSFISPF K+R +AR++H  SGLPFFEVF++ P+E+CE RDVKGLYKKARAGEIK FTG+DS YE P  P+L+LK GE SV EC+  +VE L+ + I+   +    +EL+VPEN LD   S+A  LP + I  +D QW+QVL EGWA+PL GFM+EREFLQ +HF +L + G  + S+PIVLP+++EDK  +    A AL Y  R V+I+R+PE Y+HRKEERCAR +G    +HP IKM+ E GD+L GGD+EV ER  W+D LD+YR TPK++RQK KEM AD IFAFQLRNP+HNGHALLMQD +R+L+E GYKNPVLLLHPLGGWTK+DDVPL+ R++QH +VL+ GVLD  +TI+AIFPSPM+YAGPTEVQWH +ARM +G N+YIVGRDPAG+PHPETK+DLY+P HG +VL+MAPGLT +EIIPF+VAAY+K+ K MD++D  R D+F FISGTKMR LA++ + PPDGFM P AW++L +YY +L  
Sbjct:   16 NIVYQAHHVSRSKRGQVVGTRGGFRGCTVWLTGLSGAGKTTVGFALEEYLVSHAIPCYSLDGDNIRHGLNKNLGFTSSDREENIRRIAEVAKLFADAGLVCITSFISPFGKDRNEARKIHESSGLPFFEVFVNAPLEVCESRDVKGLYKKARAGEIKGFTGIDSDYEKPDAPELILKTGELSVNECIQQVVELLKDQGIVPSGVTEDVNELFVPENKLDLVLSDAKILPAVAITKLDLQWVQVLAEGWATPLKGFMREREFLQVLHFGTLLDGGTINLSVPIVLPVSKEDKERLDGCAAFALEYKGRRVAILRSPEFYEHRKEERCARQWGTTCPQHPYIKMVQEGGDWLAGGDLEVFERIKWDDGLDQYRLTPKELRQKFKEMGADAIFAFQLRNPVHNGHALLMQDTKRRLLERGYKNPVLLLHPLGGWTKEDDVPLDWRMRQHAAVLEEGVLDPATTIVAIFPSPMMYAGPTEVQWHCRARMISGANFYIVGRDPAGMPHPETKQDLYEPTHGGKVLTMAPGLTSVEIIPFRVAAYNKVKKAMDFYDKERNDEFEFISGTKMRKLARSGKNPPDGFMAPKAWKVLTEYYSSLQK 612          
BLAST of 3'-phosphoadenosine 5'-phosphosulfate synthase vs. Ensembl Cavefish
Match: papss2a (bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 2-like [Source:NCBI gene;Acc:103047466])

HSP 1 Score: 816.609 bits (2108), Expect = 0.000e+0
Identity = 383/598 (64.05%), Postives = 479/598 (80.10%), Query Frame = 3
Query: 1266 NENVFWQKKHVSRIKRGEILG-EGSFRGCTIWFTGLSGAGKTTLAFHLEHFLVAHGIPSYSLDGDNVRTGLNQNLGFTAEDREENIRRIAEVAKLFSDGGIVCLTSFISPFEKNRQQARELHSISGLPFFEVFIDTPIEICEERDVKGLYKKARAGEIKHFTGVDSAYEPPKNPDLVLKAGEKSVYECVDILVEFLRQKDILTDSIMMKYSELYVPENILDQARSEASNLPRINIKTIDCQWLQVLCEGWASPLTGFMKEREFLQCIHFNSLNKG-LYSQSIPIVLPINEEDKTAISNHPAIALCYDNRIVSIIRNPEIYKHRKEERCARTFGFVDKRHPSIKMIFESGDFLLGGDIEVLERFHWNDNLDKYRYTPKQIRQKMKEMNADTIFAFQLRNPIHNGHALLMQDARRKLIEMGYKNPVLLLHPLGGWTKDDDVPLNVRIKQHESVLDSGVLDRNSTILAIFPSPMIYAGPTEVQWHAKARMAAGVNYYIVGRDPAGIPHPETKEDLYDPFHGAEVLSMAPGLTKLEIIPFKVAAYDKLNKRMDYFDPNRKDDFIFISGTKMRNLAKNNECPPDGFMVPAAWEILRDYYQNLN 3053
            + NV +Q  HVSR KRG+++G    FRGCT+W TGLSGAGKTTL F LE  LV+HGIP YSLDGDN+R GLN+NLGF++ DREENIRRIAEVAKLF+D G+VC+TSFISPF K+R +AR +H  SGLPFFEVF++ P+E+CE+RDVKGLYKKARAGEIK FTG+DS YE P +P+L L+ GE SV EC+  +V FL+++ I+ + +  K +EL+VP N L    S+   LP I I T+D QW+QVL EGWASPLTGFM+ERE+LQ +HFN+L  G   + S+PIVLP+  E K  ++   A+AL Y  R V+++RNPE Y+H KEERCAR +G    +HP IKM+ ESGD+L+GGD+EVLER  WND LD+YR TP +++QK KEM AD +FAFQLRNP+HNGHALLM D RRKL E GY+ PVLLLHPLGGWTKDDDVPL+ R+KQH +VL+ GVLD +STI+AIFPSPM+YAGPTEVQWH +ARM AGVN+YIVGRDPAG+PHPE+ +DLYDP HGA+VLSMAPGL+ +EIIPF+VAAY+K  + MD++D  R  +F FISGTKMR+LA++ + PPDGFM P AW+IL +YY+++ 
Sbjct:   14 STNVVYQDHHVSRSKRGQVVGTRDGFRGCTVWLTGLSGAGKTTLGFALEEHLVSHGIPCYSLDGDNIRHGLNKNLGFSSTDREENIRRIAEVAKLFADAGLVCITSFISPFTKDRNEARVVHESSGLPFFEVFVNAPLEVCEQRDVKGLYKKARAGEIKGFTGIDSTYESPPSPELELRTGELSVNECILKVVNFLKEQGIIPNGVSEKITELFVPMNKLKLVESDIKTLPTITITTLDLQWVQVLAEGWASPLTGFMREREYLQVLHFNNLLDGPAINLSVPIVLPVTTETKERLAGSVAVALEYQGRRVAVLRNPEFYQHCKEERCARQWGTSCTKHPYIKMVMESGDWLVGGDLEVLERIKWNDGLDQYRLTPSELKQKFKEMKADAVFAFQLRNPVHNGHALLMTDTRRKLEERGYRRPVLLLHPLGGWTKDDDVPLDWRMKQHAAVLEEGVLDPSSTIIAIFPSPMMYAGPTEVQWHCRARMMAGVNFYIVGRDPAGMPHPESGKDLYDPSHGAKVLSMAPGLSSVEIIPFRVAAYNKSKRAMDFYDKERHAEFEFISGTKMRSLARSGQNPPDGFMAPKAWKILTEYYKSIQ 611          
BLAST of 3'-phosphoadenosine 5'-phosphosulfate synthase vs. Ensembl Cavefish
Match: papss2a (bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 2-like [Source:NCBI gene;Acc:103047466])

HSP 1 Score: 816.609 bits (2108), Expect = 0.000e+0
Identity = 383/598 (64.05%), Postives = 479/598 (80.10%), Query Frame = 3
Query: 1266 NENVFWQKKHVSRIKRGEILG-EGSFRGCTIWFTGLSGAGKTTLAFHLEHFLVAHGIPSYSLDGDNVRTGLNQNLGFTAEDREENIRRIAEVAKLFSDGGIVCLTSFISPFEKNRQQARELHSISGLPFFEVFIDTPIEICEERDVKGLYKKARAGEIKHFTGVDSAYEPPKNPDLVLKAGEKSVYECVDILVEFLRQKDILTDSIMMKYSELYVPENILDQARSEASNLPRINIKTIDCQWLQVLCEGWASPLTGFMKEREFLQCIHFNSLNKG-LYSQSIPIVLPINEEDKTAISNHPAIALCYDNRIVSIIRNPEIYKHRKEERCARTFGFVDKRHPSIKMIFESGDFLLGGDIEVLERFHWNDNLDKYRYTPKQIRQKMKEMNADTIFAFQLRNPIHNGHALLMQDARRKLIEMGYKNPVLLLHPLGGWTKDDDVPLNVRIKQHESVLDSGVLDRNSTILAIFPSPMIYAGPTEVQWHAKARMAAGVNYYIVGRDPAGIPHPETKEDLYDPFHGAEVLSMAPGLTKLEIIPFKVAAYDKLNKRMDYFDPNRKDDFIFISGTKMRNLAKNNECPPDGFMVPAAWEILRDYYQNLN 3053
            + NV +Q  HVSR KRG+++G    FRGCT+W TGLSGAGKTTL F LE  LV+HGIP YSLDGDN+R GLN+NLGF++ DREENIRRIAEVAKLF+D G+VC+TSFISPF K+R +AR +H  SGLPFFEVF++ P+E+CE+RDVKGLYKKARAGEIK FTG+DS YE P +P+L L+ GE SV EC+  +V FL+++ I+ + +  K +EL+VP N L    S+   LP I I T+D QW+QVL EGWASPLTGFM+ERE+LQ +HFN+L  G   + S+PIVLP+  E K  ++   A+AL Y  R V+++RNPE Y+H KEERCAR +G    +HP IKM+ ESGD+L+GGD+EVLER  WND LD+YR TP +++QK KEM AD +FAFQLRNP+HNGHALLM D RRKL E GY+ PVLLLHPLGGWTKDDDVPL+ R+KQH +VL+ GVLD +STI+AIFPSPM+YAGPTEVQWH +ARM AGVN+YIVGRDPAG+PHPE+ +DLYDP HGA+VLSMAPGL+ +EIIPF+VAAY+K  + MD++D  R  +F FISGTKMR+LA++ + PPDGFM P AW+IL +YY+++ 
Sbjct:   14 STNVVYQDHHVSRSKRGQVVGTRDGFRGCTVWLTGLSGAGKTTLGFALEEHLVSHGIPCYSLDGDNIRHGLNKNLGFSSTDREENIRRIAEVAKLFADAGLVCITSFISPFTKDRNEARVVHESSGLPFFEVFVNAPLEVCEQRDVKGLYKKARAGEIKGFTGIDSTYESPPSPELELRTGELSVNECILKVVNFLKEQGIIPNGVSEKITELFVPMNKLKLVESDIKTLPTITITTLDLQWVQVLAEGWASPLTGFMREREYLQVLHFNNLLDGPAINLSVPIVLPVTTETKERLAGSVAVALEYQGRRVAVLRNPEFYQHCKEERCARQWGTSCTKHPYIKMVMESGDWLVGGDLEVLERIKWNDGLDQYRLTPSELKQKFKEMKADAVFAFQLRNPVHNGHALLMTDTRRKLEERGYRRPVLLLHPLGGWTKDDDVPLDWRMKQHAAVLEEGVLDPSSTIIAIFPSPMMYAGPTEVQWHCRARMMAGVNFYIVGRDPAGMPHPESGKDLYDPSHGAKVLSMAPGLSSVEIIPFRVAAYNKSKRAMDFYDKERHAEFEFISGTKMRSLARSGQNPPDGFMAPKAWKILTEYYKSIQ 611          
BLAST of 3'-phosphoadenosine 5'-phosphosulfate synthase vs. Ensembl Cavefish
Match: papss1 (3'-phosphoadenosine 5'-phosphosulfate synthase 1 [Source:ZFIN;Acc:ZDB-GENE-080721-5])

HSP 1 Score: 809.675 bits (2090), Expect = 0.000e+0
Identity = 366/597 (61.31%), Postives = 470/597 (78.73%), Query Frame = 3
Query: 1272 NVFWQKKHVSRIKRGEILGEGSFRGCTIWFTGLSGAGKTTLAFHLEHFLVAHGIPSYSLDGDNVRTGLNQNLGFTAEDREENIRRIAEVAKLFSDGGIVCLTSFISPFEKNRQQARELHSISGLPFFEVFIDTPIEICEERDVKGLYKKARAGEIKHFTGVDSAYEPPKNPDLVLKAGEKSVYECVDILVEFLRQKDILTDSIMMKYSELYVPENILDQARSEASNLPRINIKTIDCQWLQVLCEGWASPLTGFMKEREFLQCIHFNSL-NKGLYSQSIPIVLPINEEDKTAISNHPAIALCYDNRIVSIIRNPEIYKHRKEERCARTFGFVDKRHPSIKMIFESGDFLLGGDIEVLERFHWNDNLDKYRYTPKQIRQKMKEMNADTIFAFQLRNPIHNGHALLMQDARRKLIEMGYKNPVLLLHPLGGWTKDDDVPLNVRIKQHESVLDSGVLDRNSTILAIFPSPMIYAGPTEVQWHAKARMAAGVNYYIVGRDPAGIPHPETKEDLYDPFHGAEVLSMAPGLTKLEIIPFKVAAYDKLNKRMDYFDPNRKDDFIFISGTKMRNLAKNNECPPDGFMVPAAWEILRDYYQNLNNT 3059
            NV +Q  HVS            FRGCT+W TGLSGAGKTT++  LE  LV HGIP Y+LDGDN+R GLN+NLGF+ EDREENIRRIAEVAKLF+D G+VC+ SFISP+ ++R  AR++H  +GLPFFEVF+D P+++CE+RDVKGLYK+ARAGEI+ FTG+DS YE P+ P+LVLK    SV EC+  L++ L+++DI+      +  ELYVPEN LD A+++A  LP + I  +D QW+QVL EGWA+PL GFM+ERE+LQC+HF+ L + G+ + S+P+VLP++  DK  +    A+AL Y  R V+I+RNPE Y+HRKEERCAR +G   K HP IKM+ ESGD+L+GGD++VL+R +WND LD YR TP +++QK KEMNAD +FAFQLRNP+HNGHALLMQD +R+LIE GY+ PVLLLHPLGGWTKDDDVPL  R++QH +VL+ GVLD NSTI+AIFPSPM+YAGPTEVQWH +ARM AG N+YIVGRDPAG+PHP+T +DLY+P HGA+VL+MAPGL  LEI+PFKVAAY+K+ K MD++DP   +D+ FISGT+MR +A+  + PP+GFM   AW +L++YYQ+L   
Sbjct:    6 NVTYQAHHVS------------FRGCTVWLTGLSGAGKTTVSMALEEHLVCHGIPCYTLDGDNIRQGLNKNLGFSPEDREENIRRIAEVAKLFADAGLVCIASFISPYSRDRLNARKIHEAAGLPFFEVFVDAPLDVCEQRDVKGLYKRARAGEIRGFTGIDSEYEKPEAPELVLKTDSCSVNECIQQLLDLLQERDIVPVDATYEVKELYVPENKLDLAKADAETLPAVEIGKVDMQWVQVLAEGWATPLNGFMREREYLQCLHFDCLLDGGVINMSVPVVLPVSGADKERLDGCTAVALVYGGRRVAILRNPEFYEHRKEERCARQWGTTCKDHPYIKMVMESGDWLVGGDLQVLDRIYWNDGLDNYRLTPTELKQKFKEMNADAVFAFQLRNPVHNGHALLMQDTQRRLIERGYRRPVLLLHPLGGWTKDDDVPLPWRMRQHAAVLEEGVLDPNSTIVAIFPSPMMYAGPTEVQWHCRARMVAGANFYIVGRDPAGMPHPDTGKDLYEPTHGAKVLTMAPGLISLEIVPFKVAAYNKVKKAMDFYDPKNHEDYDFISGTRMRRMAREGQNPPEGFMALKAWTVLKEYYQSLEKA 590          
BLAST of 3'-phosphoadenosine 5'-phosphosulfate synthase vs. Ensembl Yeast
Match: MET14 (Adenylylsulfate kinase; required for sulfate assimilation and involved in methionine metabolism; human homolog PAPSS2 complements yeast null mutant [Source:SGD;Acc:S000001484])

HSP 1 Score: 210.69 bits (535), Expect = 4.630e-63
Identity = 95/175 (54.29%), Postives = 130/175 (74.29%), Query Frame = 3
Query: 1344 GCTIWFTGLSGAGKTTLAFHLEHFLVAHGIPSYSLDGDNVRTGLNQNLGFTAEDREENIRRIAEVAKLFSDGGIVCLTSFISPFEKNRQQARELHSISGLPFFEVFIDTPIEICEERDVKGLYKKARAGEIKHFTGVDSAYEPPKNPDLVLKAGEKSVYECVDILVEFLRQKDIL 1868
            GCTIW TGLS +GK+T+A  LE  L+   + +Y LDGDN+R GLN++LGF+ +DR ENIRRI+EV+KLF+D   + +TSFISP+  +R +ARELH  +GL F E+F+D P+E+ E+RD KGLYKKAR G IK FTG+ + YE PK P+L L+  +K+V EC  I+ E+L  + I+
Sbjct:   24 GCTIWLTGLSASGKSTIACALEQLLLQKNLSAYRLDGDNIRFGLNKDLGFSEKDRNENIRRISEVSKLFADSCAISITSFISPYRVDRDRARELHKEAGLKFIEIFVDVPLEVAEQRDPKGLYKKAREGVIKEFTGISAPYEAPKAPELHLRTDQKTVEECATIIYEYLISEKII 198          
BLAST of 3'-phosphoadenosine 5'-phosphosulfate synthase vs. Ensembl Yeast
Match: MET3 (ATP sulfurylase; catalyzes the primary step of intracellular sulfate activation, essential for assimilatory reduction of sulfate to sulfide, involved in methionine metabolism; human homolog PAPSS2 complements yeast null mutant [Source:SGD;Acc:S000003771])

HSP 1 Score: 144.05 bits (362), Expect = 9.788e-37
Identity = 103/354 (29.10%), Postives = 169/354 (47.74%), Query Frame = 3
Query: 1989 LQVLCEGWASPLTGFMKEREFLQCIHFNSLNKGLYSQSIPIVLPINEEDKTAISNHPAIALCYDNRI-VSIIRNPEIYKHRKEERCARTFGFVDKRHPSIKMIFE-SGDFLLGGDIEVLERFHWNDNLDKYRYTPKQIRQKMKEMNADTIFAFQLRNPIHNGHALLMQDARRKLIEMGYKNPVLLLHPLGGWTKDDDVPLNVRIKQHESVLDSGVLDRNSTILAIFPSPMIYAGPTEVQWHAKARMAAGVNYYIVGRDPAGIPHPETKEDLYDPFHGAEVLSMAPGLTKLEIIPFKVAAYDKLNKR---MDYFDPNRKDDFIFISGTKMRNLAKNNECPPDGFMVPAAWEILRD 3035
            ++++  G  SPLTGF+ E ++   +  + L  G    +IPI L ++E     I     IAL  D+ I ++I+   ++YK  K     + F   D  HP+I  +F  +GD+ +GG +E ++     D     R TP Q+R + +    D + AFQ RNP+H  H  L   A R+       N  +L+HP+ G TK  D+  + R++ ++ ++           L++ P  M  +G  E  WHA  R   G +++IVGRD AG        D Y P+   E++        +E++PF++  Y     R   +D  D   K   + ISGT++R   +     P+ F  P   +ILR+
Sbjct:   45 IELILNGGFSPLTGFLNENDYSSVVTDSRLADGTL-WTIPITLDVDEAFANQIKPDTRIALFQDDEIPIAILTVQDVYKPNKTIEAEKVFRG-DPEHPAISYLFNVAGDYYVGGSLEAIQLPQHYD-YPGLRKTPAQLRLEFQSRQWDRVVAFQTRNPMHRAHRELTVRAARE------ANAKVLIHPVVGLTKPGDIDHHTRVRVYQEIIKR--YPNGIAFLSLLPLAMRMSGDREAVWHAIIRKNYGASHFIVGRDHAGPGKNSKGVDFYGPYDAQELVESYKHELDIEVVPFRMVTYLPDEDRYAPIDQID-TTKTRTLNISGTELRRRLRVGGEIPEWFSYPEVVKILRE 386          
BLAST of 3'-phosphoadenosine 5'-phosphosulfate synthase vs. Ensembl Nematostella
Match: EDO47767 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKZ0])

HSP 1 Score: 766.918 bits (1979), Expect = 0.000e+0
Identity = 354/598 (59.20%), Postives = 466/598 (77.93%), Query Frame = 3
Query: 1272 NVFWQKKHVSRIKRGEILG-EGSFRGCTIWFTGLSGAGKTTLAFHLEHFLVAHGIPSYSLDGDNVRTGLNQNLGFTAEDREENIRRIAEVAKLFSDGGIVCLTSFISPFEKNRQQARELHSISGLPFFEVFIDTPIEICEERDVKGLYKKARAGEIKHFTGVDSAYEPPKNPDLVLKAGEKSVYECVDILVEFLRQKDILTDSIMMKYSELYV-PENILDQARSEASNLPRINIKTIDCQWLQVLCEGWASPLTGFMKEREFLQCIHFNSL-NKGLYSQSIPIVLPINEEDKTAISNHPAIALCYDNRIVSIIRNPEIYKHRKEERCARTFGFVDKRHPSIKMIFESGDFLLGGDIEVLERFHWNDNLDKYRYTPKQIRQKMKEMNADTIFAFQLRNPIHNGHALLMQDARRKLIEMGYKNPVLLLHPLGGWTKDDDVPLNVRIKQHESVLDSGVLDRNSTILAIFPSPMIYAGPTEVQWHAKARMAAGVNYYIVGRDPAGIPHPETKEDLYDPFHGAEVLSMAPGLTKLEIIPFKVAAYDKLNKRMDYFDPNRKDDFIFISGTKMRNLAKNNECPPDGFMVPAAWEILRDYYQNLNN 3056
            NV ++   VSR KRG+++G    FRGC++WFTGLSGAGKTTL+  LE +L   GIP+Y+LDGDN+RTGLN+NLGFT EDREENIRR++EVAKLF+D G+VCLT+FISP+ ++R +AR+LH  + LPFFE+F++TP+E CE+RDVKGLYKKARAG IK FTG+D+ Y+PP  P+L L+AGE SV  CV  +V+ L +  +L  +++    EL+V PEN+ D A+ EA +LP++ I  +D QW+QVL EGWA+PL GFM+E EFLQC HF +L    + +QS+PIVLP+  E+K  +    A  L Y+ R ++I+RNP+ Y+HRKE                  M+ ESGD+L GGD+EV+ER  WND LDKYR TP ++R + K + +D +FAFQLRNP+HNGHALLMQD R++LI+ G+K PVLLLHPLGGWTK+DDVPL VR++QH +VL+ GVLD ++T+LAIFPSPM+YAGPTEVQWHAKAR+AAGVN+YIVGRDPAG+PHP+ K DLY P HG +VL+MAPGLT+LEI+PF+VAAY+  +K+M++FDP  K+DF FISGT+MR LA++ + PP+GFM P AW IL ++YQ++ N
Sbjct:   19 NVEYKDHSVSRDKRGQVVGTRAGFRGCSVWFTGLSGAGKTTLSMALEDYLCRQGIPAYTLDGDNMRTGLNRNLGFTPEDREENIRRVSEVAKLFADSGMVCLTAFISPYSRDRDRARKLHEDANLPFFEIFVNTPLETCEKRDVKGLYKKARAGIIKGFTGIDAEYQPPHKPELELRAGELSVDNCVQEVVKLLTKSGVLPHAMVNGIKELFVEPENV-DAAKQEADSLPKLEITLLDLQWVQVLSEGWATPLYGFMRENEFLQCQHFGALLQASVSNQSVPIVLPLTTENKNRLEGCSAYTLTYEGRNIAIVRNPDFYEHRKE------------------MVLESGDWLSGGDLEVIERIRWNDGLDKYRLTPNELRDEFKRLGSDAVFAFQLRNPVHNGHALLMQDTRQRLIQRGFKKPVLLLHPLGGWTKEDDVPLAVRMRQHYAVLNEGVLDPDTTVLAIFPSPMMYAGPTEVQWHAKARVAAGVNFYIVGRDPAGMPHPDEKRDLYHPSHGRKVLTMAPGLTELEIVPFRVAAYNTRHKKMEFFDPEHKEDFDFISGTRMRALARSGKEPPNGFMAPTAWNILAEFYQSVKN 597          
BLAST of 3'-phosphoadenosine 5'-phosphosulfate synthase vs. Ensembl Medaka
Match: papss2a (bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 2 [Source:NCBI gene;Acc:101171603])

HSP 1 Score: 844.343 bits (2180), Expect = 0.000e+0
Identity = 388/596 (65.10%), Postives = 481/596 (80.70%), Query Frame = 3
Query: 1272 NVFWQKKHVSRIKRGEILG-EGSFRGCTIWFTGLSGAGKTTLAFHLEHFLVAHGIPSYSLDGDNVRTGLNQNLGFTAEDREENIRRIAEVAKLFSDGGIVCLTSFISPFEKNRQQARELHSISGLPFFEVFIDTPIEICEERDVKGLYKKARAGEIKHFTGVDSAYEPPKNPDLVLKAGEKSVYECVDILVEFLRQKDILTDSIMMKYSELYVPENILDQARSEASNLPRINIKTIDCQWLQVLCEGWASPLTGFMKEREFLQCIHF-NSLNKGLYSQSIPIVLPINEEDKTAISNHPAIALCYDNRIVSIIRNPEIYKHRKEERCARTFGFVDKRHPSIKMIFESGDFLLGGDIEVLERFHWNDNLDKYRYTPKQIRQKMKEMNADTIFAFQLRNPIHNGHALLMQDARRKLIEMGYKNPVLLLHPLGGWTKDDDVPLNVRIKQHESVLDSGVLDRNSTILAIFPSPMIYAGPTEVQWHAKARMAAGVNYYIVGRDPAGIPHPETKEDLYDPFHGAEVLSMAPGLTKLEIIPFKVAAYDKLNKRMDYFDPNRKDDFIFISGTKMRNLAKNNECPPDGFMVPAAWEILRDYYQNLN 3053
            NV +Q  HVSR KRG+++G  G FRGCTIW TGLSGAGKTT++F LE +LV+H IP YSLDGDN+R GLN+NLGF++EDREENIRR+AEVAKLF+D G+VC+TSFISPF ++R +AR +H  SGLPFFEVF+   +E+CE RDVKGLYKKARAGEIK FTG+DS YE P+ P+LVLK GE SV EC+  ++E LR+++I+   IM + +EL+VPEN L  A ++A++LP I+I  +D QW+QVL EGWASPL GFM+EREFLQ +HF N L+ G  + SIPIVLP+  E K  +  H A+AL Y    V+I+RNPE Y+HRKEERCAR +G    +HP IKM+ E GD+L+GGD+EVLER  WND LD YR TPK++++K K+M +D IFAFQLRNP+HNGHALLMQD +R+L+E GYKNPVLLLHPLGGWTKDDDVPL  R+KQH +VL+ GVLD  +TI+AIFPSPM+YAGPTEVQWH +ARM AG N+YIVGRDPAG+PHPETK+DLY+P HG +VL+MAPGLT +EIIPF+VAAY+K  K MD++ P R  +F FISGTKMRNLA+  E PPDGFM P AW++L +YY +L 
Sbjct:   16 NVVYQAHHVSRSKRGQVVGTRGGFRGCTIWLTGLSGAGKTTISFALEEYLVSHAIPCYSLDGDNIRHGLNKNLGFSSEDREENIRRVAEVAKLFADAGLVCITSFISPFAQDRSEARRIHQSSGLPFFEVFVHATLEVCESRDVKGLYKKARAGEIKGFTGIDSNYERPEAPELVLKTGELSVNECLQQILELLREQNIVPGEIMEEVNELFVPENKLSLAVADANSLPTISITKLDLQWVQVLAEGWASPLKGFMREREFLQVMHFGNLLDGGAINMSIPIVLPVTMETKQELDGHAAVALEYQGSRVAILRNPEFYEHRKEERCARQWGTTCPQHPYIKMVMEGGDWLVGGDLEVLERIKWNDGLDHYRLTPKELKRKFKDMGSDAIFAFQLRNPVHNGHALLMQDTKRRLLERGYKNPVLLLHPLGGWTKDDDVPLEWRMKQHAAVLEEGVLDPANTIVAIFPSPMMYAGPTEVQWHCRARMIAGANFYIVGRDPAGMPHPETKKDLYEPTHGGKVLTMAPGLTSVEIIPFRVAAYNKAKKAMDFYSPERNAEFEFISGTKMRNLARTGENPPDGFMAPKAWKVLVEYYTSLQ 611          
BLAST of 3'-phosphoadenosine 5'-phosphosulfate synthase vs. Ensembl Medaka
Match: papss1 (3'-phosphoadenosine 5'-phosphosulfate synthase 1 [Source:NCBI gene;Acc:101166444])

HSP 1 Score: 822.002 bits (2122), Expect = 0.000e+0
Identity = 371/607 (61.12%), Postives = 482/607 (79.41%), Query Frame = 3
Query: 1236 NSPEMTSKILNENVFWQKKHVSRIKRGEILG-EGSFRGCTIWFTGLSGAGKTTLAFHLEHFLVAHGIPSYSLDGDNVRTGLNQNLGFTAEDREENIRRIAEVAKLFSDGGIVCLTSFISPFEKNRQQARELHSISGLPFFEVFIDTPIEICEERDVKGLYKKARAGEIKHFTGVDSAYEPPKNPDLVLKAGEKSVYECVDILVEFLRQKDILTDSIMMKYSELYVPENILDQARSEASNLPRINIKTIDCQWLQVLCEGWASPLTGFMKEREFLQCIHFNSL-NKGLYSQSIPIVLPINEEDKTAISNHPAIALCYDNRIVSIIRNPEIYKHRKEERCARTFGFVDKRHPSIKMIFESGDFLLGGDIEVLERFHWNDNLDKYRYTPKQIRQKMKEMNADTIFAFQLRNPIHNGHALLMQDARRKLIEMGYKNPVLLLHPLGGWTKDDDVPLNVRIKQHESVLDSGVLDRNSTILAIFPSPMIYAGPTEVQWHAKARMAAGVNYYIVGRDPAGIPHPETKEDLYDPFHGAEVLSMAPGLTKLEIIPFKVAAYDKLNKRMDYFDPNRKDDFIFISGTKMRNLAKNNECPPDGFMVPAAWEILRDYYQNL 3050
            N+PE        NV +Q  HVSR KRG+++G  G FRGCT+W TGLSGAGKTT++  LE +LV H IP Y+LDGDN+R GLN+NLGF+ EDREENIRRIAEVA+LF+D G+VC+ SFISP+ ++R  AR++H  +GLPFFEVF+D P+++CE+RDVKGLYK+ARAGEI+ FTG+DS YE P+ P+LVLK    SV E +  LV+ L+++DI+      +  ELYV EN LD A+++A  LP + I  +D QW+QVL EGWA+PL GFM+EREFLQC+HF+ L + G+ + S+P+VLP++  DK  +    A+AL Y+ + V+I+RNPE Y+HRKEERCAR +G   K HP IKM+ E GD+L+GGD++VL+R  WND LD+YR TP ++RQK KEMNAD IFAFQLRNP+HNGHALLMQD +++LIE GY+ PVLLLHPLGGWTKDDDVPL  R+KQH +V++ GVL+ +STI+AIFPSPM+YAGPTEVQWH +ARM AG N+YIVGRDPAG+PHP+T +DLY+P HGA+VL+MAPGL  LEI+PFKVAAY+K+ + MD++DP    D+ FISGT+MR LA+  + PPDGFM P+AW +L++YY++L
Sbjct:   15 NAPESWGMQRATNVTYQAHHVSRNKRGQVVGTRGGFRGCTVWLTGLSGAGKTTVSMALEEYLVCHRIPCYTLDGDNIRQGLNKNLGFSPEDREENIRRIAEVARLFADAGLVCIASFISPYSRDRLNARKIHEAAGLPFFEVFVDAPLDVCEQRDVKGLYKRARAGEIRGFTGIDSEYEKPEAPELVLKTDSCSVNESIQQLVDLLQERDIVPVDGSYEVKELYVQENKLDLAKADAETLPAVQIGKLDMQWVQVLAEGWATPLNGFMREREFLQCLHFDCLLDGGVINLSVPVVLPVSTADKERLDGVTAMALVYEGKRVAILRNPEFYEHRKEERCARQWGTTCKDHPYIKMVMEGGDWLVGGDLQVLDRIRWNDGLDQYRLTPNELRQKFKEMNADAIFAFQLRNPVHNGHALLMQDTQKRLIERGYRRPVLLLHPLGGWTKDDDVPLPWRMKQHAAVMEEGVLNPDSTIVAIFPSPMMYAGPTEVQWHCRARMVAGANFYIVGRDPAGMPHPDTGKDLYEPSHGAKVLTMAPGLISLEIVPFKVAAYNKIKRAMDFYDPKNHQDYDFISGTRMRKLAREGQNPPDGFMAPSAWAVLKEYYKSL 621          
BLAST of 3'-phosphoadenosine 5'-phosphosulfate synthase vs. Planmine SMEST
Match: SMESG000077893.1 (SMESG000077893.1)

HSP 1 Score: 1258.82 bits (3256), Expect = 0.000e+0
Identity = 603/604 (99.83%), Postives = 604/604 (100.00%), Query Frame = 3
Query: 1248 MTSKILNENVFWQKKHVSRIKRGEILGEGSFRGCTIWFTGLSGAGKTTLAFHLEHFLVAHGIPSYSLDGDNVRTGLNQNLGFTAEDREENIRRIAEVAKLFSDGGIVCLTSFISPFEKNRQQARELHSISGLPFFEVFIDTPIEICEERDVKGLYKKARAGEIKHFTGVDSAYEPPKNPDLVLKAGEKSVYECVDILVEFLRQKDILTDSIMMKYSELYVPENILDQARSEASNLPRINIKTIDCQWLQVLCEGWASPLTGFMKEREFLQCIHFNSLNKGLYSQSIPIVLPINEEDKTAISNHPAIALCYDNRIVSIIRNPEIYKHRKEERCARTFGFVDKRHPSIKMIFESGDFLLGGDIEVLERFHWNDNLDKYRYTPKQIRQKMKEMNADTIFAFQLRNPIHNGHALLMQDARRKLIEMGYKNPVLLLHPLGGWTKDDDVPLNVRIKQHESVLDSGVLDRNSTILAIFPSPMIYAGPTEVQWHAKARMAAGVNYYIVGRDPAGIPHPETKEDLYDPFHGAEVLSMAPGLTKLEIIPFKVAAYDKLNKRMDYFDPNRKDDFIFISGTKMRNLAKNNECPPDGFMVPAAWEILRDYYQNLNNT 3059
            MTSKILNENVFWQKKHVSRIKRGEILGEGSFRGCTIWFTGLSGAGKTTLAFHLEHFLVAHGIPSYSLDGDNVRTGLNQNLGFTAEDREENIRRIAEVAKLFSDGGIVCLTSFISPFEKNRQQARELHSISGLPFFEVFIDTPIEICEERDVKGLYKKARAG+IKHFTGVDSAYEPPKNPDLVLKAGEKSVYECVDILVEFLRQKDILTDSIMMKYSELYVPENILDQARSEASNLPRINIKTIDCQWLQVLCEGWASPLTGFMKEREFLQCIHFNSLNKGLYSQSIPIVLPINEEDKTAISNHPAIALCYDNRIVSIIRNPEIYKHRKEERCARTFGFVDKRHPSIKMIFESGDFLLGGDIEVLERFHWNDNLDKYRYTPKQIRQKMKEMNADTIFAFQLRNPIHNGHALLMQDARRKLIEMGYKNPVLLLHPLGGWTKDDDVPLNVRIKQHESVLDSGVLDRNSTILAIFPSPMIYAGPTEVQWHAKARMAAGVNYYIVGRDPAGIPHPETKEDLYDPFHGAEVLSMAPGLTKLEIIPFKVAAYDKLNKRMDYFDPNRKDDFIFISGTKMRNLAKNNECPPDGFMVPAAWEILRDYYQNLNNT
Sbjct:    1 MTSKILNENVFWQKKHVSRIKRGEILGEGSFRGCTIWFTGLSGAGKTTLAFHLEHFLVAHGIPSYSLDGDNVRTGLNQNLGFTAEDREENIRRIAEVAKLFSDGGIVCLTSFISPFEKNRQQARELHSISGLPFFEVFIDTPIEICEERDVKGLYKKARAGKIKHFTGVDSAYEPPKNPDLVLKAGEKSVYECVDILVEFLRQKDILTDSIMMKYSELYVPENILDQARSEASNLPRINIKTIDCQWLQVLCEGWASPLTGFMKEREFLQCIHFNSLNKGLYSQSIPIVLPINEEDKTAISNHPAIALCYDNRIVSIIRNPEIYKHRKEERCARTFGFVDKRHPSIKMIFESGDFLLGGDIEVLERFHWNDNLDKYRYTPKQIRQKMKEMNADTIFAFQLRNPIHNGHALLMQDARRKLIEMGYKNPVLLLHPLGGWTKDDDVPLNVRIKQHESVLDSGVLDRNSTILAIFPSPMIYAGPTEVQWHAKARMAAGVNYYIVGRDPAGIPHPETKEDLYDPFHGAEVLSMAPGLTKLEIIPFKVAAYDKLNKRMDYFDPNRKDDFIFISGTKMRNLAKNNECPPDGFMVPAAWEILRDYYQNLNNT 604          
BLAST of 3'-phosphoadenosine 5'-phosphosulfate synthase vs. Planmine SMEST
Match: SMESG000077893.1 (SMESG000077893.1)

HSP 1 Score: 1255.35 bits (3247), Expect = 0.000e+0
Identity = 602/603 (99.83%), Postives = 603/603 (100.00%), Query Frame = 3
Query: 1251 TSKILNENVFWQKKHVSRIKRGEILGEGSFRGCTIWFTGLSGAGKTTLAFHLEHFLVAHGIPSYSLDGDNVRTGLNQNLGFTAEDREENIRRIAEVAKLFSDGGIVCLTSFISPFEKNRQQARELHSISGLPFFEVFIDTPIEICEERDVKGLYKKARAGEIKHFTGVDSAYEPPKNPDLVLKAGEKSVYECVDILVEFLRQKDILTDSIMMKYSELYVPENILDQARSEASNLPRINIKTIDCQWLQVLCEGWASPLTGFMKEREFLQCIHFNSLNKGLYSQSIPIVLPINEEDKTAISNHPAIALCYDNRIVSIIRNPEIYKHRKEERCARTFGFVDKRHPSIKMIFESGDFLLGGDIEVLERFHWNDNLDKYRYTPKQIRQKMKEMNADTIFAFQLRNPIHNGHALLMQDARRKLIEMGYKNPVLLLHPLGGWTKDDDVPLNVRIKQHESVLDSGVLDRNSTILAIFPSPMIYAGPTEVQWHAKARMAAGVNYYIVGRDPAGIPHPETKEDLYDPFHGAEVLSMAPGLTKLEIIPFKVAAYDKLNKRMDYFDPNRKDDFIFISGTKMRNLAKNNECPPDGFMVPAAWEILRDYYQNLNNT 3059
            TSKILNENVFWQKKHVSRIKRGEILGEGSFRGCTIWFTGLSGAGKTTLAFHLEHFLVAHGIPSYSLDGDNVRTGLNQNLGFTAEDREENIRRIAEVAKLFSDGGIVCLTSFISPFEKNRQQARELHSISGLPFFEVFIDTPIEICEERDVKGLYKKARAG+IKHFTGVDSAYEPPKNPDLVLKAGEKSVYECVDILVEFLRQKDILTDSIMMKYSELYVPENILDQARSEASNLPRINIKTIDCQWLQVLCEGWASPLTGFMKEREFLQCIHFNSLNKGLYSQSIPIVLPINEEDKTAISNHPAIALCYDNRIVSIIRNPEIYKHRKEERCARTFGFVDKRHPSIKMIFESGDFLLGGDIEVLERFHWNDNLDKYRYTPKQIRQKMKEMNADTIFAFQLRNPIHNGHALLMQDARRKLIEMGYKNPVLLLHPLGGWTKDDDVPLNVRIKQHESVLDSGVLDRNSTILAIFPSPMIYAGPTEVQWHAKARMAAGVNYYIVGRDPAGIPHPETKEDLYDPFHGAEVLSMAPGLTKLEIIPFKVAAYDKLNKRMDYFDPNRKDDFIFISGTKMRNLAKNNECPPDGFMVPAAWEILRDYYQNLNNT
Sbjct:   11 TSKILNENVFWQKKHVSRIKRGEILGEGSFRGCTIWFTGLSGAGKTTLAFHLEHFLVAHGIPSYSLDGDNVRTGLNQNLGFTAEDREENIRRIAEVAKLFSDGGIVCLTSFISPFEKNRQQARELHSISGLPFFEVFIDTPIEICEERDVKGLYKKARAGKIKHFTGVDSAYEPPKNPDLVLKAGEKSVYECVDILVEFLRQKDILTDSIMMKYSELYVPENILDQARSEASNLPRINIKTIDCQWLQVLCEGWASPLTGFMKEREFLQCIHFNSLNKGLYSQSIPIVLPINEEDKTAISNHPAIALCYDNRIVSIIRNPEIYKHRKEERCARTFGFVDKRHPSIKMIFESGDFLLGGDIEVLERFHWNDNLDKYRYTPKQIRQKMKEMNADTIFAFQLRNPIHNGHALLMQDARRKLIEMGYKNPVLLLHPLGGWTKDDDVPLNVRIKQHESVLDSGVLDRNSTILAIFPSPMIYAGPTEVQWHAKARMAAGVNYYIVGRDPAGIPHPETKEDLYDPFHGAEVLSMAPGLTKLEIIPFKVAAYDKLNKRMDYFDPNRKDDFIFISGTKMRNLAKNNECPPDGFMVPAAWEILRDYYQNLNNT 613          
BLAST of 3'-phosphoadenosine 5'-phosphosulfate synthase vs. Planmine SMEST
Match: SMESG000077893.1 (SMESG000077893.1)

HSP 1 Score: 1212.59 bits (3136), Expect = 0.000e+0
Identity = 586/604 (97.02%), Postives = 587/604 (97.19%), Query Frame = 3
Query: 1248 MTSKILNENVFWQKKHVSRIKRGEILGEGSFRGCTIWFTGLSGAGKTTLAFHLEHFLVAHGIPSYSLDGDNVRTGLNQNLGFTAEDREENIRRIAEVAKLFSDGGIVCLTSFISPFEKNRQQARELHSISGLPFFEVFIDTPIEICEERDVKGLYKKARAGEIKHFTGVDSAYEPPKNPDLVLKAGEKSVYECVDILVEFLRQKDILTDSIMMKYSELYVPENILDQARSEASNLPRINIKTIDCQWLQVLCEGWASPLTGFMKEREFLQCIHFNSLNKGLYSQSIPIVLPINEEDKTAISNHPAIALCYDNRIVSIIRNPEIYKHRKEERCARTFGFVDKRHPSIKMIFESGDFLLGGDIEVLERFHWNDNLDKYRYTPKQIRQKMKEMNADTIFAFQLRNPIHNGHALLMQDARRKLIEMGYKNPVLLLHPLGGWTKDDDVPLNVRIKQHESVLDSGVLDRNSTILAIFPSPMIYAGPTEVQWHAKARMAAGVNYYIVGRDPAGIPHPETKEDLYDPFHGAEVLSMAPGLTKLEIIPFKVAAYDKLNKRMDYFDPNRKDDFIFISGTKMRNLAKNNECPPDGFMVPAAWEILRDYYQNLNNT 3059
            MTSKILNENVFWQKKHVSRIKRGEILGEGSFRGCTIWFTGLSGAGKTTLAFHLEHFLVAHGIPSYSLDGDNVRTGLNQNLGFTAEDREENIRRIAEVAKLFSDGGIVCLTSFISPFEKNRQQARELHSISGLPFFEVFIDTPIEICEERDVKGLYKKARAG+IKHFTGVDSAYEPPKNPDLVLKAGEKSVYECVDILVEFLRQKDILTDSIMMKYSELYVPENILDQARSEASNLPRINIKTIDCQWLQVLCEGWASPLTGFMKEREFLQCIHFNSLNKGLYSQSIPIVLPINEEDKTAISNHPAIALCYDNRIVSIIRNPEIYKHRKEERCARTFGFVDKRHPSIKMIFESGDFLLGGDIEVLERFHWNDNLDKYRYTPKQIRQKMKEMNADTIFAFQLRNPIHNGHALLMQDARRKLIEMGYKNPVLLLHPLGGWTKDDDVPLNVRIKQHESVLDSGVLDRNSTILAIFPSPMIYAGPTEVQWHAKARMAAGVNYYIVGRDPAGIPHPETKEDLYDPFHGAEVLSMAPGLTKLEIIPFKVAAYDKLNKRMDYFDPN                 KNNECPPDGFMVPAAWEILRDYYQNLNNT
Sbjct:    1 MTSKILNENVFWQKKHVSRIKRGEILGEGSFRGCTIWFTGLSGAGKTTLAFHLEHFLVAHGIPSYSLDGDNVRTGLNQNLGFTAEDREENIRRIAEVAKLFSDGGIVCLTSFISPFEKNRQQARELHSISGLPFFEVFIDTPIEICEERDVKGLYKKARAGKIKHFTGVDSAYEPPKNPDLVLKAGEKSVYECVDILVEFLRQKDILTDSIMMKYSELYVPENILDQARSEASNLPRINIKTIDCQWLQVLCEGWASPLTGFMKEREFLQCIHFNSLNKGLYSQSIPIVLPINEEDKTAISNHPAIALCYDNRIVSIIRNPEIYKHRKEERCARTFGFVDKRHPSIKMIFESGDFLLGGDIEVLERFHWNDNLDKYRYTPKQIRQKMKEMNADTIFAFQLRNPIHNGHALLMQDARRKLIEMGYKNPVLLLHPLGGWTKDDDVPLNVRIKQHESVLDSGVLDRNSTILAIFPSPMIYAGPTEVQWHAKARMAAGVNYYIVGRDPAGIPHPETKEDLYDPFHGAEVLSMAPGLTKLEIIPFKVAAYDKLNKRMDYFDPN----------------PKNNECPPDGFMVPAAWEILRDYYQNLNNT 588          
The following BLAST results are available for this feature:
BLAST of 3'-phosphoadenosine 5'-phosphosulfate synthase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
PAPSS20.000e+063.323'-phosphoadenosine 5'-phosphosulfate synthase 2 [... [more]
PAPSS20.000e+062.793'-phosphoadenosine 5'-phosphosulfate synthase 2 [... [more]
PAPSS10.000e+061.853'-phosphoadenosine 5'-phosphosulfate synthase 1 [... [more]
back to top
BLAST of 3'-phosphoadenosine 5'-phosphosulfate synthase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
pps-10.000e+054.253'-Phosphoadenosine 5'-Phosphosulfate Synthetase ... [more]
pps-10.000e+054.083'-Phosphoadenosine 5'-Phosphosulfate Synthetase ... [more]
back to top
BLAST of 3'-phosphoadenosine 5'-phosphosulfate synthase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Papss0.000e+058.52gene:FBgn0020389 transcript:FBtr0074888[more]
Papss0.000e+059.74gene:FBgn0020389 transcript:FBtr0074885[more]
Papss0.000e+059.74gene:FBgn0020389 transcript:FBtr0074887[more]
Papss0.000e+059.74gene:FBgn0020389 transcript:FBtr0074886[more]
Papss0.000e+059.74gene:FBgn0020389 transcript:FBtr0332146[more]
back to top
BLAST of 3'-phosphoadenosine 5'-phosphosulfate synthase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
papss10.000e+062.113'-phosphoadenosine 5'-phosphosulfate synthase 1 [... [more]
papss2b0.000e+063.533'-phosphoadenosine 5'-phosphosulfate synthase 2b ... [more]
papss2a0.000e+062.333'-phosphoadenosine 5'-phosphosulfate synthase 2a ... [more]
papss2a0.000e+062.333'-phosphoadenosine 5'-phosphosulfate synthase 2a ... [more]
papss2a0.000e+062.333'-phosphoadenosine 5'-phosphosulfate synthase 2a ... [more]
back to top
BLAST of 3'-phosphoadenosine 5'-phosphosulfate synthase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PAPSS20.000e+063.483'-phosphoadenosine 5'-phosphosulfate synthase 2 [... [more]
PAPSS20.000e+063.323'-phosphoadenosine 5'-phosphosulfate synthase 2 [... [more]
PAPSS20.000e+063.323'-phosphoadenosine 5'-phosphosulfate synthase 2 [... [more]
PAPSS20.000e+062.713'-phosphoadenosine 5'-phosphosulfate synthase 2 [... [more]
PAPSS20.000e+063.533'-phosphoadenosine 5'-phosphosulfate synthase 2 [... [more]
back to top
BLAST of 3'-phosphoadenosine 5'-phosphosulfate synthase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Papss20.000e+061.943'-phosphoadenosine 5'-phosphosulfate synthase 2 [... [more]
Papss20.000e+062.503'-phosphoadenosine 5'-phosphosulfate synthase 2 [... [more]
Papss20.000e+061.983'-phosphoadenosine 5'-phosphosulfate synthase 2 [... [more]
Papss10.000e+061.853'-phosphoadenosine 5'-phosphosulfate synthase 1 [... [more]
Papss10.000e+061.853'-phosphoadenosine 5'-phosphosulfate synthase 1 [... [more]
back to top
BLAST of 3'-phosphoadenosine 5'-phosphosulfate synthase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q27128|PAPSS_URECA0.000e+063.15Bifunctional 3'-phosphoadenosine 5'-phosphosulfate... [more]
sp|O95340|PAPS2_HUMAN0.000e+063.32Bifunctional 3'-phosphoadenosine 5'-phosphosulfate... [more]
sp|O88428|PAPS2_MOUSE0.000e+061.98Bifunctional 3'-phosphoadenosine 5'-phosphosulfate... [more]
sp|Q60967|PAPS1_MOUSE0.000e+061.85Bifunctional 3'-phosphoadenosine 5'-phosphosulfate... [more]
sp|O43252|PAPS1_HUMAN0.000e+061.85Bifunctional 3'-phosphoadenosine 5'-phosphosulfate... [more]
back to top
BLAST of 3'-phosphoadenosine 5'-phosphosulfate synthase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A423U0M40.000e+065.89Putative bifunctional 3 OS=Penaeus vannamei OX=668... [more]
T1FXP60.000e+066.72Uncharacterized protein OS=Helobdella robusta OX=6... [more]
A0A2I2UIU60.000e+064.563'-phosphoadenosine 5'-phosphosulfate synthase 2 O... [more]
A0A2I0U9E70.000e+065.12Uncharacterized protein OS=Limosa lapponica baueri... [more]
A0A091PU620.000e+065.21Bifunctional 3'-phosphoadenosine 5'-phosphosulfate... [more]
back to top
BLAST of 3'-phosphoadenosine 5'-phosphosulfate synthase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
papss2b0.000e+063.823'-phosphoadenosine 5'-phosphosulfate synthase 2 [... [more]
papss2a0.000e+064.05bifunctional 3'-phosphoadenosine 5'-phosphosulfate... [more]
papss2a0.000e+064.05bifunctional 3'-phosphoadenosine 5'-phosphosulfate... [more]
papss10.000e+061.313'-phosphoadenosine 5'-phosphosulfate synthase 1 [... [more]
back to top
BLAST of 3'-phosphoadenosine 5'-phosphosulfate synthase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of 3'-phosphoadenosine 5'-phosphosulfate synthase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
MET144.630e-6354.29Adenylylsulfate kinase; required for sulfate assim... [more]
MET39.788e-3729.10ATP sulfurylase; catalyzes the primary step of int... [more]
back to top
BLAST of 3'-phosphoadenosine 5'-phosphosulfate synthase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO477670.000e+059.20Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of 3'-phosphoadenosine 5'-phosphosulfate synthase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
papss2a0.000e+065.10bifunctional 3'-phosphoadenosine 5'-phosphosulfate... [more]
papss10.000e+061.123'-phosphoadenosine 5'-phosphosulfate synthase 1 [... [more]
back to top
BLAST of 3'-phosphoadenosine 5'-phosphosulfate synthase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000077893.10.000e+099.83SMESG000077893.1[more]
SMESG000077893.10.000e+099.83SMESG000077893.1[more]
SMESG000077893.10.000e+097.02SMESG000077893.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027968 ID=SMED30027968|Name=3'-phosphoadenosine 5'-phosphosulfate synthase|organism=Schmidtea mediterranea sexual|type=transcript|length=3144bp
GTCGGCAAAATAATAAAAATTGTTGTTCTACACTCCGCCGCCACGCCACA
TTCAACAGCTTGTTTTAATCGTGTTAGCACGAATTTATTCATCGCTCTCA
ACTTCGTTGCTGTATTTAATATTACGTTACAGTATAGCTCATTCATAAGG
CGCATATTACATTATATTTATTACGTACTTTCTATATTAATATACTGGGC
CCTTAAGCCTAGTGAAAAGAAAAGTGGGAAGCCAGTTACTTTGCTAGCCG
GTTACATTCATAAAAATGAGAATTTAGAAGTAAAGACGTTTTGTATTTTA
TCTTAAATTAGCCTAGCCTAGGCTAGTATTTGTTTACAATCATAATATCT
CACTCATTATAATACTTCAAGCGTTCTAATTTGTACCATTGGATTTTACT
TAAATTAGCGCATATATATATATGCTAGGCTAACGTTGTTAACATACATT
TAAAGGGTATTTAAGGTGTCTCAATTTGAAATTGAAAAACCAATATTAGG
TCTAAAAATGACACGTTTTTCTAATCGAAATTCCACTAATGTGACTTGAA
ATAATAAATTTTAACTATTTTAATTAAGTTATTTTATCAAAGTGACCTAA
ATCATTTTTTTCTTATTTAATTAAATTTTATTAAATTTACTACTTTAAAA
GTGGGGCTCTCATTATTTTGACAAATTATTTTGCGAACTGTAATTTTTCT
GTATGTTATACTTTATTTGTAAATTTTTTAAACGAACAACATATAATACT
CGATTAAATAAATTATTCTAATGTTTTTTTAATATTTAATTCTGCTAGCA
TGACAAAGTATTGTGCAGATTTGGGGATAAATTTTTTATTAAATTTCAAT
TACCGAATGACATATTGTTTCGCATGTACATATCATATATGAAATAAAAA
TCAAAAGAAGTTTTGTTAATATTTTAACATTAAAACGTTTATGTGCATTA
AAAATTCTATCACCAGAGGCAGTATGAATAAATTAAGTAGTACAATAATT
TTTCTGTATCTATATATTTATGCAAAATTGTAGCTCGGAGATTTTAGAAT
AGATTTTTAGAGTTTAATAAATTGAAATTTGAAATGCAATATATTATTAT
TTAAATAAAATAATTAAACTTAGTTGATATTAGATGTTTTCCTGTTGAAA
ATAATGTTTTTAGTTTATAATCGAAACGCCCATCACTTTTGTTTAAATAT
CATATTACAATCATTTCGTATTAATCACCACTTTAAATTCTCCAGAAATG
ACGTCTAAGATCTTGAACGAAAATGTCTTCTGGCAGAAAAAGCATGTGAG
TCGAATAAAACGAGGAGAAATTTTGGGCGAAGGAAGTTTCAGAGGATGTA
CAATTTGGTTTACTGGTCTTTCCGGGGCTGGTAAAACAACACTAGCCTTT
CATTTGGAACATTTCCTGGTTGCCCACGGAATCCCGTCTTATTCATTGGA
TGGAGATAATGTTAGAACAGGTCTCAACCAGAATTTAGGTTTTACTGCTG
AAGACAGAGAGGAAAATATTCGTCGGATTGCTGAAGTTGCTAAATTGTTT
TCTGACGGGGGCATAGTTTGTTTAACTTCATTCATTTCACCATTTGAAAA
GAACCGTCAGCAGGCTCGAGAGCTTCATAGTATATCAGGTCTTCCATTTT
TTGAAGTATTTATCGACACACCAATTGAAATTTGTGAAGAACGAGATGTT
AAAGGACTTTATAAAAAGGCTCGAGCTGGTGAAATAAAACATTTTACCGG
GGTTGATAGTGCTTATGAACCTCCTAAAAATCCTGATCTCGTACTGAAAG
CTGGAGAAAAATCTGTTTACGAATGTGTTGATATTCTTGTTGAATTCTTG
AGGCAAAAAGATATTTTGACAGATTCCATAATGATGAAATATTCAGAATT
GTACGTTCCGGAAAATATATTAGATCAAGCACGTTCAGAGGCTAGCAACT
TACCTAGAATAAATATTAAAACTATAGATTGTCAATGGTTGCAAGTTCTT
TGTGAAGGTTGGGCAAGTCCATTAACTGGCTTTATGAAAGAAAGAGAATT
CCTACAATGTATACACTTTAACAGTTTAAACAAAGGATTATACAGTCAAA
GTATCCCAATTGTACTTCCTATCAACGAGGAAGACAAAACAGCGATTAGC
AACCATCCGGCAATCGCTCTTTGCTATGATAACAGAATCGTCTCGATTAT
TAGAAACCCAGAAATATACAAGCATAGAAAGGAAGAACGCTGCGCAAGGA
CTTTTGGATTTGTCGATAAACGTCATCCTTCGATCAAAATGATTTTTGAA
TCGGGCGACTTTTTGCTTGGTGGTGACATTGAAGTTCTTGAACGTTTTCA
TTGGAATGACAATCTTGACAAATATCGATACACTCCAAAACAGATTCGAC
AAAAAATGAAAGAAATGAACGCAGACACAATCTTTGCTTTTCAACTTAGA
AATCCTATACATAATGGCCATGCATTGTTAATGCAAGATGCTCGAAGAAA
ACTCATAGAAATGGGGTACAAGAACCCAGTCTTGTTGCTTCATCCATTGG
GTGGATGGACAAAAGACGACGATGTTCCTTTGAATGTGAGAATAAAACAG
CATGAATCTGTTTTGGATTCAGGAGTCTTGGATCGAAATTCAACAATTCT
TGCCATATTTCCATCGCCTATGATTTACGCTGGTCCTACTGAGGTTCAAT
GGCATGCCAAGGCCAGAATGGCTGCAGGTGTAAATTATTATATTGTTGGA
CGTGATCCAGCTGGCATTCCACATCCAGAAACAAAAGAGGATCTTTACGA
TCCTTTCCATGGAGCGGAAGTTCTTTCTATGGCTCCCGGACTGACAAAGT
TGGAGATCATTCCATTTAAAGTTGCTGCCTATGATAAATTGAACAAAAGA
ATGGATTATTTTGATCCGAACCGTAAAGATGATTTTATTTTCATATCGGG
TACAAAAATGCGAAATTTAGCGAAAAATAACGAATGTCCACCCGATGGCT
TCATGGTGCCAGCCGCATGGGAAATATTAAGGGATTATTATCAAAATCTG
AACAATACTTGACTAATTTTCCGAAGTCCTTCCAAATATGAATTGTGATT
GTGGTATTTTGTTAGGAAATTTTTATAAATTGTGAATTGTCTAA
back to top

protein sequence of SMED30027968-orf-1

>SMED30027968-orf-1 ID=SMED30027968-orf-1|Name=SMED30027968-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=605bp
MTSKILNENVFWQKKHVSRIKRGEILGEGSFRGCTIWFTGLSGAGKTTLA
FHLEHFLVAHGIPSYSLDGDNVRTGLNQNLGFTAEDREENIRRIAEVAKL
FSDGGIVCLTSFISPFEKNRQQARELHSISGLPFFEVFIDTPIEICEERD
VKGLYKKARAGEIKHFTGVDSAYEPPKNPDLVLKAGEKSVYECVDILVEF
LRQKDILTDSIMMKYSELYVPENILDQARSEASNLPRINIKTIDCQWLQV
LCEGWASPLTGFMKEREFLQCIHFNSLNKGLYSQSIPIVLPINEEDKTAI
SNHPAIALCYDNRIVSIIRNPEIYKHRKEERCARTFGFVDKRHPSIKMIF
ESGDFLLGGDIEVLERFHWNDNLDKYRYTPKQIRQKMKEMNADTIFAFQL
RNPIHNGHALLMQDARRKLIEMGYKNPVLLLHPLGGWTKDDDVPLNVRIK
QHESVLDSGVLDRNSTILAIFPSPMIYAGPTEVQWHAKARMAAGVNYYIV
GRDPAGIPHPETKEDLYDPFHGAEVLSMAPGLTKLEIIPFKVAAYDKLNK
RMDYFDPNRKDDFIFISGTKMRNLAKNNECPPDGFMVPAAWEILRDYYQN
LNNT*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002032epidermal cell
PLANA:0002075pigment cell
PLANA:0003116parenchymal cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR002650Sulphate_adenylyltransferase
IPR002891APS_kinase
IPR024951Sulfurylase_cat_dom
IPR025980ATP-Sase_PUA-like_dom
IPR014729Rossmann-like_a/b/a_fold
IPR027417P-loop_NTPase
IPR015947PUA-like_sf
Vocabulary: molecular function
TermDefinition
GO:0004781sulfate adenylyltransferase (ATP) activity
GO:0000166nucleotide binding
GO:0003824catalytic activity
GO:0004020adenylylsulfate kinase activity
GO:0005524ATP binding
GO:0016301kinase activity
GO:0016740transferase activity
GO:0016779nucleotidyltransferase activity
Vocabulary: biological process
TermDefinition
GO:0000103sulfate assimilation
GO:0001501skeletal system development
GO:0007596blood coagulation
GO:0008152metabolic process
GO:0016310phosphorylation
GO:00504283'-phosphoadenosine 5'-phosphosulfate biosynthetic process
GO:0060348bone development
Vocabulary: cellular component
TermDefinition
GO:0005829cytosol
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR014729Rossmann-like alpha/beta/alpha sandwich foldGENE3DG3DSA:3.40.50.620coord: 371..604
e-value: 2.7E-101
score: 339.8
IPR002650Sulphate adenylyltransferaseTIGRFAMTIGR00339TIGR00339coord: 224..596
e-value: 2.7E-111
score: 370.0
IPR002650Sulphate adenylyltransferaseCDDcd00517ATPScoord: 235..597
e-value: 2.97828E-160
score: 460.561
IPR025980ATP-sulfurylase PUA-like domainPFAMPF14306PUA_2coord: 216..365
e-value: 1.6E-44
score: 151.4
IPR002891Adenylyl-sulfate kinaseTIGRFAMTIGR00455TIGR00455coord: 31..201
e-value: 3.0E-71
score: 236.8
IPR002891Adenylyl-sulfate kinaseCDDcd02027APSKcoord: 35..184
e-value: 1.00483E-95
score: 287.452
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 6..211
e-value: 1.8E-80
score: 271.6
NoneNo IPR availableGENE3DG3DSA:3.10.400.10coord: 214..370
e-value: 3.3E-60
score: 204.0
NoneNo IPR availablePFAMPF01583APS_kinasecoord: 32..189
e-value: 4.2E-71
score: 237.9
NoneNo IPR availablePANTHERPTHR11055:SF16BIFUNCTIONAL 3'-PHOSPHOADENOSINE 5'-PHOSPHOSULFATE SYNTHASE 2coord: 8..603
NoneNo IPR availablePANTHERPTHR11055ADENYLSULFATE KINASE/SULFATE ADENYLTRANSFERASEcoord: 8..603
NoneNo IPR availableSUPERFAMILYSSF52374Nucleotidylyl transferasecoord: 375..598
IPR024951Sulphate adenylyltransferase catalytic domainPFAMPF01747ATP-sulfurylasecoord: 374..596
e-value: 4.6E-68
score: 228.9
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 31..204
IPR015947PUA-like superfamilySUPERFAMILYSSF88697PUA domain-likecoord: 216..369