DUF3421 domain-containing protein

Overview
NameDUF3421 domain-containing protein
Smed IDSMED30027962
Length (bp)771
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027962

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
testis primordiumSMED30027962SMESG000069900.1 Contig6028_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of DUF3421 domain-containing protein vs. TrEMBL
Match: Q5DGU2 (SJCHGC03760 protein OS=Schistosoma japonicum OX=6182 GN=EWB00_003363 PE=2 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 6.381e-13
Identity = 55/180 (30.56%), Postives = 87/180 (48.33%), Query Frame = 1
Query:   76 MSHVFNGIQINLSWVPADLNSIPENAIKVDDKVFVIRLTRADGTKIGSSMSSLAVIPWNDKFSILTYGG-------FEVLTYTGISEFGENYKWTKCVNGEVPVRKNAVLGGITDANDVMYVIKAPLVYDIADGGKKVIYSAGSLVEGANCATIPVLFSSSSPNDWPCVKVTEYEVLCFK 594
            M+   +G+QI+LSW+P      PENAI V D ++V+R      ++  + M    +IP N+     +YGG       +EVL  T ++E G+ Y+W K  NG  P  K+A++ G+      +Y+ +  +   I           G + EG  CA +P     +S        V+EYEVL +K
Sbjct:    1 MAKFGDGVQISLSWIPQCNGKYPENAITVGDNIYVVR------SRFINEMLPGMLIP-NEGKCHCSYGGNEMEFTEYEVLCDTSLNELGKGYEWVKSSNGGHP--KHAIIAGLASDGKPLYIARGYVDNKIC---------VGKVHEGHKCAYMPCGGLENS--------VSEYEVLVWK 154          
BLAST of DUF3421 domain-containing protein vs. TrEMBL
Match: A0A4Z2D8L7 (DUF3421 domain-containing protein OS=Schistosoma japonicum OX=6182 GN=EWB00_003363 PE=4 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 9.200e-13
Identity = 55/180 (30.56%), Postives = 87/180 (48.33%), Query Frame = 1
Query:   76 MSHVFNGIQINLSWVPADLNSIPENAIKVDDKVFVIRLTRADGTKIGSSMSSLAVIPWNDKFSILTYGG-------FEVLTYTGISEFGENYKWTKCVNGEVPVRKNAVLGGITDANDVMYVIKAPLVYDIADGGKKVIYSAGSLVEGANCATIPVLFSSSSPNDWPCVKVTEYEVLCFK 594
            M+   +G+QI+LSW+P      PENAI V D ++V+R      ++  + M    +IP N+     +YGG       +EVL  T ++E G+ Y+W K  NG  P  K+A++ G+      +Y+ +  +   I           G + EG  CA +P     +S        V+EYEVL +K
Sbjct:   11 MAKFGDGVQISLSWIPQCNGKYPENAITVGDNIYVVR------SRFINEMLPGMLIP-NEGKCHCSYGGNEMEFTEYEVLCDTSLNELGKGYEWVKSSNGGHP--KHAIIAGLASDGKPLYIARGYVDNKIC---------VGKVHEGHKCAYMPCGGLENS--------VSEYEVLVWK 164          
BLAST of DUF3421 domain-containing protein vs. TrEMBL
Match: A0A183LEQ6 (DUF3421 domain-containing protein OS=Schistosoma margrebowiei OX=48269 GN=SMRZ_LOCUS2281 PE=4 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 1.219e-12
Identity = 50/150 (33.33%), Postives = 75/150 (50.00%), Query Frame = 1
Query:   76 MSHVFNGIQINLSWVPADLNSIPENAIKVDDKVFVIRLTRADGTKIG--SSMSSLAVIPWNDKFSILTYGGFEVLTYTGISEFGENYKWTKCVNGEVPVRKNAVLGGITDANDVMYVIKAPLVYDIADGGKKVIYSAGSLVEGANCATIP 519
            M+ V NG+QI LSW+PA    +P+NA+K D+ +FV R    D    G  S     A IP + K   L +  +EVL  TGI      Y+W     G+VP  +NA++ GI      +Y++KA +  ++         S G L++G +    P
Sbjct:    1 MARVSNGLQIPLSWIPAKDGILPKNAVKADESIFVARCQIDDNLICGKFSEKYGKAYIPLDGKE--LEFTNYEVLCNTGIPGCRIGYEWIMMNGGDVP--ENALVAGINKFGTPLYIVKARIEGEV---------SVGKLIQGESSGCFP 137          
BLAST of DUF3421 domain-containing protein vs. TrEMBL
Match: A0A183K9P0 (DUF3421 domain-containing protein OS=Schistosoma curassoni OX=6186 GN=SCUD_LOCUS11723 PE=4 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 1.845e-12
Identity = 50/155 (32.26%), Postives = 73/155 (47.10%), Query Frame = 1
Query:   76 MSHVFNGIQINLSWVPADLNSIPENAIKVDDKVFVIRLTRADGTKIGSSMSSLAVIPWNDKFSILTYGG-------FEVLTYTGISEFGENYKWTKCVNGEVPVRKNAVLGGITDANDVMYVIKAPLVYDIADGGKKVIYSAGSLVEGANCATIP 519
            M+ +  G+QI LSW+P      PENAI V D VFV+R      ++  + M    ++P   K    ++GG       +EVL  T + E G+ Y+W K   GE P  K A++ GI      +YV K  +  ++           G L EG  CA +P
Sbjct:    1 MAKIGKGVQIPLSWIPQSHGKYPENAISVGDGVFVVR------SRFLNEMLPGKLVPKEGK-CYCSHGGEEIELTEYEVLCDTSLYELGKGYEWVKSSGGEYP--KRAIIAGIGSDGKPLYVAKGYVENNVC---------VGKLHEGHVCAYMP 137          
BLAST of DUF3421 domain-containing protein vs. TrEMBL
Match: A0A094ZJL1 (DUF3421 domain-containing protein (Fragment) OS=Schistosoma haematobium OX=6185 GN=MS3_02356 PE=4 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 2.836e-12
Identity = 49/150 (32.67%), Postives = 75/150 (50.00%), Query Frame = 1
Query:   76 MSHVFNGIQINLSWVPADLNSIPENAIKVDDKVFVIRLTRADGTKIG--SSMSSLAVIPWNDKFSILTYGGFEVLTYTGISEFGENYKWTKCVNGEVPVRKNAVLGGITDANDVMYVIKAPLVYDIADGGKKVIYSAGSLVEGANCATIP 519
            M+ V NG+QI LSW+PA    +P+NA+K D+ ++V R    D    G  S     A IP + K   L +  +EVL  TGI      Y+W     G+VP  +NA++ GI      +Y++KA +  ++         S G L++G +    P
Sbjct:    1 MARVSNGLQIPLSWIPAKDGILPKNAVKADEAIYVARCQMDDDLICGKFSEKYGKAYIPLDGKE--LEFTNYEVLCNTGIPGCRVGYEWIMMNGGDVP--ENALVAGINKFGTPLYIVKAVIEGEV---------SVGKLIQGESSGCFP 137          
BLAST of DUF3421 domain-containing protein vs. Planmine SMEST
Match: SMESG000069900.1 (SMESG000069900.1)

HSP 1 Score: 367.851 bits (943), Expect = 6.161e-131
Identity = 179/179 (100.00%), Postives = 179/179 (100.00%), Query Frame = 1
Query:   76 MSHVFNGIQINLSWVPADLNSIPENAIKVDDKVFVIRLTRADGTKIGSSMSSLAVIPWNDKFSILTYGGFEVLTYTGISEFGENYKWTKCVNGEVPVRKNAVLGGITDANDVMYVIKAPLVYDIADGGKKVIYSAGSLVEGANCATIPVLFSSSSPNDWPCVKVTEYEVLCFKNARCHY 612
            MSHVFNGIQINLSWVPADLNSIPENAIKVDDKVFVIRLTRADGTKIGSSMSSLAVIPWNDKFSILTYGGFEVLTYTGISEFGENYKWTKCVNGEVPVRKNAVLGGITDANDVMYVIKAPLVYDIADGGKKVIYSAGSLVEGANCATIPVLFSSSSPNDWPCVKVTEYEVLCFKNARCHY
Sbjct:    1 MSHVFNGIQINLSWVPADLNSIPENAIKVDDKVFVIRLTRADGTKIGSSMSSLAVIPWNDKFSILTYGGFEVLTYTGISEFGENYKWTKCVNGEVPVRKNAVLGGITDANDVMYVIKAPLVYDIADGGKKVIYSAGSLVEGANCATIPVLFSSSSPNDWPCVKVTEYEVLCFKNARCHY 179          
BLAST of DUF3421 domain-containing protein vs. Planmine SMEST
Match: SMESG000046710.1 (SMESG000046710.1)

HSP 1 Score: 82.8037 bits (203), Expect = 1.622e-19
Identity = 59/180 (32.78%), Postives = 83/180 (46.11%), Query Frame = 1
Query:   76 MSHVFNGIQINLSWVPADLNSIPENAIKVDDKVFVIRLTRADG------TKIGSSMSSLAVIPWNDKFSILTYGGFEVLTYTGISEFGENYKWTKCVNGEVPVRKNAVLGGITDANDVMYVIKAPLVYDIADGGKKVIYSAGSLVEGANCATIPVLFSSSSPNDWPCVKVTEYEVLCFKN 597
            MS   +G Q +LSW P     +P NAI+ D  ++++R TR  G      TK+G +          D  S      +EVL  TG+  FG  + W    NG VP   NAV+GG T +N+ +Y+ KA +  ++  G  KV  S G       CA +P   +          K   YEVLCF +
Sbjct:    1 MSRAGSGRQASLSWQPGQYGQVPYNAIQADAGLYIVR-TRTGGDLTIGKTKVGHNSGYFPYAGREDSIS-----NYEVLCDTGLHVFGGEHHWQHMANGSVP--HNAVVGGHTASNEPLYIAKARINGEMCVG--KVCQSHG-------CAFMPYGGAEH--------KAHHYEVLCFSD 155          
BLAST of DUF3421 domain-containing protein vs. Planmine SMEST
Match: SMESG000046697.1 (SMESG000046697.1)

HSP 1 Score: 82.8037 bits (203), Expect = 1.622e-19
Identity = 59/180 (32.78%), Postives = 83/180 (46.11%), Query Frame = 1
Query:   76 MSHVFNGIQINLSWVPADLNSIPENAIKVDDKVFVIRLTRADG------TKIGSSMSSLAVIPWNDKFSILTYGGFEVLTYTGISEFGENYKWTKCVNGEVPVRKNAVLGGITDANDVMYVIKAPLVYDIADGGKKVIYSAGSLVEGANCATIPVLFSSSSPNDWPCVKVTEYEVLCFKN 597
            MS   +G Q +LSW P     +P NAI+ D  ++++R TR  G      TK+G +          D  S      +EVL  TG+  FG  + W    NG VP   NAV+GG T +N+ +Y+ KA +  ++  G  KV  S G       CA +P   +          K   YEVLCF +
Sbjct:    1 MSRAGSGRQASLSWQPGQYGQVPYNAIQADAGLYIVR-TRTGGDLTIGKTKVGHNSGYFPYAGREDSIS-----NYEVLCDTGLHVFGGEHHWQHMANGSVP--HNAVVGGHTASNEPLYIAKARINGEMCVG--KVCQSHG-------CAFMPYGGAEH--------KAHHYEVLCFSD 155          
BLAST of DUF3421 domain-containing protein vs. Planmine SMEST
Match: SMESG000057816.1 (SMESG000057816.1)

HSP 1 Score: 75.485 bits (184), Expect = 9.434e-17
Identity = 50/180 (27.78%), Postives = 83/180 (46.11%), Query Frame = 1
Query:   76 MSHVFNGIQINLSWVPADLNSIPENAIKVDDKVFVIRLTRADG------TKIGSSMSSLAVIPWNDKFSILTYGGFEVLTYTGISEFGENYKWTKCVNGEVPVRKNAVLGGITDANDVMYVIKAPLVYDIADGGKKVIYSAGSLVEGANCATIPVLFSSSSPNDWPCVKVTEYEVLCFKN 597
            MS    G QI+LSW+P +   +P NA++ D  ++++R  R DG      TK+G         P+  +  ++    +EVL  TG+  +G  + W    NG VP   NAV+GG T   + +Y+ +A +  ++           G +     C  +P              KV +YEVLC+++
Sbjct:    1 MSRAGTGRQISLSWLPGEYGQVPPNAVQADPGLYIVR-ARTDGDVTVGKTKVGHQS---GFFPYAGREDMVPR--YEVLCDTGLHVWGSEFHWQYMGNGAVP--HNAVVGGHTSTYEPLYIARARIHGEMC---------VGKVANSHKCGFMPYGGKEH--------KVYKYEVLCYRD 155          
BLAST of DUF3421 domain-containing protein vs. Planmine SMEST
Match: SMESG000046742.1 (SMESG000046742.1)

HSP 1 Score: 67.781 bits (164), Expect = 5.529e-14
Identity = 52/179 (29.05%), Postives = 80/179 (44.69%), Query Frame = 1
Query:   76 MSHVFNGIQINLSWVPADLNSIPENAIKVDDKVFVIRL-TRADGT----KIGSSMSSLAVIPWNDKFSILTYGGFEVLTYTGISEFGENYKWTKCVNGEVPVRKNAVLGGITDANDVMYVIKAPLVYDIADGGKKVIYSAGSLVEGANCATIPVLFSSSSPNDWPCVKVTEYEVLCFKN 597
            M  V +G Q +LSW P +   +P NAI+ D  +F+ R  T  D T    K+G +    +     +  S      +EVL  TG+  FG    W    NG VP   NA++GG T +N+ +Y+ +A +  D+           G + +   CA +P              ++  YEVLC+ N
Sbjct:    1 MCSVGSGRQASLSWQPGNNGQVPYNAIQADGGLFIGRARTGGDVTPGKLKVGYNTGYFSYAGKEECIS-----NYEVLCDTGLHVFGPETIWIHMSNGCVP--PNALVGGHTSSNEPLYIGRARISGDMC---------VGKICQSHGCAYMPYGGQEH--------RINNYEVLCYSN 155          
The following BLAST results are available for this feature:
BLAST of DUF3421 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF3421 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF3421 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF3421 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF3421 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF3421 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF3421 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF3421 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
Q5DGU26.381e-1330.56SJCHGC03760 protein OS=Schistosoma japonicum OX=61... [more]
A0A4Z2D8L79.200e-1330.56DUF3421 domain-containing protein OS=Schistosoma j... [more]
A0A183LEQ61.219e-1233.33DUF3421 domain-containing protein OS=Schistosoma m... [more]
A0A183K9P01.845e-1232.26DUF3421 domain-containing protein OS=Schistosoma c... [more]
A0A094ZJL12.836e-1232.67DUF3421 domain-containing protein (Fragment) OS=Sc... [more]
back to top
BLAST of DUF3421 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF3421 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF3421 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF3421 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF3421 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF3421 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000069900.16.161e-131100.00SMESG000069900.1[more]
SMESG000046710.11.622e-1932.78SMESG000046710.1[more]
SMESG000046697.11.622e-1932.78SMESG000046697.1[more]
SMESG000057816.19.434e-1727.78SMESG000057816.1[more]
SMESG000046742.15.529e-1429.05SMESG000046742.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027962 ID=SMED30027962|Name=DUF3421 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=771bp
ATTTATATATAAAATAACAGACCATACAATAGTGAAGAATAAATGAAATT
GAAGATCTAACATCAAGAATTGAAAATGTCGCATGTTTTCAATGGTATTC
AAATAAATCTTTCCTGGGTGCCTGCTGATTTGAATAGTATCCCGGAAAAT
GCCATTAAAGTTGATGACAAGGTTTTTGTTATCCGATTAACTCGAGCCGA
CGGAACCAAAATAGGCTCAAGCATGTCTTCATTAGCGGTTATTCCGTGGA
ATGACAAGTTCAGCATTTTAACCTATGGTGGCTTTGAAGTCTTAACCTAT
ACTGGTATAAGTGAATTCGGTGAAAATTACAAATGGACAAAATGCGTTAA
TGGCGAAGTGCCTGTGAGAAAGAATGCTGTATTAGGAGGAATCACAGATG
CGAATGATGTAATGTACGTGATAAAGGCACCTCTTGTCTATGACATAGCC
GATGGAGGAAAGAAAGTAATCTATTCAGCCGGTTCATTGGTTGAAGGAGC
TAATTGCGCAACGATACCCGTTCTATTTTCTTCAAGTTCACCAAATGACT
GGCCATGTGTAAAAGTTACAGAATATGAAGTTTTGTGTTTTAAAAATGCA
AGATGCCATTACTAGAAAGGCACCATAATAATATTAGTAAAATAATACAC
AATAATTAGAATGAAATTCCTCCCATTTAAATCTATTTCAATTTACTTAG
CATGCATTTAATTTTCTTCATTATATTGTAATAAGCGCTAATTTTTATTT
CCTATTTCAATTAAAATATTC
back to top

protein sequence of SMED30027962-orf-1

>SMED30027962-orf-1 ID=SMED30027962-orf-1|Name=SMED30027962-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=180bp
MSHVFNGIQINLSWVPADLNSIPENAIKVDDKVFVIRLTRADGTKIGSSM
SSLAVIPWNDKFSILTYGGFEVLTYTGISEFGENYKWTKCVNGEVPVRKN
AVLGGITDANDVMYVIKAPLVYDIADGGKKVIYSAGSLVEGANCATIPVL
FSSSSPNDWPCVKVTEYEVLCFKNARCHY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003304testis primordium
Vocabulary: INTERPRO
TermDefinition
IPR024518DUF3421
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR024518Domain of unknown function DUF3421PFAMPF11901DUF3421coord: 31..118
e-value: 1.6E-6
score: 28.0