SMED30027961

Overview
NameSMED30027961
Smed IDSMED30027961
Length (bp)1985
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30027961 (SMED30027961) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30027961 (SMED30027961) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30027961 (SMED30027961) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30027961 (SMED30027961) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027961

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30027961h1SMcG0003654 SmedASXL_074614SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
epidermisSMED30027961h1SMcG0003654 dd_Smed_v4_15477_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30027961h1SMcG0003654 dd_Smed_v4_15477_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior sideSMED30027961h1SMcG0003654 dd_Smed_v4_4658_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30027961h1SMcG0003654 dd_Smed_v4_4658_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30027961 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.012114:785..2866 -9551
Homology
BLAST of SMED30027961 vs. Ensembl Human
Match: PRPSAP1 (phosphoribosyl pyrophosphate synthetase associated protein 1 [Source:HGNC Symbol;Acc:HGNC:9466])

HSP 1 Score: 167.162 bits (422), Expect = 2.470e-46
Identity = 88/136 (64.71%), Postives = 116/136 (85.29%), Query Frame = -2
Query:  143 SLHVGFDMLPMMLAKEKPPLTVVGDVSGHIAXXXXXXXXXXDQFVTAAELLHERVYFY*VFVMATHGLLSSDAPRKLEDSLIDEIIVTNTVPHHIQKMQCHKIKTVDVTMLIAEAIRRIHNNESMSYLFMNIPKDD 550
            ++H G + LP+M+AKEKPP+TVVGDV G IAII+DDIIDDV+ FV AAE+L ER   Y ++VMATHG+LS++APR +E+S +DE++VTNTVPH +QK+QC KIKTVD++++++EAIRRIHN ESM+YLF NI  DD
Sbjct:  149 TVHPGLE-LPLMMAKEKPPITVVGDVGGRIAIIVDDIIDDVESFVAAAEILKER-GAYKIYVMATHGILSAEAPRLIEESSVDEVVVTNTVPHEVQKLQCPKIKTVDISLILSEAIRRIHNGESMAYLFRNITVDD 282          
BLAST of SMED30027961 vs. Ensembl Human
Match: PRPSAP2 (phosphoribosyl pyrophosphate synthetase associated protein 2 [Source:HGNC Symbol;Acc:HGNC:9467])

HSP 1 Score: 166.007 bits (419), Expect = 7.123e-46
Identity = 90/128 (70.31%), Postives = 110/128 (85.94%), Query Frame = -2
Query:  143 LPMMLAKEKPPLTVVGDVSGHIAXXXXXXXXXXDQFVTAAELLHERVYFY*VFVMATHGLLSSDAPRKLEDSLIDEIIVTNTVPHHIQKMQCHKIKTVDVTMLIAEAIRRIHNNESMSYLFMNIPKDD 526
            +PM++ KEKPP+TVVGDV G IAII+DDIIDDVD F+ AAE L ER   Y +FVMATHGLLSSDAPR++E+S IDE++VTNT+PH +QK+QC KIKTVD++M+++EAIRRIHN ESMSYLF NI  DD
Sbjct:  157 IPMLIPKEKPPITVVGDVGGRIAIIVDDIIDDVDSFLAAAETLKER-GAYKIFVMATHGLLSSDAPRRIEESAIDEVVVTNTIPHEVQKLQCPKIKTVDISMILSEAIRRIHNGESMSYLFRNIGLDD 283          
BLAST of SMED30027961 vs. Ensembl Human
Match: PRPSAP2 (phosphoribosyl pyrophosphate synthetase associated protein 2 [Source:HGNC Symbol;Acc:HGNC:9467])

HSP 1 Score: 166.007 bits (419), Expect = 7.123e-46
Identity = 90/128 (70.31%), Postives = 110/128 (85.94%), Query Frame = -2
Query:  143 LPMMLAKEKPPLTVVGDVSGHIAXXXXXXXXXXDQFVTAAELLHERVYFY*VFVMATHGLLSSDAPRKLEDSLIDEIIVTNTVPHHIQKMQCHKIKTVDVTMLIAEAIRRIHNNESMSYLFMNIPKDD 526
            +PM++ KEKPP+TVVGDV G IAII+DDIIDDVD F+ AAE L ER   Y +FVMATHGLLSSDAPR++E+S IDE++VTNT+PH +QK+QC KIKTVD++M+++EAIRRIHN ESMSYLF NI  DD
Sbjct:  157 IPMLIPKEKPPITVVGDVGGRIAIIVDDIIDDVDSFLAAAETLKER-GAYKIFVMATHGLLSSDAPRRIEESAIDEVVVTNTIPHEVQKLQCPKIKTVDISMILSEAIRRIHNGESMSYLFRNIGLDD 283          
BLAST of SMED30027961 vs. Ensembl Human
Match: PRPSAP1 (phosphoribosyl pyrophosphate synthetase associated protein 1 [Source:HGNC Symbol;Acc:HGNC:9466])

HSP 1 Score: 168.703 bits (426), Expect = 8.432e-46
Identity = 88/136 (64.71%), Postives = 116/136 (85.29%), Query Frame = -2
Query:  143 SLHVGFDMLPMMLAKEKPPLTVVGDVSGHIAXXXXXXXXXXDQFVTAAELLHERVYFY*VFVMATHGLLSSDAPRKLEDSLIDEIIVTNTVPHHIQKMQCHKIKTVDVTMLIAEAIRRIHNNESMSYLFMNIPKDD 550
            ++H G + LP+M+AKEKPP+TVVGDV G IAII+DDIIDDV+ FV AAE+L ER   Y ++VMATHG+LS++APR +E+S +DE++VTNTVPH +QK+QC KIKTVD++++++EAIRRIHN ESM+YLF NI  DD
Sbjct:  252 TVHPGLE-LPLMMAKEKPPITVVGDVGGRIAIIVDDIIDDVESFVAAAEILKER-GAYKIYVMATHGILSAEAPRLIEESSVDEVVVTNTVPHEVQKLQCPKIKTVDISLILSEAIRRIHNGESMAYLFRNITVDD 385          
BLAST of SMED30027961 vs. Ensembl Human
Match: PRPSAP2 (phosphoribosyl pyrophosphate synthetase associated protein 2 [Source:HGNC Symbol;Acc:HGNC:9467])

HSP 1 Score: 166.007 bits (419), Expect = 1.884e-45
Identity = 90/128 (70.31%), Postives = 110/128 (85.94%), Query Frame = -2
Query:  143 LPMMLAKEKPPLTVVGDVSGHIAXXXXXXXXXXDQFVTAAELLHERVYFY*VFVMATHGLLSSDAPRKLEDSLIDEIIVTNTVPHHIQKMQCHKIKTVDVTMLIAEAIRRIHNNESMSYLFMNIPKDD 526
            +PM++ KEKPP+TVVGDV G IAII+DDIIDDVD F+ AAE L ER   Y +FVMATHGLLSSDAPR++E+S IDE++VTNT+PH +QK+QC KIKTVD++M+++EAIRRIHN ESMSYLF NI  DD
Sbjct:  203 IPMLIPKEKPPITVVGDVGGRIAIIVDDIIDDVDSFLAAAETLKER-GAYKIFVMATHGLLSSDAPRRIEESAIDEVVVTNTIPHEVQKLQCPKIKTVDISMILSEAIRRIHNGESMSYLFRNIGLDD 329          
BLAST of SMED30027961 vs. Ensembl Celegans
Match: W04G3.5 (pep chromosome:WBcel235:X:11073658:11076043:1 gene:WBGene00012258.1 transcript:W04G3.5a.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:W04G3.5)

HSP 1 Score: 149.058 bits (375), Expect = 1.906e-39
Identity = 83/131 (63.36%), Postives = 102/131 (77.86%), Query Frame = -2
Query:  143 FDMLPMMLAKEKPPLTVVGDVSGHIAXXXXXXXXXXDQFVTAAELLHERVYFY*VFVMATHGLLSSDAPRKLEDSLIDEIIVTNTVPHHIQKMQCHKIKTVDVTMLIAEAIRRIHNNESMSYLFMNIPKDD 535
            +D LP   +K+KPPLTVVGDV G IAI++DDIIDD   FV AAE+L  R   Y ++V+ATHG+LSSDAP  LE S I E+IVTNTVPH +QKM+CHKIKTVDV+++I EAIRRI +NESM  LF ++  DD
Sbjct:  224 YDFLPAQESKQKPPLTVVGDVGGRIAIMVDDIIDDAQSFVAAAEVLKAR-GAYKIYVIATHGVLSSDAPALLEASPITEVIVTNTVPHDLQKMRCHKIKTVDVSLMICEAIRRIFHNESMGQLFRDVTLDD 353          
BLAST of SMED30027961 vs. Ensembl Celegans
Match: W04G3.5 (pep chromosome:WBcel235:X:11073658:11075961:1 gene:WBGene00012258.1 transcript:W04G3.5a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:W04G3.5)

HSP 1 Score: 149.058 bits (375), Expect = 1.906e-39
Identity = 83/131 (63.36%), Postives = 102/131 (77.86%), Query Frame = -2
Query:  143 FDMLPMMLAKEKPPLTVVGDVSGHIAXXXXXXXXXXDQFVTAAELLHERVYFY*VFVMATHGLLSSDAPRKLEDSLIDEIIVTNTVPHHIQKMQCHKIKTVDVTMLIAEAIRRIHNNESMSYLFMNIPKDD 535
            +D LP   +K+KPPLTVVGDV G IAI++DDIIDD   FV AAE+L  R   Y ++V+ATHG+LSSDAP  LE S I E+IVTNTVPH +QKM+CHKIKTVDV+++I EAIRRI +NESM  LF ++  DD
Sbjct:  224 YDFLPAQESKQKPPLTVVGDVGGRIAIMVDDIIDDAQSFVAAAEVLKAR-GAYKIYVIATHGVLSSDAPALLEASPITEVIVTNTVPHDLQKMRCHKIKTVDVSLMICEAIRRIFHNESMGQLFRDVTLDD 353          
BLAST of SMED30027961 vs. Ensembl Celegans
Match: W04G3.5 (pep chromosome:WBcel235:X:11073658:11076043:1 gene:WBGene00012258.1 transcript:W04G3.5b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:W04G3.5)

HSP 1 Score: 149.058 bits (375), Expect = 1.968e-39
Identity = 83/131 (63.36%), Postives = 102/131 (77.86%), Query Frame = -2
Query:  143 FDMLPMMLAKEKPPLTVVGDVSGHIAXXXXXXXXXXDQFVTAAELLHERVYFY*VFVMATHGLLSSDAPRKLEDSLIDEIIVTNTVPHHIQKMQCHKIKTVDVTMLIAEAIRRIHNNESMSYLFMNIPKDD 535
            +D LP   +K+KPPLTVVGDV G IAI++DDIIDD   FV AAE+L  R   Y ++V+ATHG+LSSDAP  LE S I E+IVTNTVPH +QKM+CHKIKTVDV+++I EAIRRI +NESM  LF ++  DD
Sbjct:  225 YDFLPAQESKQKPPLTVVGDVGGRIAIMVDDIIDDAQSFVAAAEVLKAR-GAYKIYVIATHGVLSSDAPALLEASPITEVIVTNTVPHDLQKMRCHKIKTVDVSLMICEAIRRIFHNESMGQLFRDVTLDD 354          
BLAST of SMED30027961 vs. Ensembl Celegans
Match: R151.2 (pep chromosome:WBcel235:III:7213176:7215226:1 gene:WBGene00020107.1 transcript:R151.2c.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:R151.2)

HSP 1 Score: 82.4185 bits (202), Expect = 7.145e-17
Identity = 48/120 (40.00%), Postives = 72/120 (60.00%), Query Frame = -2
Query:  152 AKEKPPLTVVGDVSGHIAXXXXXXXXXXDQFVTAAELLHERVYFY*VFVMATHGLLSSDAPRKLEDSLIDEIIVTNTVPHHIQKMQCHKIKTVDVTMLIAEAIRRIHNNESMSYLFMNIP 511
            A E   +T+VG V G +AI++DD+ D       AA+ L E      V+    HG+ S  A  +L  S  + ++VTNT+P      +C KI+ +D++M++AEAIRR HN ES+SYLF ++P
Sbjct:  198 ANEVEKMTLVGSVEGKVAILVDDMADTCGTICMAADKLVEAGADK-VYAFCVHGIFSGPALTRLNASKFEAVVVTNTIPQDENMKKCSKIQCIDISMILAEAIRRTHNGESVSYLFSHVP 316          
BLAST of SMED30027961 vs. Ensembl Celegans
Match: R151.2 (pep chromosome:WBcel235:III:7211424:7215111:1 gene:WBGene00020107.1 transcript:R151.2b.4 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:R151.2)

HSP 1 Score: 82.4185 bits (202), Expect = 7.579e-17
Identity = 48/120 (40.00%), Postives = 72/120 (60.00%), Query Frame = -2
Query:  152 AKEKPPLTVVGDVSGHIAXXXXXXXXXXDQFVTAAELLHERVYFY*VFVMATHGLLSSDAPRKLEDSLIDEIIVTNTVPHHIQKMQCHKIKTVDVTMLIAEAIRRIHNNESMSYLFMNIP 511
            A E   +T+VG V G +AI++DD+ D       AA+ L E      V+    HG+ S  A  +L  S  + ++VTNT+P      +C KI+ +D++M++AEAIRR HN ES+SYLF ++P
Sbjct:  199 ANEVEKMTLVGSVEGKVAILVDDMADTCGTICMAADKLVEAGADK-VYAFCVHGIFSGPALTRLNASKFEAVVVTNTIPQDENMKKCSKIQCIDISMILAEAIRRTHNGESVSYLFSHVP 317          
BLAST of SMED30027961 vs. Ensembl Fly
Match: CG2246 (gene:FBgn0039790 transcript:FBtr0335445)

HSP 1 Score: 160.229 bits (404), Expect = 2.239e-43
Identity = 88/136 (64.71%), Postives = 111/136 (81.62%), Query Frame = -2
Query:  143 SLHVGFDMLPMMLAKEKPPLTVVGDVSGHIAXXXXXXXXXXDQFVTAAELLHERVYFY*VFVMATHGLLSSDAPRKLEDSLIDEIIVTNTVPHHIQKMQCHKIKTVDVTMLIAEAIRRIHNNESMSYLFMNIPKDD 550
            S+ VG   +P  + K KPPLT+VGDVSG IAI++DD+IDDV  FV AAE+L E      ++V+ATHGLLSSDAPR+L++S IDEI+VTNT+PH IQK+QCHKIKT+D+++LIAEAIRRIHN ESMSYLF N+  +D
Sbjct:  225 SVSVG---VPEHIVKVKPPLTIVGDVSGRIAIMVDDLIDDVQAFVAAAEMLKENGACK-IYVLATHGLLSSDAPRQLDESPIDEIVVTNTIPHEIQKLQCHKIKTIDISILIAEAIRRIHNKESMSYLFRNVTLED 356          
BLAST of SMED30027961 vs. Ensembl Fly
Match: CG2246 (gene:FBgn0039790 transcript:FBtr0302610)

HSP 1 Score: 160.229 bits (404), Expect = 3.699e-43
Identity = 88/136 (64.71%), Postives = 111/136 (81.62%), Query Frame = -2
Query:  143 SLHVGFDMLPMMLAKEKPPLTVVGDVSGHIAXXXXXXXXXXDQFVTAAELLHERVYFY*VFVMATHGLLSSDAPRKLEDSLIDEIIVTNTVPHHIQKMQCHKIKTVDVTMLIAEAIRRIHNNESMSYLFMNIPKDD 550
            S+ VG   +P  + K KPPLT+VGDVSG IAI++DD+IDDV  FV AAE+L E      ++V+ATHGLLSSDAPR+L++S IDEI+VTNT+PH IQK+QCHKIKT+D+++LIAEAIRRIHN ESMSYLF N+  +D
Sbjct:  236 SVSVG---VPEHIVKVKPPLTIVGDVSGRIAIMVDDLIDDVQAFVAAAEMLKENGACK-IYVLATHGLLSSDAPRQLDESPIDEIVVTNTIPHEIQKLQCHKIKTIDISILIAEAIRRIHNKESMSYLFRNVTLED 367          
BLAST of SMED30027961 vs. Ensembl Fly
Match: CG2246 (gene:FBgn0039790 transcript:FBtr0085677)

HSP 1 Score: 160.229 bits (404), Expect = 3.699e-43
Identity = 88/136 (64.71%), Postives = 111/136 (81.62%), Query Frame = -2
Query:  143 SLHVGFDMLPMMLAKEKPPLTVVGDVSGHIAXXXXXXXXXXDQFVTAAELLHERVYFY*VFVMATHGLLSSDAPRKLEDSLIDEIIVTNTVPHHIQKMQCHKIKTVDVTMLIAEAIRRIHNNESMSYLFMNIPKDD 550
            S+ VG   +P  + K KPPLT+VGDVSG IAI++DD+IDDV  FV AAE+L E      ++V+ATHGLLSSDAPR+L++S IDEI+VTNT+PH IQK+QCHKIKT+D+++LIAEAIRRIHN ESMSYLF N+  +D
Sbjct:  236 SVSVG---VPEHIVKVKPPLTIVGDVSGRIAIMVDDLIDDVQAFVAAAEMLKENGACK-IYVLATHGLLSSDAPRQLDESPIDEIVVTNTIPHEIQKLQCHKIKTIDISILIAEAIRRIHNKESMSYLFRNVTLED 367          
BLAST of SMED30027961 vs. Ensembl Fly
Match: CG2246 (gene:FBgn0039790 transcript:FBtr0302609)

HSP 1 Score: 160.229 bits (404), Expect = 3.699e-43
Identity = 88/136 (64.71%), Postives = 111/136 (81.62%), Query Frame = -2
Query:  143 SLHVGFDMLPMMLAKEKPPLTVVGDVSGHIAXXXXXXXXXXDQFVTAAELLHERVYFY*VFVMATHGLLSSDAPRKLEDSLIDEIIVTNTVPHHIQKMQCHKIKTVDVTMLIAEAIRRIHNNESMSYLFMNIPKDD 550
            S+ VG   +P  + K KPPLT+VGDVSG IAI++DD+IDDV  FV AAE+L E      ++V+ATHGLLSSDAPR+L++S IDEI+VTNT+PH IQK+QCHKIKT+D+++LIAEAIRRIHN ESMSYLF N+  +D
Sbjct:  236 SVSVG---VPEHIVKVKPPLTIVGDVSGRIAIMVDDLIDDVQAFVAAAEMLKENGACK-IYVLATHGLLSSDAPRQLDESPIDEIVVTNTIPHEIQKLQCHKIKTIDISILIAEAIRRIHNKESMSYLFRNVTLED 367          
BLAST of SMED30027961 vs. Ensembl Fly
Match: CG2246 (gene:FBgn0039790 transcript:FBtr0302608)

HSP 1 Score: 160.229 bits (404), Expect = 3.699e-43
Identity = 88/136 (64.71%), Postives = 111/136 (81.62%), Query Frame = -2
Query:  143 SLHVGFDMLPMMLAKEKPPLTVVGDVSGHIAXXXXXXXXXXDQFVTAAELLHERVYFY*VFVMATHGLLSSDAPRKLEDSLIDEIIVTNTVPHHIQKMQCHKIKTVDVTMLIAEAIRRIHNNESMSYLFMNIPKDD 550
            S+ VG   +P  + K KPPLT+VGDVSG IAI++DD+IDDV  FV AAE+L E      ++V+ATHGLLSSDAPR+L++S IDEI+VTNT+PH IQK+QCHKIKT+D+++LIAEAIRRIHN ESMSYLF N+  +D
Sbjct:  236 SVSVG---VPEHIVKVKPPLTIVGDVSGRIAIMVDDLIDDVQAFVAAAEMLKENGACK-IYVLATHGLLSSDAPRQLDESPIDEIVVTNTIPHEIQKLQCHKIKTIDISILIAEAIRRIHNKESMSYLFRNVTLED 367          
BLAST of SMED30027961 vs. Ensembl Zebrafish
Match: prpsap1 (phosphoribosyl pyrophosphate synthetase-associated protein 1 [Source:ZFIN;Acc:ZDB-GENE-040704-40])

HSP 1 Score: 166.777 bits (421), Expect = 7.333e-48
Identity = 92/134 (68.66%), Postives = 114/134 (85.07%), Query Frame = -2
Query:  143 HVGFDMLPMMLAKEKPPLTVVGDVSGHIAXXXXXXXXXXDQFVTAAELLHERVYFY*VFVMATHGLLSSDAPRKLEDSLIDEIIVTNTVPHHIQKMQCHKIKTVDVTMLIAEAIRRIHNNESMSYLFMNIPKDD 544
            H G + LP+M+AKEKPP+TVVGDV G IAII+DDIIDDV+ +V AAE+L ER   Y +++MATHGLLS+DAPR +E+S IDE++VTNTVPH +QK+QC KIKTVDV+M++AEAIRRIHN ESM+YLF NI  DD
Sbjct:   40 HPGLE-LPLMMAKEKPPITVVGDVGGRIAIIVDDIIDDVEDYVAAAEILKER-GAYKIYIMATHGLLSADAPRLIEESAIDEVVVTNTVPHEVQKLQCPKIKTVDVSMILAEAIRRIHNGESMAYLFRNITVDD 171          
BLAST of SMED30027961 vs. Ensembl Zebrafish
Match: prpsap2 (phosphoribosyl pyrophosphate synthetase-associated protein 2 [Source:ZFIN;Acc:ZDB-GENE-040426-2077])

HSP 1 Score: 163.31 bits (412), Expect = 2.635e-44
Identity = 89/128 (69.53%), Postives = 109/128 (85.16%), Query Frame = -2
Query:  143 LPMMLAKEKPPLTVVGDVSGHIAXXXXXXXXXXDQFVTAAELLHERVYFY*VFVMATHGLLSSDAPRKLEDSLIDEIIVTNTVPHHIQKMQCHKIKTVDVTMLIAEAIRRIHNNESMSYLFMNIPKDD 526
            +P+++ KEKPP+TVVGDV G IAII+DDIIDDVD F+ AAE L ER   Y +FVMATHG+LSSDAPR +E+S IDE++VTNT+PH IQK+QC KIKTVD++M+++EAIRRIHN ESMSYLF NI  DD
Sbjct:  231 IPLLIPKEKPPITVVGDVGGRIAIIVDDIIDDVDSFLAAAETLKER-GAYKIFVMATHGILSSDAPRLIEESAIDEVVVTNTIPHEIQKLQCPKIKTVDISMILSEAIRRIHNGESMSYLFRNIGMDD 357          
BLAST of SMED30027961 vs. Ensembl Zebrafish
Match: prps1a (phosphoribosyl pyrophosphate synthetase 1A [Source:ZFIN;Acc:ZDB-GENE-011212-5])

HSP 1 Score: 77.7962 bits (190), Expect = 3.703e-15
Identity = 45/120 (37.50%), Postives = 73/120 (60.83%), Query Frame = -2
Query:  152 AKEKPPLTVVGDVSGHIAXXXXXXXXXXDQFVTAAELLHERVYFY*VFVMATHGLLSSDAPRKLEDSLIDEIIVTNTVPHHIQKMQCHKIKTVDVTMLIAEAIRRIHNNESMSYLFMNIP 511
            A E   + +VGDV   +AI++DD+ D       AA+ L        V+ + THG+ S  A  ++ ++  + ++VTNT+P   +   C KI+ +D++M++AEAIRR HN ES+SYLF ++P
Sbjct:  199 ANEVDRMVLVGDVKDRVAILVDDMADTCGTVCHAADKLVSAGAIK-VYAILTHGIFSGPAISRINNANFEAVVVTNTIPQEDKIKHCSKIQVIDISMILAEAIRRTHNGESVSYLFSHVP 317          
BLAST of SMED30027961 vs. Ensembl Zebrafish
Match: prps1a (phosphoribosyl pyrophosphate synthetase 1A [Source:ZFIN;Acc:ZDB-GENE-011212-5])

HSP 1 Score: 77.7962 bits (190), Expect = 4.042e-15
Identity = 45/120 (37.50%), Postives = 73/120 (60.83%), Query Frame = -2
Query:  152 AKEKPPLTVVGDVSGHIAXXXXXXXXXXDQFVTAAELLHERVYFY*VFVMATHGLLSSDAPRKLEDSLIDEIIVTNTVPHHIQKMQCHKIKTVDVTMLIAEAIRRIHNNESMSYLFMNIP 511
            A E   + +VGDV   +AI++DD+ D       AA+ L        V+ + THG+ S  A  ++ ++  + ++VTNT+P   +   C KI+ +D++M++AEAIRR HN ES+SYLF ++P
Sbjct:  201 ANEVDRMVLVGDVKDRVAILVDDMADTCGTVCHAADKLVSAGAIK-VYAILTHGIFSGPAISRINNANFEAVVVTNTIPQEDKIKHCSKIQVIDISMILAEAIRRTHNGESVSYLFSHVP 319          
BLAST of SMED30027961 vs. Ensembl Zebrafish
Match: prps1b (phosphoribosyl pyrophosphate synthetase 1B [Source:ZFIN;Acc:ZDB-GENE-030131-4011])

HSP 1 Score: 77.7962 bits (190), Expect = 4.330e-15
Identity = 45/120 (37.50%), Postives = 73/120 (60.83%), Query Frame = -2
Query:  152 AKEKPPLTVVGDVSGHIAXXXXXXXXXXDQFVTAAELLHERVYFY*VFVMATHGLLSSDAPRKLEDSLIDEIIVTNTVPHHIQKMQCHKIKTVDVTMLIAEAIRRIHNNESMSYLFMNIP 511
            A E   + +VGDV   +AI++DD+ D       AA+ L        V+ + THG+ S  A  ++ ++  + ++VTNT+P   +   C KI+ +D++M++AEAIRR HN ES+SYLF ++P
Sbjct:  199 ANEVDRMVLVGDVKDRVAILVDDMADTCGTVCHAADKLISAGATK-VYAILTHGIFSGPAISRINNACFEAVVVTNTIPQEEKMKHCPKIQVIDISMILAEAIRRTHNGESVSYLFSHVP 317          
BLAST of SMED30027961 vs. Ensembl Xenopus
Match: rab10 (RAB10, member RAS oncogene family [Source:Xenbase;Acc:XB-GENE-5947409])

HSP 1 Score: 162.925 bits (411), Expect = 7.155e-44
Identity = 90/128 (70.31%), Postives = 108/128 (84.38%), Query Frame = -2
Query:  143 LPMMLAKEKPPLTVVGDVSGHIAXXXXXXXXXXDQFVTAAELLHERVYFY*VFVMATHGLLSSDAPRKLEDSLIDEIIVTNTVPHHIQKMQCHKIKTVDVTMLIAEAIRRIHNNESMSYLFMNIPKDD 526
            +P+M  KEKPP+TVVGDV G IAII+DDIIDDVD FV AA+ L ER   Y +FVMATHGLLSS+APR +E+S IDE++VTNT+PH IQK+QC KIKTVD++M+++EAIRRIHN ESMSYLF NI  DD
Sbjct:  245 IPLMFPKEKPPITVVGDVGGRIAIIVDDIIDDVDSFVAAADTLKER-GAYKIFVMATHGLLSSEAPRLIEESTIDEVVVTNTIPHEIQKLQCPKIKTVDISMILSEAIRRIHNGESMSYLFRNIGVDD 371          
BLAST of SMED30027961 vs. Ensembl Xenopus
Match: lmbrd2 (LMBR1 domain containing 2 [Source:Xenbase;Acc:XB-GENE-991215])

HSP 1 Score: 161.384 bits (407), Expect = 2.679e-43
Identity = 86/139 (61.87%), Postives = 113/139 (81.29%), Query Frame = -2
Query:  143 VFRSLHVGFDMLPMMLAKEKPPLTVVGDVSGHIAXXXXXXXXXXDQFVTAAELLHERVYFY*VFVMATHGLLSSDAPRKLEDSLIDEIIVTNTVPHHIQKMQCHKIKTVDVTMLIAEAIRRIHNNESMSYLFMNIPKDD 559
            V  ++H G + +P+M+ KEKPP+++VGDV G IAII+DDIID+V+ FV AA++L ER  F  V+ MATHG+LSSDAPR LE S IDE++VTNT+PH +QK QC KI+TVD++++++EAIRRIHN ESMSYLF NI  DD
Sbjct:  233 VKNTVHKGLE-IPLMMPKEKPPISLVGDVHGKIAIIVDDIIDEVESFVAAADILKERGAFK-VYAMATHGILSSDAPRLLELSAIDEVVVTNTIPHELQKQQCSKIRTVDISLILSEAIRRIHNGESMSYLFRNIALDD 369          
BLAST of SMED30027961 vs. Ensembl Xenopus
Match: lmbrd2 (LMBR1 domain containing 2 [Source:Xenbase;Acc:XB-GENE-991215])

HSP 1 Score: 160.999 bits (406), Expect = 2.822e-43
Identity = 86/139 (61.87%), Postives = 113/139 (81.29%), Query Frame = -2
Query:  143 VFRSLHVGFDMLPMMLAKEKPPLTVVGDVSGHIAXXXXXXXXXXDQFVTAAELLHERVYFY*VFVMATHGLLSSDAPRKLEDSLIDEIIVTNTVPHHIQKMQCHKIKTVDVTMLIAEAIRRIHNNESMSYLFMNIPKDD 559
            V  ++H G + +P+M+ KEKPP+++VGDV G IAII+DDIID+V+ FV AA++L ER  F  V+ MATHG+LSSDAPR LE S IDE++VTNT+PH +QK QC KI+TVD++++++EAIRRIHN ESMSYLF NI  DD
Sbjct:  227 VKNTVHKGLE-IPLMMPKEKPPISLVGDVHGKIAIIVDDIIDEVESFVAAADILKERGAFK-VYAMATHGILSSDAPRLLELSAIDEVVVTNTIPHELQKQQCSKIRTVDISLILSEAIRRIHNGESMSYLFRNIALDD 363          
BLAST of SMED30027961 vs. Ensembl Xenopus
Match: lmbrd2 (LMBR1 domain containing 2 [Source:Xenbase;Acc:XB-GENE-991215])

HSP 1 Score: 160.999 bits (406), Expect = 3.696e-43
Identity = 86/139 (61.87%), Postives = 113/139 (81.29%), Query Frame = -2
Query:  143 VFRSLHVGFDMLPMMLAKEKPPLTVVGDVSGHIAXXXXXXXXXXDQFVTAAELLHERVYFY*VFVMATHGLLSSDAPRKLEDSLIDEIIVTNTVPHHIQKMQCHKIKTVDVTMLIAEAIRRIHNNESMSYLFMNIPKDD 559
            V  ++H G + +P+M+ KEKPP+++VGDV G IAII+DDIID+V+ FV AA++L ER  F  V+ MATHG+LSSDAPR LE S IDE++VTNT+PH +QK QC KI+TVD++++++EAIRRIHN ESMSYLF NI  DD
Sbjct:  234 VKNTVHKGLE-IPLMMPKEKPPISLVGDVHGKIAIIVDDIIDEVESFVAAADILKERGAFK-VYAMATHGILSSDAPRLLELSAIDEVVVTNTIPHELQKQQCSKIRTVDISLILSEAIRRIHNGESMSYLFRNIALDD 370          
BLAST of SMED30027961 vs. Ensembl Xenopus
Match: lmbrd2 (LMBR1 domain containing 2 [Source:Xenbase;Acc:XB-GENE-991215])

HSP 1 Score: 160.999 bits (406), Expect = 1.359e-42
Identity = 85/128 (66.41%), Postives = 107/128 (83.59%), Query Frame = -2
Query:  143 LPMMLAKEKPPLTVVGDVSGHIAXXXXXXXXXXDQFVTAAELLHERVYFY*VFVMATHGLLSSDAPRKLEDSLIDEIIVTNTVPHHIQKMQCHKIKTVDVTMLIAEAIRRIHNNESMSYLFMNIPKDD 526
            LPMM+ KEKPP+++VGDV G IAII+DDIID+V+ FV AA++L ER  F  V+ MATHG+LSSDAPR LE S IDE++VTNT+PH +QK QC KI+TVD++++++EAIRRIHN ESMSYLF NI  DD
Sbjct:  311 LPMMMPKEKPPISLVGDVHGKIAIIVDDIIDEVESFVAAADILKERGAFK-VYAMATHGILSSDAPRLLELSAIDEVVVTNTIPHELQKQQCSKIRTVDISLILSEAIRRIHNGESMSYLFRNIALDD 437          
BLAST of SMED30027961 vs. Ensembl Mouse
Match: Prpsap1 (phosphoribosyl pyrophosphate synthetase-associated protein 1 [Source:MGI Symbol;Acc:MGI:1915013])

HSP 1 Score: 168.703 bits (426), Expect = 6.086e-46
Identity = 89/136 (65.44%), Postives = 116/136 (85.29%), Query Frame = -2
Query:  143 SLHVGFDMLPMMLAKEKPPLTVVGDVSGHIAXXXXXXXXXXDQFVTAAELLHERVYFY*VFVMATHGLLSSDAPRKLEDSLIDEIIVTNTVPHHIQKMQCHKIKTVDVTMLIAEAIRRIHNNESMSYLFMNIPKDD 550
            ++H G + LP+M+AKEKPP+TVVGDV G IAII+DDIIDDV+ FV AAE+L ER   Y ++VMATHG+LS++APR +E+S IDE++VTNTVPH +QK+QC KIKTVD++++++EAIRRIHN ESM+YLF NI  DD
Sbjct:  252 TVHPGLE-LPLMMAKEKPPITVVGDVGGRIAIIVDDIIDDVESFVAAAEILKER-GAYKIYVMATHGILSAEAPRLIEESPIDEVVVTNTVPHELQKLQCPKIKTVDISLILSEAIRRIHNGESMAYLFRNITVDD 385          
BLAST of SMED30027961 vs. Ensembl Mouse
Match: Prpsap2 (phosphoribosyl pyrophosphate synthetase-associated protein 2 [Source:MGI Symbol;Acc:MGI:2384838])

HSP 1 Score: 165.236 bits (417), Expect = 8.070e-45
Identity = 91/128 (71.09%), Postives = 109/128 (85.16%), Query Frame = -2
Query:  143 LPMMLAKEKPPLTVVGDVSGHIAXXXXXXXXXXDQFVTAAELLHERVYFY*VFVMATHGLLSSDAPRKLEDSLIDEIIVTNTVPHHIQKMQCHKIKTVDVTMLIAEAIRRIHNNESMSYLFMNIPKDD 526
            +PM++ KEKPP+TVVGDV G IAII+DDIIDDVD F+ AAE L ER   Y +FVMATHGLLSSDAPR +E+S IDE++VTNT+PH IQK+QC KIKTVD++M+++EAIRRIHN ESMSYLF NI  DD
Sbjct:  243 IPMLIPKEKPPITVVGDVGGRIAIIVDDIIDDVDSFLAAAETLKER-GAYKIFVMATHGLLSSDAPRLIEESAIDEVVVTNTIPHEIQKLQCPKIKTVDISMILSEAIRRIHNGESMSYLFRNIGLDD 369          
BLAST of SMED30027961 vs. Ensembl Mouse
Match: Prpsap2 (phosphoribosyl pyrophosphate synthetase-associated protein 2 [Source:MGI Symbol;Acc:MGI:2384838])

HSP 1 Score: 165.236 bits (417), Expect = 8.070e-45
Identity = 91/128 (71.09%), Postives = 109/128 (85.16%), Query Frame = -2
Query:  143 LPMMLAKEKPPLTVVGDVSGHIAXXXXXXXXXXDQFVTAAELLHERVYFY*VFVMATHGLLSSDAPRKLEDSLIDEIIVTNTVPHHIQKMQCHKIKTVDVTMLIAEAIRRIHNNESMSYLFMNIPKDD 526
            +PM++ KEKPP+TVVGDV G IAII+DDIIDDVD F+ AAE L ER   Y +FVMATHGLLSSDAPR +E+S IDE++VTNT+PH IQK+QC KIKTVD++M+++EAIRRIHN ESMSYLF NI  DD
Sbjct:  243 IPMLIPKEKPPITVVGDVGGRIAIIVDDIIDDVDSFLAAAETLKER-GAYKIFVMATHGLLSSDAPRLIEESAIDEVVVTNTIPHEIQKLQCPKIKTVDISMILSEAIRRIHNGESMSYLFRNIGLDD 369          
BLAST of SMED30027961 vs. Ensembl Mouse
Match: Prps1l1 (phosphoribosyl pyrophosphate synthetase 1-like 1 [Source:MGI Symbol;Acc:MGI:1922706])

HSP 1 Score: 82.4185 bits (202), Expect = 1.374e-16
Identity = 48/121 (39.67%), Postives = 74/121 (61.16%), Query Frame = -2
Query:  152 AKEKPPLTVVGDVSGHIAXXXXXXXXXXDQFVTAAE-LLHERVYFY*VFVMATHGLLSSDAPRKLEDSLIDEIIVTNTVPHHIQKMQCHKIKTVDVTMLIAEAIRRIHNNESMSYLFMNIP 511
            A E   + +VGDV   +AI++DD+ D       AA+ LL E      V+ + THG+ S  A  ++  +  + ++VTNT+P   +  QC KI+ +D+ M++AEAIRR HN ES+SYLF ++P
Sbjct:  199 ANEVDRMVLVGDVKDRVAILVDDMADTCGTICYAADKLLSEGATR--VYAILTHGIFSGPAIARINGACFEAVVVTNTIPQEDKMKQCSKIQVIDIAMILAEAIRRTHNGESVSYLFSHVP 317          
BLAST of SMED30027961 vs. Ensembl Mouse
Match: Prps1 (phosphoribosyl pyrophosphate synthetase 1 [Source:MGI Symbol;Acc:MGI:97775])

HSP 1 Score: 79.337 bits (194), Expect = 1.228e-15
Identity = 45/120 (37.50%), Postives = 73/120 (60.83%), Query Frame = -2
Query:  152 AKEKPPLTVVGDVSGHIAXXXXXXXXXXDQFVTAAELLHERVYFY*VFVMATHGLLSSDAPRKLEDSLIDEIIVTNTVPHHIQKMQCHKIKTVDVTMLIAEAIRRIHNNESMSYLFMNIP 511
            A E   + +VGDV   +AI++DD+ D       AA+ L        V+ + THG+ S  A  ++ ++  + ++VTNT+P   +   C KI+ +D++M++AEAIRR HN ES+SYLF ++P
Sbjct:  199 ANEVDRMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATR-VYAILTHGIFSGPAISRINNACFEAVVVTNTIPQEDKMKHCSKIQVIDISMILAEAIRRTHNGESVSYLFSHVP 317          
BLAST of SMED30027961 vs. UniProt/SwissProt
Match: sp|Q08DW2|KPRA_BOVIN (Phosphoribosyl pyrophosphate synthase-associated protein 1 OS=Bos taurus OX=9913 GN=PRPSAP1 PE=2 SV=1)

HSP 1 Score: 169.088 bits (427), Expect = 1.560e-45
Identity = 89/136 (65.44%), Postives = 116/136 (85.29%), Query Frame = -2
Query:  143 SLHVGFDMLPMMLAKEKPPLTVVGDVSGHIAXXXXXXXXXXDQFVTAAELLHERVYFY*VFVMATHGLLSSDAPRKLEDSLIDEIIVTNTVPHHIQKMQCHKIKTVDVTMLIAEAIRRIHNNESMSYLFMNIPKDD 550
            ++H G + LP+M+AKEKPP+TVVGDV G IAII+DDIIDDV+ FV AAE+L ER   Y ++VMATHG+LS++APR +E+S IDE++VTNTVPH +QK+QC KIKTVD++++++EAIRRIHN ESM+YLF NI  DD
Sbjct:  223 TVHPGLE-LPLMMAKEKPPITVVGDVGGRIAIIVDDIIDDVESFVAAAEILKER-GAYRIYVMATHGILSAEAPRLIEESSIDEVVVTNTVPHEVQKLQCPKIKTVDISLILSEAIRRIHNGESMAYLFRNITVDD 356          
BLAST of SMED30027961 vs. UniProt/SwissProt
Match: sp|Q14558|KPRA_HUMAN (Phosphoribosyl pyrophosphate synthase-associated protein 1 OS=Homo sapiens OX=9606 GN=PRPSAP1 PE=1 SV=2)

HSP 1 Score: 168.318 bits (425), Expect = 2.605e-45
Identity = 88/136 (64.71%), Postives = 116/136 (85.29%), Query Frame = -2
Query:  143 SLHVGFDMLPMMLAKEKPPLTVVGDVSGHIAXXXXXXXXXXDQFVTAAELLHERVYFY*VFVMATHGLLSSDAPRKLEDSLIDEIIVTNTVPHHIQKMQCHKIKTVDVTMLIAEAIRRIHNNESMSYLFMNIPKDD 550
            ++H G + LP+M+AKEKPP+TVVGDV G IAII+DDIIDDV+ FV AAE+L ER   Y ++VMATHG+LS++APR +E+S +DE++VTNTVPH +QK+QC KIKTVD++++++EAIRRIHN ESM+YLF NI  DD
Sbjct:  223 TVHPGLE-LPLMMAKEKPPITVVGDVGGRIAIIVDDIIDDVESFVAAAEILKER-GAYKIYVMATHGILSAEAPRLIEESSVDEVVVTNTVPHEVQKLQCPKIKTVDISLILSEAIRRIHNGESMAYLFRNITVDD 356          
BLAST of SMED30027961 vs. UniProt/SwissProt
Match: sp|Q9D0M1|KPRA_MOUSE (Phosphoribosyl pyrophosphate synthase-associated protein 1 OS=Mus musculus OX=10090 GN=Prpsap1 PE=1 SV=1)

HSP 1 Score: 167.933 bits (424), Expect = 3.487e-45
Identity = 89/136 (65.44%), Postives = 116/136 (85.29%), Query Frame = -2
Query:  143 SLHVGFDMLPMMLAKEKPPLTVVGDVSGHIAXXXXXXXXXXDQFVTAAELLHERVYFY*VFVMATHGLLSSDAPRKLEDSLIDEIIVTNTVPHHIQKMQCHKIKTVDVTMLIAEAIRRIHNNESMSYLFMNIPKDD 550
            ++H G + LP+M+AKEKPP+TVVGDV G IAII+DDIIDDV+ FV AAE+L ER   Y ++VMATHG+LS++APR +E+S IDE++VTNTVPH +QK+QC KIKTVD++++++EAIRRIHN ESM+YLF NI  DD
Sbjct:  223 TVHPGLE-LPLMMAKEKPPITVVGDVGGRIAIIVDDIIDDVESFVAAAEILKER-GAYKIYVMATHGILSAEAPRLIEESPIDEVVVTNTVPHELQKLQCPKIKTVDISLILSEAIRRIHNGESMAYLFRNITVDD 356          
BLAST of SMED30027961 vs. UniProt/SwissProt
Match: sp|Q63468|KPRA_RAT (Phosphoribosyl pyrophosphate synthase-associated protein 1 OS=Rattus norvegicus OX=10116 GN=Prpsap1 PE=1 SV=1)

HSP 1 Score: 167.162 bits (422), Expect = 7.557e-45
Identity = 89/136 (65.44%), Postives = 115/136 (84.56%), Query Frame = -2
Query:  143 SLHVGFDMLPMMLAKEKPPLTVVGDVSGHIAXXXXXXXXXXDQFVTAAELLHERVYFY*VFVMATHGLLSSDAPRKLEDSLIDEIIVTNTVPHHIQKMQCHKIKTVDVTMLIAEAIRRIHNNESMSYLFMNIPKDD 550
            ++H G + LP+M+AKEKPP+TVVGDV G IAII+DDIIDDV+ FV AAE L ER   Y ++VMATHG+LS++APR +E+S IDE++VTNTVPH +QK+QC KIKTVD++++++EAIRRIHN ESM+YLF NI  DD
Sbjct:  223 TVHPGLE-LPLMMAKEKPPITVVGDVGGRIAIIVDDIIDDVESFVAAAETLKER-GAYKIYVMATHGILSAEAPRLIEESPIDEVVVTNTVPHELQKLQCPKIKTVDISLILSEAIRRIHNGESMAYLFRNITVDD 356          
BLAST of SMED30027961 vs. UniProt/SwissProt
Match: sp|O60256|KPRB_HUMAN (Phosphoribosyl pyrophosphate synthase-associated protein 2 OS=Homo sapiens OX=9606 GN=PRPSAP2 PE=1 SV=1)

HSP 1 Score: 166.777 bits (421), Expect = 1.418e-44
Identity = 90/128 (70.31%), Postives = 110/128 (85.94%), Query Frame = -2
Query:  143 LPMMLAKEKPPLTVVGDVSGHIAXXXXXXXXXXDQFVTAAELLHERVYFY*VFVMATHGLLSSDAPRKLEDSLIDEIIVTNTVPHHIQKMQCHKIKTVDVTMLIAEAIRRIHNNESMSYLFMNIPKDD 526
            +PM++ KEKPP+TVVGDV G IAII+DDIIDDVD F+ AAE L ER   Y +FVMATHGLLSSDAPR++E+S IDE++VTNT+PH +QK+QC KIKTVD++M+++EAIRRIHN ESMSYLF NI  DD
Sbjct:  243 IPMLIPKEKPPITVVGDVGGRIAIIVDDIIDDVDSFLAAAETLKER-GAYKIFVMATHGLLSSDAPRRIEESAIDEVVVTNTIPHEVQKLQCPKIKTVDISMILSEAIRRIHNGESMSYLFRNIGLDD 369          
BLAST of SMED30027961 vs. TrEMBL
Match: A0A183B1Z3 (Uncharacterized protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS13228 PE=4 SV=1)

HSP 1 Score: 186.037 bits (471), Expect = 5.974e-52
Identity = 101/147 (68.71%), Postives = 125/147 (85.03%), Query Frame = -2
Query:  143 IFVFLQIVFR-SLHVGFDMLPMMLAKEKPPLTVVGDVSGHIAXXXXXXXXXXDQFVTAAELLHERVYFY*VFVMATHGLLSSDAPRKLEDSLIDEIIVTNTVPHHIQKMQCHKIKTVDVTMLIAEAIRRIHNNESMSYLFMNIPKDD 580
            +F+   I+ R + HVG ++LPMM+ K KPP T+VGDV G IAII+DDIIDDV QFV +A+LLHER   Y VFV ATHGLLS+DAP++LE+S IDE++VTNTVPH IQKMQCHKI+TVD++ML+AEAIRRI+N+ESMSYLF N+PKDD
Sbjct:    5 LFIHDDIISRPTAHVGMELLPMMVPKAKPPPTLVGDVHGRIAIIVDDIIDDVQQFVKSADLLHER-GAYKVFVFATHGLLSADAPQRLEESWIDEVVVTNTVPHGIQKMQCHKIRTVDISMLLAEAIRRIYNDESMSYLFTNVPKDD 150          
BLAST of SMED30027961 vs. TrEMBL
Match: A0A2H1C381 (Phosphoribosyl transferase domain protein OS=Fasciola hepatica OX=6192 GN=D915_11141 PE=4 SV=1)

HSP 1 Score: 182.956 bits (463), Expect = 1.158e-50
Identity = 99/144 (68.75%), Postives = 121/144 (84.03%), Query Frame = -2
Query:  143 VFLQIVFRSLHVGFDMLPMMLAKEKPPLTVVGDVSGHIAXXXXXXXXXXDQFVTAAELLHERVYFY*VFVMATHGLLSSDAPRKLEDSLIDEIIVTNTVPHHIQKMQCHKIKTVDVTMLIAEAIRRIHNNESMSYLFMNIPKDD 574
            V    +  +  VG ++LPMM++K KPP T+VGDV G IAII+DDIIDDV QFV AA+LLHER   Y VFV ATHGLLS+DAP++LE+S IDE++VTNTVPH IQKMQCHKI+TVD++ML+AEAIRRI+N+ESMSYLF N+PKDD
Sbjct:   14 VLFHFIRPTAQVGLELLPMMVSKAKPPPTLVGDVHGRIAIILDDIIDDVQQFVKAADLLHERGA-YKVFVFATHGLLSADAPQRLEESWIDEVVVTNTVPHGIQKMQCHKIRTVDISMLLAEAIRRIYNDESMSYLFTNVPKDD 156          
BLAST of SMED30027961 vs. TrEMBL
Match: G4VHZ7 (Putative ribose-phosphate pyrophosphokinase 1,2 OS=Schistosoma mansoni OX=6183 GN=Smp_052280.2 PE=4 SV=1)

HSP 1 Score: 181.415 bits (459), Expect = 2.532e-48
Identity = 98/137 (71.53%), Postives = 118/137 (86.13%), Query Frame = -2
Query:  143 RSLHVGFDMLPMMLAKEKPPLTVVGDVSGHIAXXXXXXXXXXDQFVTAAELLHERVYFY*VFVMATHGLLSSDAPRKLEDSLIDEIIVTNTVPHHIQKMQCHKIKTVDVTMLIAEAIRRIHNNESMSYLFMNIPKDD 553
            RS  +G ++LPMM+ K KPPLT+VGDV+  IAIIIDDIIDDV +FV AAELL ER   Y +FV+ATHGLLS DAPR LE+S IDE++VTNTVPH +QKMQCHKI+TVD++ L+AEAIRRI+N+ESMSYLFMN+PKDD
Sbjct:  151 RSTQIGLELLPMMIPKAKPPLTLVGDVNSRIAIIIDDIIDDVSKFVNAAELLRER-GAYKIFVIATHGLLSLDAPRLLEESRIDEVVVTNTVPHEVQKMQCHKIRTVDISPLLAEAIRRIYNDESMSYLFMNVPKDD 286          
BLAST of SMED30027961 vs. TrEMBL
Match: A0A504YSA8 (Phosphoribosyl pyrophosphate synthetase-associated protein 2 OS=Fasciola gigantica OX=46835 GN=FGIG_09525 PE=4 SV=1)

HSP 1 Score: 183.341 bits (464), Expect = 5.136e-48
Identity = 98/136 (72.06%), Postives = 119/136 (87.50%), Query Frame = -2
Query:  143 SLHVGFDMLPMMLAKEKPPLTVVGDVSGHIAXXXXXXXXXXDQFVTAAELLHERVYFY*VFVMATHGLLSSDAPRKLEDSLIDEIIVTNTVPHHIQKMQCHKIKTVDVTMLIAEAIRRIHNNESMSYLFMNIPKDD 550
            +  VG ++LPMM++K KPP T+VGDV G IAII+DDIIDDV QFV AA+LLHER   Y VFV ATHGLLS+DAP++LE+S IDE++VTNTVPH IQKMQCHKI+TVD++ML+AEAIRRI+N+ESMSYLF N+PKDD
Sbjct:  243 TAQVGLELLPMMVSKAKPPPTLVGDVHGRIAIILDDIIDDVQQFVKAADLLHER-GAYKVFVFATHGLLSADAPQRLEESWIDEVVVTNTVPHGIQKMQCHKIRTVDISMLLAEAIRRIYNDESMSYLFTNVPKDD 377          
BLAST of SMED30027961 vs. TrEMBL
Match: A0A4E0R865 (Phosphoribosyl pyrophosphate synthetase-associated protein 2 OS=Fasciola hepatica OX=6192 GN=D915_007324 PE=4 SV=1)

HSP 1 Score: 183.341 bits (464), Expect = 5.136e-48
Identity = 98/136 (72.06%), Postives = 119/136 (87.50%), Query Frame = -2
Query:  143 SLHVGFDMLPMMLAKEKPPLTVVGDVSGHIAXXXXXXXXXXDQFVTAAELLHERVYFY*VFVMATHGLLSSDAPRKLEDSLIDEIIVTNTVPHHIQKMQCHKIKTVDVTMLIAEAIRRIHNNESMSYLFMNIPKDD 550
            +  VG ++LPMM++K KPP T+VGDV G IAII+DDIIDDV QFV AA+LLHER   Y VFV ATHGLLS+DAP++LE+S IDE++VTNTVPH IQKMQCHKI+TVD++ML+AEAIRRI+N+ESMSYLF N+PKDD
Sbjct:  243 TAQVGLELLPMMVSKAKPPPTLVGDVHGRIAIILDDIIDDVQQFVKAADLLHER-GAYKVFVFATHGLLSADAPQRLEESWIDEVVVTNTVPHGIQKMQCHKIRTVDISMLLAEAIRRIYNDESMSYLFTNVPKDD 377          
BLAST of SMED30027961 vs. Ensembl Cavefish
Match: prpsap1 (phosphoribosyl pyrophosphate synthase-associated protein 1 [Source:NCBI gene;Acc:103035713])

HSP 1 Score: 170.244 bits (430), Expect = 7.596e-47
Identity = 95/136 (69.85%), Postives = 115/136 (84.56%), Query Frame = -2
Query:  143 SLHVGFDMLPMMLAKEKPPLTVVGDVSGHIAXXXXXXXXXXDQFVTAAELLHERVYFY*VFVMATHGLLSSDAPRKLEDSLIDEIIVTNTVPHHIQKMQCHKIKTVDVTMLIAEAIRRIHNNESMSYLFMNIPKDD 550
            S H G + LP+M+AKEKPP+TVVGDV G IAIIIDDIIDDV+ FV AAE+L ER   Y +++MATHGLLS+DAPR +E+S IDE++VTNTVPH +QK+QC KIKTVDV+M++AEAIRRIHN ESM+YLF NI  DD
Sbjct:  223 SGHPGLE-LPLMMAKEKPPITVVGDVGGRIAIIIDDIIDDVEDFVAAAEILKER-GAYKIYIMATHGLLSADAPRLIEESAIDEVVVTNTVPHEVQKLQCPKIKTVDVSMILAEAIRRIHNGESMAYLFRNITVDD 356          
BLAST of SMED30027961 vs. Ensembl Cavefish
Match: PRPSAP1 (phosphoribosyl pyrophosphate synthetase associated protein 1 [Source:NCBI gene;Acc:103025091])

HSP 1 Score: 168.318 bits (425), Expect = 3.251e-46
Identity = 91/128 (71.09%), Postives = 110/128 (85.94%), Query Frame = -2
Query:  143 LPMMLAKEKPPLTVVGDVSGHIAXXXXXXXXXXDQFVTAAELLHERVYFY*VFVMATHGLLSSDAPRKLEDSLIDEIIVTNTVPHHIQKMQCHKIKTVDVTMLIAEAIRRIHNNESMSYLFMNIPKDD 526
            LPMM+AKEKPP+TVVGDV G IAII+DDIIDDV  FV AAE+L ER   Y +++MATHGLLS+DAPR +E+S IDE++VTNTVPH +QK+QC KIKTVDV+M++AEAIRRIHN ESM+YLF N+  DD
Sbjct:  224 LPMMMAKEKPPITVVGDVGGRIAIIVDDIIDDVADFVAAAEILKER-GAYKIYIMATHGLLSADAPRLIEESAIDEVVVTNTVPHEVQKLQCPKIKTVDVSMILAEAIRRIHNGESMAYLFRNVTVDD 350          
BLAST of SMED30027961 vs. Ensembl Cavefish
Match: PRPSAP1 (phosphoribosyl pyrophosphate synthetase associated protein 1 [Source:NCBI gene;Acc:103025091])

HSP 1 Score: 168.703 bits (426), Expect = 3.608e-46
Identity = 91/128 (71.09%), Postives = 110/128 (85.94%), Query Frame = -2
Query:  143 LPMMLAKEKPPLTVVGDVSGHIAXXXXXXXXXXDQFVTAAELLHERVYFY*VFVMATHGLLSSDAPRKLEDSLIDEIIVTNTVPHHIQKMQCHKIKTVDVTMLIAEAIRRIHNNESMSYLFMNIPKDD 526
            LPMM+AKEKPP+TVVGDV G IAII+DDIIDDV  FV AAE+L ER   Y +++MATHGLLS+DAPR +E+S IDE++VTNTVPH +QK+QC KIKTVDV+M++AEAIRRIHN ESM+YLF N+  DD
Sbjct:  243 LPMMMAKEKPPITVVGDVGGRIAIIVDDIIDDVADFVAAAEILKER-GAYKIYIMATHGLLSADAPRLIEESAIDEVVVTNTVPHEVQKLQCPKIKTVDVSMILAEAIRRIHNGESMAYLFRNVTVDD 369          
BLAST of SMED30027961 vs. Ensembl Cavefish
Match: PRPSAP1 (phosphoribosyl pyrophosphate synthetase associated protein 1 [Source:NCBI gene;Acc:103025091])

HSP 1 Score: 167.162 bits (422), Expect = 4.819e-46
Identity = 90/128 (70.31%), Postives = 110/128 (85.94%), Query Frame = -2
Query:  143 LPMMLAKEKPPLTVVGDVSGHIAXXXXXXXXXXDQFVTAAELLHERVYFY*VFVMATHGLLSSDAPRKLEDSLIDEIIVTNTVPHHIQKMQCHKIKTVDVTMLIAEAIRRIHNNESMSYLFMNIPKDD 526
            LP+M+AKEKPP+TVVGDV G IAII+DDIIDDV  FV AAE+L ER   Y +++MATHGLLS+DAPR +E+S IDE++VTNTVPH +QK+QC KIKTVDV+M++AEAIRRIHN ESM+YLF N+  DD
Sbjct:  211 LPLMMAKEKPPITVVGDVGGRIAIIVDDIIDDVADFVAAAEILKER-GAYKIYIMATHGLLSADAPRLIEESAIDEVVVTNTVPHEVQKLQCPKIKTVDVSMILAEAIRRIHNGESMAYLFRNVTVDD 337          
BLAST of SMED30027961 vs. Ensembl Cavefish
Match: prpsap1 (phosphoribosyl pyrophosphate synthase-associated protein 1 [Source:NCBI gene;Acc:103035713])

HSP 1 Score: 167.933 bits (424), Expect = 6.522e-46
Identity = 92/128 (71.88%), Postives = 111/128 (86.72%), Query Frame = -2
Query:  143 LPMMLAKEKPPLTVVGDVSGHIAXXXXXXXXXXDQFVTAAELLHERVYFY*VFVMATHGLLSSDAPRKLEDSLIDEIIVTNTVPHHIQKMQCHKIKTVDVTMLIAEAIRRIHNNESMSYLFMNIPKDD 526
            LP+M+AKEKPP+TVVGDV G IAIIIDDIIDDV+ FV AAE+L ER   Y +++MATHGLLS+DAPR +E+S IDE++VTNTVPH +QK+QC KIKTVDV+M++AEAIRRIHN ESM+YLF NI  DD
Sbjct:  243 LPIMMAKEKPPITVVGDVGGRIAIIIDDIIDDVEDFVAAAEILKER-GAYKIYIMATHGLLSADAPRLIEESAIDEVVVTNTVPHEVQKLQCPKIKTVDVSMILAEAIRRIHNGESMAYLFRNITVDD 369          
BLAST of SMED30027961 vs. Ensembl Sea Lamprey
Match: prpsap2 (phosphoribosyl pyrophosphate synthetase-associated protein 2 [Source:ZFIN;Acc:ZDB-GENE-040426-2077])

HSP 1 Score: 167.548 bits (423), Expect = 8.580e-47
Identity = 90/128 (70.31%), Postives = 108/128 (84.38%), Query Frame = -2
Query:  143 LPMMLAKEKPPLTVVGDVSGHIAXXXXXXXXXXDQFVTAAELLHERVYFY*VFVMATHGLLSSDAPRKLEDSLIDEIIVTNTVPHHIQKMQCHKIKTVDVTMLIAEAIRRIHNNESMSYLFMNIPKDD 526
            LP+M+ KEKPP+TVVGDV G IAII+DDIIDDV  FV AAE L ER   Y ++VMATHGLLSSDAPR +E+S I E++VTNT+PH +QK+QCHKIKTVD++M+++EAIRRIHN ESMSYLF NI  DD
Sbjct:  209 LPLMMPKEKPPITVVGDVGGRIAIIVDDIIDDVHSFVMAAETLKER-GAYKIYVMATHGLLSSDAPRLIEESPIHEVVVTNTIPHEVQKLQCHKIKTVDISMIVSEAIRRIHNGESMSYLFRNIGVDD 335          
BLAST of SMED30027961 vs. Ensembl Yeast
Match: PRS3 (5-phospho-ribosyl-1(alpha)-pyrophosphate synthetase; synthesizes PRPP, which is required for nucleotide, histidine, and tryptophan biosynthesis; one of five related enzymes, which are active as heteromultimeric complexes [Source:SGD;Acc:S000001003])

HSP 1 Score: 82.0333 bits (201), Expect = 1.822e-17
Identity = 49/120 (40.83%), Postives = 73/120 (60.83%), Query Frame = -2
Query:  152 AKEKPPLTVVGDVSGHIAXXXXXXXXXXDQFVTAAELLHERVYFY*VFVMATHGLLSSDAPRKLEDSLIDEIIVTNTVPHHIQKMQCHKIKTVDVTMLIAEAIRRIHNNESMSYLFMNIP 511
            A E   + +VGDV+  I II+DD+ D       AAE+L E      V  + THG+LS  A   + +S +D ++ TNTVP   +  +C K+  +D++ ++AE+IRR+HN ES+SYLF N P
Sbjct:  201 ANEVSRMVLVGDVTDKICIIVDDMADTCGTLAKAAEILLENRAKS-VIAIVTHGVLSGRAIENINNSKLDRVVCTNTVPFEEKIKKCPKLAVIDISSVLAESIRRLHNGESISYLFKNYP 319          
BLAST of SMED30027961 vs. Ensembl Yeast
Match: PRS5 (5-phospho-ribosyl-1(alpha)-pyrophosphate synthetase; synthesizes PRPP, which is required for nucleotide, histidine, and tryptophan biosynthesis; one of five related enzymes, which are active as heteromultimeric complexes; forms cytoplasmic foci upon DNA replication stress [Source:SGD;Acc:S000005422])

HSP 1 Score: 72.0182 bits (175), Expect = 8.886e-14
Identity = 45/110 (40.91%), Postives = 70/110 (63.64%), Query Frame = -2
Query:  164 VVGDVSGHIAXXXXXXXXXXDQFVTAAELLHERVYFY*VFVMATHGLLSSDAPRKLEDSLIDEIIVTNTVPHH--IQKMQCHKIKTVDVTMLIAEAIRRIHNNESMSYLF 487
            +VGDV   + II+DD++D       AA+LL ++     V+ + THG+ S DA  ++  S ID++I++NTVP    +Q +   ++  +DV+ +I EAIRRIHN ES+S LF
Sbjct:  384 LVGDVRNKVCIIVDDLVDTSYTITRAAKLLKDQGSTK-VYALITHGVFSGDALERIGQSSIDKLIISNTVPQDRTLQYLGKDRVDVIDVSCIIGEAIRRIHNGESISMLF 492          
BLAST of SMED30027961 vs. Ensembl Yeast
Match: PRS1 (5-phospho-ribosyl-1(alpha)-pyrophosphate synthetase; synthesizes PRPP, which is required for nucleotide, histidine, and tryptophan biosynthesis; plays a key role in cell wall integrity (CWI) pathway; one of five related enzymes, which are active as heteromultimeric complexes; missense mutations in human homolog PRPS1 are associated with neuropathic Arts syndrome and Charcot-Marie Tooth (CMTX5) disease [Source:SGD;Acc:S000001664])

HSP 1 Score: 69.3218 bits (168), Expect = 5.772e-13
Identity = 50/112 (44.64%), Postives = 72/112 (64.29%), Query Frame = -2
Query:  164 LTVVGDVSGHIAXXXXXXXXXXDQFVTAAELLHERVYFY*VFVMATHGLLSSDAPRKLEDS-LIDEIIVTNTVPHHIQKM-QCHKIKTVDVTMLIAEAIRRIHNNESMSYLF 493
            +T+VG+V G  AII+DD+ID    F++AAE L +      V+V+ATHG+ + D   +LE S  ID I+VTNT P   +++    K+ T+DV+ + AE IRR H  ES+S LF
Sbjct:  310 ITLVGNVRGRSAIILDDMIDRPGSFISAAEHLVQNCGAKKVYVVATHGIFTGDCLEELEKSDAIDTIVVTNTYPISGERIAGSKKLVTIDVSPIFAECIRRDHYGESISVLF 421          
BLAST of SMED30027961 vs. Ensembl Yeast
Match: PRS2 (5-phospho-ribosyl-1(alpha)-pyrophosphate synthetase, synthesizes PRPP; which is required for nucleotide, histidine, and tryptophan biosynthesis; one of five related enzymes, which are active as heteromultimeric complexes; PRS2 has a paralog, PRS4, that arose from the whole genome duplication [Source:SGD;Acc:S000000901])

HSP 1 Score: 66.6254 bits (161), Expect = 2.082e-12
Identity = 47/120 (39.17%), Postives = 67/120 (55.83%), Query Frame = -2
Query:  152 AKEKPPLTVVGDVSGHIAXXXXXXXXXXDQFVTAAELLHERVYFY*VFVMATHGLLSSDAPRKLEDSLIDEIIVTNTVPHHIQKMQCHKIKTVDVTMLIAEAIRRIHNNESMSYLFMNIP 511
            A E   + +VGDV+G   ++IDD+ D     V A + L +      V  + THG+ S  A  KL +S +  I+ TNTVP     +    +  VD++  IAEAIRR+HN ES+SYLF + P
Sbjct:  202 ANEVSRMLLVGDVAGKSCLLIDDMADTCGTLVKACDTLMDHGAKE-VIAIVTHGIFSGSAREKLINSRLSRIVCTNTVP---VDLDLDIVDQVDISPTIAEAIRRLHNGESVSYLFTHAP 317          
BLAST of SMED30027961 vs. Ensembl Yeast
Match: PRS4 (5-phospho-ribosyl-1(alpha)-pyrophosphate synthetase, synthesizes PRPP; which is required for nucleotide, histidine, and tryptophan biosynthesis; one of five related enzymes, which are active as heteromultimeric complexes; PRS4 has a paralog, PRS2, that arose from the whole genome duplication; a missense mutation in the conserved residue R196 of its human homolog PRPS1 is pathogenic [Source:SGD;Acc:S000000164])

HSP 1 Score: 62.7734 bits (151), Expect = 3.845e-11
Identity = 45/120 (37.50%), Postives = 65/120 (54.17%), Query Frame = -2
Query:  152 AKEKPPLTVVGDVSGHIAXXXXXXXXXXDQFVTAAELLHERVYFY*VFVMATHGLLSSDAPRKLEDSLIDEIIVTNTVPHHIQKMQCHKIKTVDVTMLIAEAIRRIHNNESMSYLFMNIP 511
            A E   + +VGDV+    +++DD+ D     V A + L E      V  + THG+ S  A  KL +S +  I+ TNTVP  +      +I   D++   AEAIRR+HN ES+SYLF + P
Sbjct:  210 ANEVSKMVLVGDVTNKSCLLVDDMADTCGTLVKACDTLMEHGAKE-VIAIVTHGIFSGSAREKLRNSRLSRIVCTNTVPVDLDLPIADQI---DISPTFAEAIRRLHNGESVSYLFTHAP 325          
BLAST of SMED30027961 vs. Ensembl Nematostella
Match: EDO27332 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T9J2])

HSP 1 Score: 141.354 bits (355), Expect = 9.562e-39
Identity = 78/141 (55.32%), Postives = 100/141 (70.92%), Query Frame = -2
Query:  143 VGFDMLPM--------MLAKEKPPLTVVGDVSGHIAXXXXXXXXXXDQFVTAAELLHERVYFY*VFVMATHGLLSSDAPRKLEDSLIDEIIVTNTVPHHIQKMQCHKIKTVDVTMLIAEAIRRIHNNESMSYLFMNIPKDD 541
            +GF+ +P+         L KEKPP+ VVGDV G IAII+DD+IDD   FV AA LL +R   Y ++VM THGLLS  AP  +E S IDE++VTNTVPH  +  +C KIKT+D++ L+AEA+RRIHN ESM YLF N+P +D
Sbjct:   61 IGFNFVPLENELNVPGFLPKEKPPMNVVGDVGGKIAIIVDDMIDDATTFVDAARLLRDR-GAYKIYVMVTHGLLSGSAPELIEGSEIDEVVVTNTVPHDSKVARCSKIKTIDISQLLAEAVRRIHNGESMGYLFRNVPLED 200          
BLAST of SMED30027961 vs. Ensembl Nematostella
Match: EDO48023 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKP7])

HSP 1 Score: 141.739 bits (356), Expect = 5.251e-37
Identity = 78/141 (55.32%), Postives = 100/141 (70.92%), Query Frame = -2
Query:  143 VGFDMLPM--------MLAKEKPPLTVVGDVSGHIAXXXXXXXXXXDQFVTAAELLHERVYFY*VFVMATHGLLSSDAPRKLEDSLIDEIIVTNTVPHHIQKMQCHKIKTVDVTMLIAEAIRRIHNNESMSYLFMNIPKDD 541
            +GF+ +P+         L KEKPP+ VVGDV G IAII+DD+IDD   FV AA LL +R   Y ++VM THGLLS  AP  +E S IDE++VTNTVPH  +  +C KIKT+D++ L+AEA+RRIHN ESM YLF N+P +D
Sbjct:  226 IGFNFVPLENELNVPGFLPKEKPPMNVVGDVGGKIAIIVDDMIDDATTFVDAARLLRDR-GAYKIYVMVTHGLLSGSAPELIEGSEIDEVVVTNTVPHDSKVARCSKIKTIDISQLLAEAVRRIHNGESMGYLFRNVPLED 365          
BLAST of SMED30027961 vs. Ensembl Nematostella
Match: EDO47117 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNC7])

HSP 1 Score: 91.2781 bits (225), Expect = 4.263e-20
Identity = 53/134 (39.55%), Postives = 83/134 (61.94%), Query Frame = -2
Query:  152 LHVGFDML--PMMLAKEKPPLTVVGDVSGHIAXXXXXXXXXXDQFVTAAELLHERVYFY*VFVMATHGLLSSDAPRKLEDSLIDEIIVTNTVPHHIQKMQCHKIKTVDVTMLIAEAIRRIHNNESMSYLFMNIP 547
            L+ GF ++     +A E   + +VGDV    AI++DDI D       AA  L+E      V+ + THG+ S  A ++L+ S+I+ + +TN++P   +   C KI++VDV+M++AEAIRR HN ES+SYLF ++P
Sbjct:  185 LNCGFALIHKERKVANEVASMVLVGDVKDRTAILVDDIADTCGTLTLAATKLNEAGAAK-VYAICTHGVFSGPALKRLDGSIIEAVAITNSIPQEAKMQMCSKIRSVDVSMILAEAIRRTHNGESVSYLFTHVP 317          
BLAST of SMED30027961 vs. Ensembl Medaka
Match: ENSORLT00000000265.2 (phosphoribosyl pyrophosphate synthase-associated protein 1 [Source:NCBI gene;Acc:101162980])

HSP 1 Score: 172.94 bits (437), Expect = 7.602e-48
Identity = 91/134 (67.91%), Postives = 113/134 (84.33%), Query Frame = -2
Query:  143 HVGFDMLPMMLAKEKPPLTVVGDVSGHIAXXXXXXXXXXDQFVTAAELLHERVYFY*VFVMATHGLLSSDAPRKLEDSLIDEIIVTNTVPHHIQKMQCHKIKTVDVTMLIAEAIRRIHNNESMSYLFMNIPKDD 544
            H G + LP+M+AKEKPP++VVGDV G IAI++DDIIDDV+ FV AAE L ER   Y +++MATHGLLS++APR +E+S IDE++VTNTVPH +QK+QC KIKTVDV+M++AEAIRRIHN ESMSYLF NI  DD
Sbjct:  228 HTGLE-LPLMMAKEKPPISVVGDVGGRIAIVVDDIIDDVEDFVAAAEALKER-GAYKIYIMATHGLLSAEAPRLIEESAIDEVVVTNTVPHEVQKLQCSKIKTVDVSMILAEAIRRIHNGESMSYLFRNITVDD 359          
BLAST of SMED30027961 vs. Ensembl Medaka
Match: ENSORLT00000046014.1 (phosphoribosyl pyrophosphate synthase-associated protein 1 [Source:NCBI gene;Acc:101162980])

HSP 1 Score: 172.94 bits (437), Expect = 1.201e-47
Identity = 91/134 (67.91%), Postives = 113/134 (84.33%), Query Frame = -2
Query:  143 HVGFDMLPMMLAKEKPPLTVVGDVSGHIAXXXXXXXXXXDQFVTAAELLHERVYFY*VFVMATHGLLSSDAPRKLEDSLIDEIIVTNTVPHHIQKMQCHKIKTVDVTMLIAEAIRRIHNNESMSYLFMNIPKDD 544
            H G + LP+M+AKEKPP++VVGDV G IAI++DDIIDDV+ FV AAE L ER   Y +++MATHGLLS++APR +E+S IDE++VTNTVPH +QK+QC KIKTVDV+M++AEAIRRIHN ESMSYLF NI  DD
Sbjct:  253 HTGLE-LPLMMAKEKPPISVVGDVGGRIAIVVDDIIDDVEDFVAAAEALKER-GAYKIYIMATHGLLSAEAPRLIEESAIDEVVVTNTVPHEVQKLQCSKIKTVDVSMILAEAIRRIHNGESMSYLFRNITVDD 384          
BLAST of SMED30027961 vs. Ensembl Medaka
Match: ENSORLT00000015651.2 (phosphoribosyl pyrophosphate synthase-associated protein 1 [Source:NCBI gene;Acc:101163819])

HSP 1 Score: 170.629 bits (431), Expect = 4.945e-47
Identity = 93/134 (69.40%), Postives = 113/134 (84.33%), Query Frame = -2
Query:  143 HVGFDMLPMMLAKEKPPLTVVGDVSGHIAXXXXXXXXXXDQFVTAAELLHERVYFY*VFVMATHGLLSSDAPRKLEDSLIDEIIVTNTVPHHIQKMQCHKIKTVDVTMLIAEAIRRIHNNESMSYLFMNIPKDD 544
            H G + LP+M+AKEKPP+TVVGDV G IAII+DDIIDDV  FV AAE+L ER   Y +++MATHGLLS+DAPR +E+S IDE++VTNTVPH +QK+QC KIKTVDV+M++AEAIRRIHN ESM+YLF NI  DD
Sbjct:  225 HTGLE-LPLMMAKEKPPITVVGDVGGRIAIIVDDIIDDVGDFVAAAEILKER-GAYKIYIMATHGLLSADAPRLIEESAIDEVVVTNTVPHEVQKLQCPKIKTVDVSMILAEAIRRIHNGESMAYLFRNITVDD 356          
BLAST of SMED30027961 vs. Ensembl Medaka
Match: ENSORLT00000042972.1 (phosphoribosyl pyrophosphate synthase-associated protein 1 [Source:NCBI gene;Acc:101163819])

HSP 1 Score: 168.318 bits (425), Expect = 5.321e-46
Identity = 91/128 (71.09%), Postives = 110/128 (85.94%), Query Frame = -2
Query:  143 LPMMLAKEKPPLTVVGDVSGHIAXXXXXXXXXXDQFVTAAELLHERVYFY*VFVMATHGLLSSDAPRKLEDSLIDEIIVTNTVPHHIQKMQCHKIKTVDVTMLIAEAIRRIHNNESMSYLFMNIPKDD 526
            LP+M+AKEKPP+TVVGDV G IAII+DDIIDDV  FV AAE+L ER   Y +++MATHGLLS+DAPR +E+S IDE++VTNTVPH +QK+QC KIKTVDV+M++AEAIRRIHN ESM+YLF NI  DD
Sbjct:  244 LPIMMAKEKPPITVVGDVGGRIAIIVDDIIDDVGDFVAAAEILKER-GAYKIYIMATHGLLSADAPRLIEESAIDEVVVTNTVPHEVQKLQCPKIKTVDVSMILAEAIRRIHNGESMAYLFRNITVDD 370          
BLAST of SMED30027961 vs. Ensembl Medaka
Match: prpsap2 (phosphoribosyl pyrophosphate synthase-associated protein 2 [Source:NCBI gene;Acc:101168959])

HSP 1 Score: 158.688 bits (400), Expect = 1.086e-42
Identity = 87/128 (67.97%), Postives = 108/128 (84.38%), Query Frame = -2
Query:  143 LPMMLAKEKPPLTVVGDVSGHIAXXXXXXXXXXDQFVTAAELLHERVYFY*VFVMATHGLLSSDAPRKLEDSLIDEIIVTNTVPHHIQKMQCHKIKTVDVTMLIAEAIRRIHNNESMSYLFMNIPKDD 526
            +P+++ KEKPP++VVGDV G IAII+DDIIDDVD FV AAE L ER   Y +FVMATHGLLS +APR +E+S IDE++VTNT+PH +QK+QC KIKTVD++M+++EAIRRIHN ESMSYLF NI  DD
Sbjct:  231 IPLLIPKEKPPISVVGDVGGRIAIIVDDIIDDVDSFVAAAETLKER-GAYKIFVMATHGLLSCEAPRFIEESAIDEVVVTNTIPHELQKLQCPKIKTVDISMILSEAIRRIHNGESMSYLFRNIGVDD 357          
BLAST of SMED30027961 vs. Planmine SMEST
Match: SMESG000021780.1 (SMESG000021780.1)

HSP 1 Score: 270.781 bits (691), Expect = 3.292e-86
Identity = 142/195 (72.82%), Postives = 158/195 (81.03%), Query Frame = 3
Query: 1146 DWGKKDEEKTESKKQKLTKPAKRKYNDQYIEFAFVPYVSEISIPVCLLCSQTLSNEAMVPSKLKRHLKTNHPKHVLKPRAYFEEIFLKSQKQT-KLKNYCKISIDAQI------------------GKNIILFSLEIAVSSIVNEKAVNLVKQIPISSDTITYRIQEIPDEIDQQLKENFLNNKEPMLKLWALQI 1673
            DWGKKD+EKTESKKQ LTKPAKRKYNDQYIEF FVP +S+ S+PVCLLCSQT SNEAMVPS LK HLKTNHP +VL PRAYFEEIF KSQKQT KLKNY KISI++QI                  G+ I+L SLEIAVSS+VN KAV+LVKQIP+SSDTI  +IQE+ D+IDQQLKE+ LNNKEPMLKLWALQI
Sbjct:   28 DWGKKDKEKTESKKQNLTKPAKRKYNDQYIEFDFVPSISDSSLPVCLLCSQTRSNEAMVPSNLKYHLKTNHPVYVLNPRAYFEEIFSKSQKQTKKLKNYRKISINSQIASFKIAQLLARKKKPYSDGEYILLPSLEIAVSSMVNGKAVDLVKQIPLSSDTIARKIQEMSDDIDQQLKEHILNNKEPMLKLWALQI 222          
BLAST of SMED30027961 vs. Planmine SMEST
Match: SMESG000009288.1 (SMESG000009288.1)

HSP 1 Score: 246.514 bits (628), Expect = 5.015e-78
Identity = 130/176 (73.86%), Postives = 142/176 (80.68%), Query Frame = 3
Query: 1119 MDKYFMKAYDWGKKDEEKTESKKQKLTKPAKRKYNDQYIEFAFVPYVSEISIPVCLLCSQTLSNEAMVPSKLKRHLKTNHPKHVLKPRAYFEEIFLKSQKQT-KLKNYCKISIDAQI------------------GKNIILFSLEIAVSSIVNEKAVNLVKQIPISSDTITYRIQE 1589
            MDKYFMKAYDW KKDEEKTE KKQKLTKPAKRKY+DQYIEFA VP VSE S+PVCLLCSQT  NEAMV SKLKRHLKTNHP++VLKPRAYFEEIF KSQKQT KLKNYCKISI+AQI                  G+ II+ SLEIA+SS+VN KAV+LVKQIP SS+TI  RIQ+
Sbjct:    1 MDKYFMKAYDWVKKDEEKTEGKKQKLTKPAKRKYHDQYIEFAIVPSVSESSLPVCLLCSQTPLNEAMVSSKLKRHLKTNHPEYVLKPRAYFEEIFSKSQKQTKKLKNYCKISINAQIASFKITQLLARKKKPHSDGEKIIVPSLEIAISSMVNGKAVDLVKQIPFSSNTIARRIQQ 176          
BLAST of SMED30027961 vs. Planmine SMEST
Match: SMESG000007561.1 (SMESG000007561.1)

HSP 1 Score: 240.736 bits (613), Expect = 2.214e-73
Identity = 132/137 (96.35%), Postives = 133/137 (97.08%), Query Frame = -2
Query:  143 RSLHVGFDMLPMMLAKEKPPLTVVGDVSGHIAXXXXXXXXXXDQFVTAAELLHERVYFY*VFVMATHGLLSSDAPRKLEDSLIDEIIVTNTVPHHIQKMQCHKIKTVDVTMLIAEAIRRIHNNESMSYLFMNIPKDD 553
            +SLHVGFDMLPMMLAKEKPPLTVVGDVSGHIAIIIDDIIDDVDQFVTAAELLHER   Y VFVMATHGLLSSDAPRKLEDSLIDEIIVTNTVPHHIQKMQCHKIKTVDVTMLIAEAIRRIHNNESMSYLFMNIPKDD
Sbjct:  218 KSLHVGFDMLPMMLAKEKPPLTVVGDVSGHIAIIIDDIIDDVDQFVTAAELLHER-GVYKVFVMATHGLLSSDAPRKLEDSLIDEIIVTNTVPHHIQKMQCHKIKTVDVTMLIAEAIRRIHNNESMSYLFMNIPKDD 353          
BLAST of SMED30027961 vs. Planmine SMEST
Match: SMESG000007561.1 (SMESG000007561.1)

HSP 1 Score: 239.965 bits (611), Expect = 5.860e-73
Identity = 132/136 (97.06%), Postives = 132/136 (97.06%), Query Frame = -2
Query:  143 SLHVGFDMLPMMLAKEKPPLTVVGDVSGHIAXXXXXXXXXXDQFVTAAELLHERVYFY*VFVMATHGLLSSDAPRKLEDSLIDEIIVTNTVPHHIQKMQCHKIKTVDVTMLIAEAIRRIHNNESMSYLFMNIPKDD 550
            SLHVGFDMLPMMLAKEKPPLTVVGDVSGHIAIIIDDIIDDVDQFVTAAELLHER   Y VFVMATHGLLSSDAPRKLEDSLIDEIIVTNTVPHHIQKMQCHKIKTVDVTMLIAEAIRRIHNNESMSYLFMNIPKDD
Sbjct:  226 SLHVGFDMLPMMLAKEKPPLTVVGDVSGHIAIIIDDIIDDVDQFVTAAELLHER-GVYKVFVMATHGLLSSDAPRKLEDSLIDEIIVTNTVPHHIQKMQCHKIKTVDVTMLIAEAIRRIHNNESMSYLFMNIPKDD 360          
BLAST of SMED30027961 vs. Planmine SMEST
Match: SMESG000028779.1 (SMESG000028779.1)

HSP 1 Score: 184.111 bits (466), Expect = 2.616e-55
Identity = 91/109 (83.49%), Postives = 98/109 (89.91%), Query Frame = 3
Query: 1119 MDKYFMKAYDWGKKDEEKTESKKQKLTKPAKRKYNDQYIEFAFVPYVSEISIPVCLLCSQTLSNEAMVPSKLKRHLKTNHPKHVLKPRAYFEEIFLKSQKQT-KLKNYC 1442
            MDKYFMKAYD GK DEEKTE+KKQ LT P K KYND+YIEF FVP VS+ SIPVCLLCSQTLSNEA+VPSKLKRHLKTNHP++VLKPRAYF+EIF KSQKQT KLKNYC
Sbjct:    1 MDKYFMKAYDCGKNDEEKTETKKQNLTNPVKCKYNDKYIEFFFVPSVSDSSIPVCLLCSQTLSNEAVVPSKLKRHLKTNHPEYVLKPRAYFKEIFSKSQKQTKKLKNYC 109          
The following BLAST results are available for this feature:
BLAST of SMED30027961 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PRPSAP12.470e-4664.71phosphoribosyl pyrophosphate synthetase associated... [more]
PRPSAP27.123e-4670.31phosphoribosyl pyrophosphate synthetase associated... [more]
PRPSAP27.123e-4670.31phosphoribosyl pyrophosphate synthetase associated... [more]
PRPSAP18.432e-4664.71phosphoribosyl pyrophosphate synthetase associated... [more]
PRPSAP21.884e-4570.31phosphoribosyl pyrophosphate synthetase associated... [more]
back to top
BLAST of SMED30027961 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
W04G3.51.906e-3963.36pep chromosome:WBcel235:X:11073658:11076043:1 gene... [more]
W04G3.51.906e-3963.36pep chromosome:WBcel235:X:11073658:11075961:1 gene... [more]
W04G3.51.968e-3963.36pep chromosome:WBcel235:X:11073658:11076043:1 gene... [more]
R151.27.145e-1740.00pep chromosome:WBcel235:III:7213176:7215226:1 gene... [more]
R151.27.579e-1740.00pep chromosome:WBcel235:III:7211424:7215111:1 gene... [more]
back to top
BLAST of SMED30027961 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG22462.239e-4364.71gene:FBgn0039790 transcript:FBtr0335445[more]
CG22463.699e-4364.71gene:FBgn0039790 transcript:FBtr0302610[more]
CG22463.699e-4364.71gene:FBgn0039790 transcript:FBtr0085677[more]
CG22463.699e-4364.71gene:FBgn0039790 transcript:FBtr0302609[more]
CG22463.699e-4364.71gene:FBgn0039790 transcript:FBtr0302608[more]
back to top
BLAST of SMED30027961 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prpsap17.333e-4868.66phosphoribosyl pyrophosphate synthetase-associated... [more]
prpsap22.635e-4469.53phosphoribosyl pyrophosphate synthetase-associated... [more]
prps1a3.703e-1537.50phosphoribosyl pyrophosphate synthetase 1A [Source... [more]
prps1a4.042e-1537.50phosphoribosyl pyrophosphate synthetase 1A [Source... [more]
prps1b4.330e-1537.50phosphoribosyl pyrophosphate synthetase 1B [Source... [more]
back to top
BLAST of SMED30027961 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab107.155e-4470.31RAB10, member RAS oncogene family [Source:Xenbase;... [more]
lmbrd22.679e-4361.87LMBR1 domain containing 2 [Source:Xenbase;Acc:XB-G... [more]
lmbrd22.822e-4361.87LMBR1 domain containing 2 [Source:Xenbase;Acc:XB-G... [more]
lmbrd23.696e-4361.87LMBR1 domain containing 2 [Source:Xenbase;Acc:XB-G... [more]
lmbrd21.359e-4266.41LMBR1 domain containing 2 [Source:Xenbase;Acc:XB-G... [more]
back to top
BLAST of SMED30027961 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Prpsap16.086e-4665.44phosphoribosyl pyrophosphate synthetase-associated... [more]
Prpsap28.070e-4571.09phosphoribosyl pyrophosphate synthetase-associated... [more]
Prpsap28.070e-4571.09phosphoribosyl pyrophosphate synthetase-associated... [more]
Prps1l11.374e-1639.67phosphoribosyl pyrophosphate synthetase 1-like 1 [... [more]
Prps11.228e-1537.50phosphoribosyl pyrophosphate synthetase 1 [Source:... [more]
back to top
BLAST of SMED30027961 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q08DW2|KPRA_BOVIN1.560e-4565.44Phosphoribosyl pyrophosphate synthase-associated p... [more]
sp|Q14558|KPRA_HUMAN2.605e-4564.71Phosphoribosyl pyrophosphate synthase-associated p... [more]
sp|Q9D0M1|KPRA_MOUSE3.487e-4565.44Phosphoribosyl pyrophosphate synthase-associated p... [more]
sp|Q63468|KPRA_RAT7.557e-4565.44Phosphoribosyl pyrophosphate synthase-associated p... [more]
sp|O60256|KPRB_HUMAN1.418e-4470.31Phosphoribosyl pyrophosphate synthase-associated p... [more]
back to top
BLAST of SMED30027961 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A183B1Z35.974e-5268.71Uncharacterized protein OS=Echinostoma caproni OX=... [more]
A0A2H1C3811.158e-5068.75Phosphoribosyl transferase domain protein OS=Fasci... [more]
G4VHZ72.532e-4871.53Putative ribose-phosphate pyrophosphokinase 1,2 OS... [more]
A0A504YSA85.136e-4872.06Phosphoribosyl pyrophosphate synthetase-associated... [more]
A0A4E0R8655.136e-4872.06Phosphoribosyl pyrophosphate synthetase-associated... [more]
back to top
BLAST of SMED30027961 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prpsap17.596e-4769.85phosphoribosyl pyrophosphate synthase-associated p... [more]
PRPSAP13.251e-4671.09phosphoribosyl pyrophosphate synthetase associated... [more]
PRPSAP13.608e-4671.09phosphoribosyl pyrophosphate synthetase associated... [more]
PRPSAP14.819e-4670.31phosphoribosyl pyrophosphate synthetase associated... [more]
prpsap16.522e-4671.88phosphoribosyl pyrophosphate synthase-associated p... [more]
back to top
BLAST of SMED30027961 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
prpsap28.580e-4770.31phosphoribosyl pyrophosphate synthetase-associated... [more]
back to top
BLAST of SMED30027961 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
PRS31.822e-1740.835-phospho-ribosyl-1(alpha)-pyrophosphate synthetas... [more]
PRS58.886e-1440.915-phospho-ribosyl-1(alpha)-pyrophosphate synthetas... [more]
PRS15.772e-1344.645-phospho-ribosyl-1(alpha)-pyrophosphate synthetas... [more]
PRS22.082e-1239.175-phospho-ribosyl-1(alpha)-pyrophosphate synthetas... [more]
PRS43.845e-1137.505-phospho-ribosyl-1(alpha)-pyrophosphate synthetas... [more]
back to top
BLAST of SMED30027961 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO273329.562e-3955.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO480235.251e-3755.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO471174.263e-2039.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30027961 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000000265.27.602e-4867.91phosphoribosyl pyrophosphate synthase-associated p... [more]
ENSORLT00000046014.11.201e-4767.91phosphoribosyl pyrophosphate synthase-associated p... [more]
ENSORLT00000015651.24.945e-4769.40phosphoribosyl pyrophosphate synthase-associated p... [more]
ENSORLT00000042972.15.321e-4671.09phosphoribosyl pyrophosphate synthase-associated p... [more]
prpsap21.086e-4267.97phosphoribosyl pyrophosphate synthase-associated p... [more]
back to top
BLAST of SMED30027961 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000021780.13.292e-8672.82SMESG000021780.1[more]
SMESG000009288.15.015e-7873.86SMESG000009288.1[more]
SMESG000007561.12.214e-7396.35SMESG000007561.1[more]
SMESG000007561.15.860e-7397.06SMESG000007561.1[more]
SMESG000028779.12.616e-5583.49SMESG000028779.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027961 ID=SMED30027961|Name=SMED30027961|organism=Schmidtea mediterranea sexual|type=transcript|length=1985bp
ATATTTGTAGTCCAAAAATATTTAAAGCCAAATCACGCGTATTCTACAGT
AAAGTACAAAAAAATAATAGCAAAAGTTCAAAACATAATTGAATTCAGTT
TTATTGGAATTACACATTTAATAAAACTAAAAATGAATTTTAATCATCTT
TAGGAATATTCATGAATAAATATGACATGGACTCATTGTTGTGAATACGC
CGAATTGCTTCAGCAATGAGCATAGTTACATCCACAGTTTTGATTTTATG
GCATTGCATTTTTTGAATATGATGTGGTACTGTATTGGTGACAATAATTT
CATCAATTAAACTATCTTCTAATTTCCTCGGAGCATCTGAGCTTAACAAC
CCATGAGTGGCCATTACAAAAACCTAATAAAAATATACTCGCTCATGTAA
TAATTCGGCTGCGGTTACGAATTGATCAACATCGTCTATTATGTCATCAA
TTATTATAGCAATGTGACCACTAACATCTCCAACAACTGTCAAAGGTGGT
TTTTCTTTGGCTAGCATCATAGGTAACATATCAAATCCAACATGTAGAGA
TCTAAAAACAATTTGTAAAAATACAAATATGTTCTTAAATTTTTCATAAC
ATTTAGGAGTGATTAGATACCGAAATTTTATGATATTAGACCAGTGTATC
GCAAACTGTGCCGTGAGAAATTTTTATGCTGGCACTATATATTTTATTGA
TTATCTCGAGAAGTAACTTTTTTAAATGAAAAAGCCTTAAAATTGAATGT
ATCGATTGATTCAAATTCTTTCAAAGCTTAAACTCATGCAAGGCATGATA
TAGGGATCATTTTATAGATGATTTCTGGCATTTTAAATGATGCAGCATTT
CTTAAAGTTAGTATTATGGTTTCATTATTTTAACGTGCAGTTTCATAATT
TTATTTTATACATTATGGTGTTTTATCGACTTTATATTTTAAAACGCCAA
ACTTTTGACTTTAAATTTTACCTAATAATAAATTTAGCTTTTATATTTTA
AATTTAAAATTTATATATAAACATTCTATATATTTAATGCTTAGAAAATC
ATTTATAATCGTTTTAACAAGGCCTAATATAAGCGTTTAACAAACATTTT
TCAAAAATATGGATAAATATGGACAAATATTTTATGAAAGCATATGATTG
GGGCAAAAAGGATGAAGAAAAAACAGAAAGTAAAAAACAAAAGCTAACTA
AACCAGCAAAGCGCAAATATAATGACCAGTACATTGAGTTTGCTTTTGTT
CCATATGTAAGTGAGATCTCTATACCAGTGTGCTTGCTATGTTCTCAGAC
TCTTTCGAATGAAGCAATGGTTCCTAGTAAGCTGAAGCGTCATTTAAAAA
CCAATCATCCCAAGCACGTGCTAAAACCTAGAGCTTATTTCGAGGAAATC
TTTTTAAAATCTCAAAAACAAACCAAACTGAAGAATTATTGCAAAATATC
TATAGATGCTCAAATCGGTAAAAACATCATTTTGTTTTCGTTGGAAATTG
CTGTTTCTTCAATCGTTAATGAAAAAGCCGTCAATCTTGTGAAGCAGATT
CCAATTTCATCGGACACAATAACTTATAGAATACAAGAAATACCAGATGA
AATTGACCAACAACTCAAAGAAAATTTTTTGAATAATAAAGAACCAATGT
TGAAATTATGGGCGCTTCAAATCCACATCGAGAATTGAGCATGAAAGCTA
TTCGAGCATTGTTGCTTTTTGGATCTTCCTATCTTTGTGAATTATGATGT
TCATCATTAAACGAAATTAAATCCAAAAAACGTGAACCACTGCAAATGAT
TGATGGGGAAATGCGAGTATGCTTATCGAACATAGAACCGAGAATTACTC
ATATTTGTAGTTTAAAACAAGCTCACACTTCGTATTAAAATACTCCTTAT
TAAATCTGTAATATTTAATGGTTATTACCATATGACGTTTAAGTTTAGAA
AGCAAATCGAAAATTGAGTTTTTTATTTAAATATT
back to top

protein sequence of SMED30027961-orf-1

>SMED30027961-orf-1 ID=SMED30027961-orf-1|Name=SMED30027961-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=190bp
MDKYFMKAYDWGKKDEEKTESKKQKLTKPAKRKYNDQYIEFAFVPYVSEI
SIPVCLLCSQTLSNEAMVPSKLKRHLKTNHPKHVLKPRAYFEEIFLKSQK
QTKLKNYCKISIDAQIGKNIILFSLEIAVSSIVNEKAVNLVKQIPISSDT
ITYRIQEIPDEIDQQLKENFLNNKEPMLKLWALQIHIEN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0002032epidermal cell
PLANA:0002056medial muscle cell
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR029057PRTase-like
IPR005946Rib-P_diPkinase
Vocabulary: molecular function
TermDefinition
GO:0004749ribose phosphate diphosphokinase activity
GO:0000287magnesium ion binding
GO:0000981RNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0003676nucleic acid binding
GO:0003677DNA binding
GO:0003700transcription factor activity, sequence-specific DNA binding
Vocabulary: biological process
TermDefinition
GO:0009165nucleotide biosynthetic process
GO:0006355regulation of transcription, DNA-templated
GO:0006357regulation of transcription from RNA polymerase II promoter
GO:0015074DNA integration
Vocabulary: cellular component
TermDefinition
GO:0005654nucleoplasm
GO:0005737cytoplasm
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR029057Phosphoribosyltransferase-likeGENE3DG3DSA:3.40.50.2020coord: 1..44
e-value: 1.6E-11
score: 45.9
IPR029057Phosphoribosyltransferase-likeSUPERFAMILYSSF53271PRTase-likecoord: 2..67
IPR005946Ribose-phosphate pyrophosphokinasePFAMPF14572Pribosyl_synthcoord: 1..67
e-value: 2.3E-35
score: 122.3
IPR005946Ribose-phosphate pyrophosphokinasePANTHERPTHR10210RIBOSE-PHOSPHATE DIPHOSPHOKINASE FAMILY MEMBERcoord: 1..72
NoneNo IPR availablePANTHERPTHR10210:SF28PHOSPHORIBOSYL PYROPHOSPHATE SYNTHASE-ASSOCIATED PROTEIN 1coord: 1..72