NPHS1-1

Overview
NameNPHS1-1 (AKN21717.1)
Smed IDSMED30027960
Length (bp)5087
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of NPHS1-1 (SMED30027960) t-SNE clustered cells

Violin plots show distribution of expression levels for NPHS1-1 (SMED30027960) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of NPHS1-1 (SMED30027960) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for NPHS1-1 (SMED30027960) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027960

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
muscle cellSMED30027960SMESG000029156.1 tr5_12233mu_Smed_v1PMID:25558068
Reuter et al., 2015
whole organism asexual adult fluorescence in situ hybridization evidence
posterior region of the whole animalSMED30027960SMESG000029156.1 tr5_12233mu_Smed_v1PMID:25558068
Reuter et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30027960SMESG000003359.1 tr5_12233mu_Smed_v1PMID:25558068
Reuter et al., 2015
whole organism asexual adult fluorescence in situ hybridization evidence
posterior region of the whole animalSMED30027960SMESG000003359.1 tr5_12233mu_Smed_v1PMID:25558068
Reuter et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
nervous systemSMED30027960SMESG000003359.1 dd_Smed_v4_11987_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30027960SMESG000003359.1 dd_Smed_v4_11987_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30027960SMESG000003359.1 dd_Smed_v4_11987_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30027960SMESG000003359.1 dd_Smed_v4_11987_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30027960SMESG000003359.1 dd_Smed_v6_11987_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
dorsal-ventral muscle cellSMED30027960SMESG000003359.1 dd_Smed_v4_11987_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of NPHS1-1 vs. Ensembl Human
Match: NPHS1 (NPHS1 adhesion molecule, nephrin [Source:HGNC Symbol;Acc:HGNC:7908])

HSP 1 Score: 95.5153 bits (236), Expect = 8.028e-19
Identity = 180/816 (22.06%), Postives = 301/816 (36.89%), Query Frame = 2
Query:  284 VLEGKDVLMGCRVAHQQGKLQWAFKGKMLGFDRNIPTYPRMRMTGNAVIGDHSLFIENVKVSDSGNYECQLSPAASQP----PRRRMTKLTVLKV------PSTPIIYQNGQSNKQNISVSIKKDEFDSNINLTCVSLNGNPVPTFEWSVNRSPLKHGFKFRGNKVSIETINDTANSLSMKSSQIMNGDIVTCGVENNATRKMFNLTERIIKTQMRVFKRILPGKIVIKEVSDIEKTVYVTEGHQLQLSCVCNNPGDPPIDLKWNINEDDLMIAQDKILSVKSEHFSQNTFRMSNISRKWHRKELYCSGSQDNYAIPSSATVLILVNYPPSKIEMEAISIKTNVSLHNPSTVYCKEGQKVKLSCTSDNFFTDNVRILWFIKSSEESDWKPITTSFEKTVFTSDGRLKYITSSLEVPPSFVDKDISSHILSRLLSQVVCIVKSTEFNIEIRRQLKIELFEEPSVPVLTLNNLSKPQILTNGESAKLKCTVTGGHPTPQL------RLLDERDREMKSSNLHEIGITR------LEYNIEVKPRDNEKKFRCIVSYNNVMDFESASSELMALQVANPPKQLHMKIISSMDNLIANQNFEMQCHTDSSFPEAKIEWWWHHSCKSSHTLGIRSTSKDVRSLCQSEILNEPQNINYQKSTQSTFTSINVKLTPEFDLSFIECMIIPHEKWITINKVLSKLIKIRVRYPPQFLNVHKLPNDVQTFVVEKGNNFSIAIKSIAHPSINGYTWLVNK---QPMEKKIHIDTSVDKFSIVNAQPEMMANYSLLVENNLGKAAFDFFLNITYGPTLLGASQETIKVN 2656
            V+EG  V + C V+     +QWA  G +LG D  IP +PR R+ G+   G+  L IE   +SD   YECQ+  +   P    PR  ++ L   K+        T + +  GQ    N      K   D  I      L+G  +     +VN           G++  + T+  TA  ++ +SS   N  ++ C   + A        E  IK    V     PG  VI+     E   +V  G  L+L CV    G+P   L+W  N   +  A     +  ++  +++   M+ +  + H  +L C       A      + + V +PPS I +   + +T             E + V LSC S +     V + W++       W+ +    E+TV           S+L       D  ++          + C   S  F  E  ++  I   + P+   L +    + Q L  G   +L C   GG+P P L      R + E     +S  +H   + +       E  +   P DN+ KF C           SAS++L    V  PP   ++ I+++   L       + C + SS P   + W                  K+   L    +   P+   ++ S  +   S+ ++++       + C     E    + + +S   ++ V Y P+FL    L        VE+G    + +   A+P+   + W        P     H   S     + N        Y L  +N+ G A     L++ Y PT+  A Q+  +VN
Sbjct:   43 VVEGASVELRCGVSTPGSAVQWAKDGLLLGPDPRIPGFPRYRLEGDPARGEFHLHIEACDLSDDAEYECQVGRSEMGPELVSPRVILSILVPPKLLLLTPEAGTMVTWVAGQEYVVNCVSGDAKPAPDITI-----LLSGQTISDISANVN----------EGSQQKLFTVEATAR-VTPRSSD--NRQLLVCEASSPA-------LEAPIKASFTVNVLFPPGPPVIEWPGLDEG--HVRAGQSLELPCVARG-GNPLATLQWLKNGQPVSTAWG---TEHTQAVARSVLVMT-VRPEDHGAQLSCEAHNSVSAGTQEHGITLQVTFPPSAIIILGSASQT-------------ENKNVTLSCVSKS-SRPRVLLRWWL------GWRQL-LPMEETVMDGLHGGHISMSNLTFLARREDNGLT----------LTCEAFSEAFTKETFKKSLILNVKYPAQ-KLWIEGPPEGQKLRAGTRVRLVCLAIGGNPEPSLMWYKDSRTVTESRLPQESRRVHLGSVEKSGSTFSRELVLVTGPSDNQAKFTCKAGQ------LSASTQLA---VQFPPT--NVTILANASALRPGDALNLTCVSVSSNPPVNLSW-----------------DKEGERL--EGVAAPPRRAPFKGSAAA--RSVLLQVSSRDHGQRVTCRAHSAE----LRETVSSFYRLNVLYRPEFLGEQVL----VVTAVEQGEAL-LPVSVSANPAPEAFNWTFRGYRLSPAGGPRHRILSSGALHLWNVTRADDGLYQLHCQNSEGTAEARLRLDVHYAPTIR-ALQDPTEVN 752          
BLAST of NPHS1-1 vs. Ensembl Human
Match: NPHS1 (NPHS1 adhesion molecule, nephrin [Source:HGNC Symbol;Acc:HGNC:7908])

HSP 1 Score: 95.1301 bits (235), Expect = 9.673e-19
Identity = 180/816 (22.06%), Postives = 301/816 (36.89%), Query Frame = 2
Query:  284 VLEGKDVLMGCRVAHQQGKLQWAFKGKMLGFDRNIPTYPRMRMTGNAVIGDHSLFIENVKVSDSGNYECQLSPAASQP----PRRRMTKLTVLKV------PSTPIIYQNGQSNKQNISVSIKKDEFDSNINLTCVSLNGNPVPTFEWSVNRSPLKHGFKFRGNKVSIETINDTANSLSMKSSQIMNGDIVTCGVENNATRKMFNLTERIIKTQMRVFKRILPGKIVIKEVSDIEKTVYVTEGHQLQLSCVCNNPGDPPIDLKWNINEDDLMIAQDKILSVKSEHFSQNTFRMSNISRKWHRKELYCSGSQDNYAIPSSATVLILVNYPPSKIEMEAISIKTNVSLHNPSTVYCKEGQKVKLSCTSDNFFTDNVRILWFIKSSEESDWKPITTSFEKTVFTSDGRLKYITSSLEVPPSFVDKDISSHILSRLLSQVVCIVKSTEFNIEIRRQLKIELFEEPSVPVLTLNNLSKPQILTNGESAKLKCTVTGGHPTPQL------RLLDERDREMKSSNLHEIGITR------LEYNIEVKPRDNEKKFRCIVSYNNVMDFESASSELMALQVANPPKQLHMKIISSMDNLIANQNFEMQCHTDSSFPEAKIEWWWHHSCKSSHTLGIRSTSKDVRSLCQSEILNEPQNINYQKSTQSTFTSINVKLTPEFDLSFIECMIIPHEKWITINKVLSKLIKIRVRYPPQFLNVHKLPNDVQTFVVEKGNNFSIAIKSIAHPSINGYTWLVNK---QPMEKKIHIDTSVDKFSIVNAQPEMMANYSLLVENNLGKAAFDFFLNITYGPTLLGASQETIKVN 2656
            V+EG  V + C V+     +QWA  G +LG D  IP +PR R+ G+   G+  L IE   +SD   YECQ+  +   P    PR  ++ L   K+        T + +  GQ    N      K   D  I      L+G  +     +VN           G++  + T+  TA  ++ +SS   N  ++ C   + A        E  IK    V     PG  VI+     E   +V  G  L+L CV    G+P   L+W  N   +  A     +  ++  +++   M+ +  + H  +L C       A      + + V +PPS I +   + +T             E + V LSC S +     V + W++       W+ +    E+TV           S+L       D  ++          + C   S  F  E  ++  I   + P+   L +    + Q L  G   +L C   GG+P P L      R + E     +S  +H   + +       E  +   P DN+ KF C           SAS++L    V  PP   ++ I+++   L       + C + SS P   + W                  K+   L    +   P+   ++ S  +   S+ ++++       + C     E    + + +S   ++ V Y P+FL    L        VE+G    + +   A+P+   + W        P     H   S     + N        Y L  +N+ G A     L++ Y PT+  A Q+  +VN
Sbjct:   43 VVEGASVELRCGVSTPGSAVQWAKDGLLLGPDPRIPGFPRYRLEGDPARGEFHLHIEACDLSDDAEYECQVGRSEMGPELVSPRVILSILVPPKLLLLTPEAGTMVTWVAGQEYVVNCVSGDAKPAPDITI-----LLSGQTISDISANVN----------EGSQQKLFTVEATAR-VTPRSSD--NRQLLVCEASSPA-------LEAPIKASFTVNVLFPPGPPVIEWPGLDEG--HVRAGQSLELPCVARG-GNPLATLQWLKNGQPVSTAWG---TEHTQAVARSVLVMT-VRPEDHGAQLSCEAHNSVSAGTQEHGITLQVTFPPSAIIILGSASQT-------------ENKNVTLSCVSKS-SRPRVLLRWWL------GWRQL-LPMEETVMDGLHGGHISMSNLTFLARREDNGLT----------LTCEAFSEAFTKETFKKSLILNVKYPAQ-KLWIEGPPEGQKLRAGTRVRLVCLAIGGNPEPSLMWYKDSRTVTESRLPQESRRVHLGSVEKSGSTFSRELVLVTGPSDNQAKFTCKAGQ------LSASTQLA---VQFPPT--NVTILANASALRPGDALNLTCVSVSSNPPVNLSW-----------------DKEGERL--EGVAAPPRRAPFKGSAAA--RSVLLQVSSRDHGQRVTCRAHSAE----LRETVSSFYRLNVLYRPEFLGEQVL----VVTAVEQGEAL-LPVSVSANPAPEAFNWTFRGYRLSPAGGPRHRILSSGALHLWNVTRADDGLYQLHCQNSEGTAEARLRLDVHYAPTIR-ALQDPTEVN 752          
BLAST of NPHS1-1 vs. Ensembl Human
Match: KIRREL1 (kirre like nephrin family adhesion molecule 1 [Source:HGNC Symbol;Acc:HGNC:15734])

HSP 1 Score: 75.0998 bits (183), Expect = 8.286e-13
Identity = 56/201 (27.86%), Postives = 88/201 (43.78%), Query Frame = 2
Query:  284 VLEGKDVLMGCRVAHQQGKLQWAFKGKMLGFDRNIPTYPRMRMTGNAVIGDHSLFIENVKVSDSGNYECQLSPAASQPPRRRMTKLTVL------KVPSTPII-YQNGQSNKQNISVSIKKDEFDSNINLTCVSLNGNPVPTFEWSVNRSPLKHGFKFRGNKVSIETIND-----TANSLSMKSSQIMNGDIVTCGVENNA 850
            V+ G+  ++ C + +  G +QW   G  LG  + +  +PR R+ G+A  G ++L I + ++SD  +YECQ + AA    R R  KLTVL      ++   P+I  Q G  +                 NLTC + N  P  T  W       + G +  G   S E + D     T + L +  + +  G + TC   N A
Sbjct:   32 VVAGQRAVLPCVLLNYSGIVQWTKDGLALGMGQGLKAWPRYRVVGSADAGQYNLEITDAELSDDASYECQATEAAL---RSRRAKLTVLIPPEDTRIDGGPVILLQAGTPH-----------------NLTCRAFNAKPAATIIW------FRDGTQQEGAVASTELLKDGKRETTVSQLLINPTDLDIGRVFTCRSMNEA 206          
BLAST of NPHS1-1 vs. Ensembl Human
Match: KIRREL2 (kirre like nephrin family adhesion molecule 2 [Source:HGNC Symbol;Acc:HGNC:18816])

HSP 1 Score: 68.1662 bits (165), Expect = 5.603e-12
Identity = 51/159 (32.08%), Postives = 70/159 (44.03%), Query Frame = 2
Query:  251 CFR--ELPSPKY-------DVLEGKDVLMGCRVAHQQGKLQWAFKGKMLGFDRNIPTYPRMRMTGNAVIGDHSLFIENVKVSDSGNYECQLSPAASQPPRRRMTKLTVLKVPSTPIIYQNGQSNKQNISVSIKKDEFDSNINLTCVSL-NGNPVPTFEW 697
            CFR    PSP +        VL G++  + C +    G +QW   G  LG  R++P + R  ++GNA  G H L I  V++ D  +YECQ + A     R R  +L VL  P  P +           SVS+         NLTC S  +  P P   W
Sbjct:   15 CFRGRAGPSPHFLQQPEDLVVLLGEEARLPCALGAYWGLVQWTKSGLALGGQRDLPGWSRYWISGNAANGQHDLHIRPVELEDEASYECQATQAGL---RSRPAQLHVLVPPEAPQVL-------GGPSVSLVA---GVPANLTCRSRGDARPTPELLW 160          
BLAST of NPHS1-1 vs. Ensembl Human
Match: KIRREL3 (kirre like nephrin family adhesion molecule 3 [Source:HGNC Symbol;Acc:HGNC:23204])

HSP 1 Score: 72.4034 bits (176), Expect = 5.906e-12
Identity = 64/251 (25.50%), Postives = 102/251 (40.64%), Query Frame = 2
Query:  158 PFNVDDLDA-----AESISLSQSSTC-----TEKDDIHR-----IQCFRELPSPKYDVLEGKDVLMGCRVAHQQGKLQWAFKGKMLGFDRNIPTYPRMRMTGNAVIGDHSLFIENVKVSDSGNYECQLSPAASQPPRRRMTKLTVLKVPSTPIIYQNGQSNKQNISVSIKKDEFDSNINLTCVSLNGNPVPTFEWSVNRSPLKHGFKFRGNKVSIETIND-----TANSLSMKSSQIMNGDIVTCGVENNA 850
            PF +D L       ++ + L +   C       KD   R     +  F + P  +  V+ G+ V + C +    G + W   G  LG  R++ +YP+  + GN + G+H L I   ++ D   YECQ   AA    R R  +LTVL  P  P+I            +S++  +    +NLTC + N  P  +  W      L+ G    G   S   + D       ++L +    + NG  + C   N A
Sbjct:    3 PFQLDLLFVCFFLFSQELGLQKRGCCLVLGYMAKDKFRRMNEGQVYSFSQQPQDQV-VVSGQPVTLLCAIPEYDGFVLWIKDGLALGVGRDLSSYPQYLVVGNHLSGEHHLKILRAELQDDAVYECQAIQAAI---RSRPARLTVLVPPDDPVILGGP-------VISLRAGD---PLNLTCHADNAKPAASIIW------LRKGEVINGATYSKTLLRDGKRESIVSTLFISPGDVENGQSIVCRATNKA 233          
BLAST of NPHS1-1 vs. Ensembl Celegans
Match: syg-2 (Synaptogenesis protein syg-2 [Source:UniProtKB/Swiss-Prot;Acc:Q9U3P2])

HSP 1 Score: 135.961 bits (341), Expect = 1.198e-31
Identity = 262/1225 (21.39%), Postives = 470/1225 (38.37%), Query Frame = 2
Query:  248 QCFRELPSPKYDVLEGKDVLMGCRVAHQQGKL---QW-AFKGKMLGFDRN--IPTYPRMRMTGNAVIGDHSLFIENVKVSDSGNYECQ-LSPAASQPPRRRMTKLTVLKVPSTPIIYQNGQSNKQNISVSIKKDEFDSNINLTCVSLNGNPVPTFEWSVNRSPLKHGFKFRGNKVSIETINDT---ANSLSMKSSQIMNGDIVTCGVENNATRKMFNLTERIIKTQMRVFKRILPGKIVIKEVSDIEKTVYVTEGHQLQLSCVCNNPGDPPIDLKWNINEDDLMIAQDKILSVKSEHFSQNTFRMSNISRKWHRKELYCSGSQDNYAIPSSATVLILVNYPPSKIEMEAISIKTNVSLHNPSTVYCKEGQKVKLSCTSDNFFTDNVRILWFIKSSEESDWKPITTSFEKTVFTSDGRLKYITSSLEVPPSFVDKDISSHILSRLLSQVVCIVKSTEFNIEIRRQLKIELFEEPSVPVLTLNNLSKPQILTNGESAKLKCTVTGGHPTPQLRLLDERDREMKSSNLHEIGITRLEYNIEVKPRDNEKKFRCIVSYNNVMDFESASSELMALQVANPPKQLHMKIISSMDN-LIANQNFEMQCHTDSSFPEAKIEWWWHHSCKSSHTLGIRSTSKDVRSLCQSEILNEPQNINYQKSTQSTFTSINVKLTPEFDLSFIECMIIPHEKWITINKVLSKLIKIRVRYPPQFLNVHKLPNDVQTFVVEKGNNFSIAIKSIAHPSINGYTWLVNKQPMEKKIHIDTSVDKFSIVNAQPEMMAN----YSLLVENNLGKAAFDFFLNITYGPTLLGASQETIKVNPQMEHNHKAMIMCSAQANPSREQLTVEWIREISKILDQEELLDILKGQQKFISSDPIRCTNTHQWNKGKVNVNCISFGDVEIVTTMQIMPIDYRFIGSYRCIIKNSDKRPPAIKTIKLVYPT-RPNPVKNFRKSEFAAQIFGKSELFCYFIGFPVPTVKWMTFYKNESL--DNPVKYFTSVAQTEPGYFKAVLAISDTNESDLGKYI-CVAGNQYGESSHVVILNKPRSPTQPINFTVINVTETSVSVGWILRFNGGSKQQIKLYWRLRDT----VVNGDYQNANIFEDEEKDVQFFTIYNLYRNREYEISIISVNEYSPSAGIPKPIIIKTMNYVDPDPDSIHIQNDSKRGFNKQLEKRIEPVESNNFLIIILLATVGVLLLTIKIGLIVYFVRKRKLKHRKSREK 3853
            Q F E PS     + G+ +   C        +   QW +  G +LG+ +   +P +            +  L I +V + D G YECQ L P   + P R  + L ++ VP   + + N Q N      SI   + ++ +N+TCV  N  P P   W ++   +    K    + S   +N T     SL ++S +  +G ++TC        + F     I  T       + P      E+  +     +  G  + ++C     G+PP D+ W    ++  +     L  +S+   +N +     S+  +  E  C  +      P    + + VNYPP+ +E+     ++N+   + + + CK       S           +I W I        + + T  ++     +G    I SS  V     +  + +H ++     V C+  + E +    +Q  I++   P  P++T   L   +    G+   + C   GG+P  +L      ++   + N      +     + V    N ++ +C  + N  +D     S+   L V  PP+++ ++   S D  L+  ++  + C T SS P A I W +            R+T  +   L    +    ++  +      +FT      T E+D + + C I  H +W      ++    + V YPP+ L      ND  T V+ +G++F   +    +P+I+ + W  N  P +   H    V     V +  ++++     Y+L   N++G       L + Y   +   S   I            ++ C A   PS+  + + W +      + E L    +G +K I    +R   T Q +                              G Y C   N    P   +T  LV    R  PV  + K+  A  + G ++  C    + VPTV+++ + K+E L   N  KY     Q +   +++ L I +    D  K + C+A N +G     + +  P  P +P N T+ N T  ++SV W  RF+GGS Q  ++ +R ++     +VN  + N  +      +  FF I              S+N    ++    P+I  T+N               + G N  +  R E ++   ++  IL+  V  +LL +   +I  FV  R  K RK REK
Sbjct:   19 QFFLESPS-NLSTIAGESITFRCSAEKSPEPIVYSQWKSNTGSLLGYHQEGILPGHQGRFSYIKQNAEELHLKITHVNLDDDGEYECQMLHP--EEGPIRAKSFLNII-VPPQLVYFSNYQPN------SIIAVKENTPLNITCVVPNVKPEPEVLWYMDGKVMSRDVK----QASTPHLNKTFTVYTSLVVQSDRNDHGKVITC--------EAFQKETDIRITTNTTLDVLFPPSDPTVEI--LRNPSALRSGDNVTIACSVTG-GNPPPDVFWY--HENKRLQSHSTLDTRSKEI-KNIYSFI-ASQNDNMAEYECRANNSRTGNPKRKAMKLEVNYPPASVELFG---ESNIRYGSSANIQCKSLPSNPAS-----------QITWIING------RSVPTPTQREFVVENG----IVSSSNVSVHSNELSVEAHQIN-----VECMATNPEGSSA--KQHVIKIIAPPKAPIIT--GLEDRKFF-EGDIVNVTCEAQGGNPLAELSWYRGSEKVNGAHNEVAGFSSYSTLALRVDRTMNTQRLKCEAT-NAALDEPLIESQY--LSVYYPPRRVLIRPADSGDQRLLVGKSARLVCGTLSSNPAAHISWQFS-----------RATDDNKVHLGDVSLNETTRDNGFNVENVLSFTP-----TEEYDGTVVHC-IANHPEW---KHSVNTSFPLNVMYPPKML-----VNDPVTVVMSEGDSFKENLTVRGNPAISLWQWRKNGVPFD---HTIGRVFARGAVLSGKQLLSTDAGVYTLTATNSVGSTNITIKLAVEYSARITSISTPVIAAT-----GDTVLLECEADGEPSKANM-IHWYK------NGEILAAQHRGHKKAI----LRLNATEQQS------------------------------GEYTCKADNGIGVPAEGQTFLLVNSAPRVLPVARYAKT--AGILGGVAKARCKV--YAVPTVEFV-WEKDEQLIKKNSSKYSIVNTQIDYSTYESTLWIKNIVPDDYTKKVKCIARNSFGTDHLSIPIIPPTHPDEPFNLTMTNSTLNTISVAWEPRFDGGSDQIFEVKYRRQNDDLIHLVNTTHTNLRLSGLATANTYFFQIR-------------SINARGFASSWTSPVIFATLN---------------EDGVNVAM-IRNEKLKLTTWIPYILIFIVLFMLLNV---VICCFVCNRT-KKRKLREK 1065          
BLAST of NPHS1-1 vs. Ensembl Celegans
Match: syg-2 (Synaptogenesis protein syg-2 [Source:UniProtKB/Swiss-Prot;Acc:Q9U3P2])

HSP 1 Score: 132.88 bits (333), Expect = 8.752e-31
Identity = 266/1238 (21.49%), Postives = 477/1238 (38.53%), Query Frame = 2
Query:  248 QCFRELPSPKYDVLEGKDVLMGCRVAHQQGKL---QW-AFKGKMLGFDRN--IPTYPRMRMTGNAVIGDHSLFIENVKVSDSGNYECQ-LSPAASQPPRRRMTKLTVLKVPSTPIIYQNGQSNKQNISVSIKKDEFDSNINLTCVSLNGNPVPTFEWSVNRSPLKHGFKFRGNKVSIETINDT---ANSLSMKSSQIMNGDIVTCGVENNATRKMFNLTERIIKTQMRVFKRILPGKIVIKEVSDIEKTVYVTEGHQLQLSCVCNNPGDPPIDLKWNINEDDLMIAQDKILSVKSEHFSQNTFRMSNISRKWHRKELYCSGSQDNYAIPSSATVLILVNYPPSKIEMEAISIKTNVSLHNPSTVYCKEGQKVKLSCTSDNFFTDNVRILWFIKSSEESDWKPITTSFEKTVFTSDGRLKYITSSLEVPPSFVDKDISSHILSRLLSQVVCIVKSTEFNIEIRRQLKIELFEEPSVPVLTLNNLSKPQILTNGESAKLKCTVTGGHPTPQL-------RLLDERDREMKSSNLHEI-----GITRLE-YNIEVKPRDNEKKFRCIVSYNNVMDFESASSELMALQVANPPKQLHMKIISSMDN-LIANQNFEMQCHTDSSFPEAKIEWWWHHSCKSSHTLGIRSTSKDVRSLCQSEILNEPQNINYQKSTQSTFTSINVKLTPEFDLSFIECMIIPHEKWITINKVLSKLIKIRVRYPPQFLNVHKLPNDVQTFVVEKGNNFSIAIKSIAHPSINGYTWLVNKQPMEKKIHIDTSVDKFSIVNAQPEMMAN----YSLLVENNLGKAAFDFFLNITYGPTLLGASQETIKVNPQMEHNHKAMIMCSAQANPSREQLTVEWIREISKILDQEELLDILKGQQKFISSDPIRCTNTHQWNKGKVNVNCISFGDVEIVTTMQIMPIDYRFIGSYRCIIKNSDKRPPAIKTIKLVYPT-RPNPVKNFRKSEFAAQIFGKSELFCYFIGFPVPTVKWMTFYKNESL--DNPVKYFTSVAQTEPGYFKAVLAISDTNESDLGKYI-CVAGNQYGESSHVVILNKPRSPTQPINFTVINVTETSVSVGWILRFNGGSKQQIKLYWRLRDT----VVNGDYQNANIFEDEEKDVQFFTIYNLYRNREYEISIISVNEYSPSAGIPKPIIIKTMNYVDPDPDSIHIQNDSKRGFNKQLEKRIEPVESNNFLIIILLATVGVLLLTIKIGLIVYFVRKRKLKHRKSREK 3853
            Q F E PS     + G+ +   C        +   QW +  G +LG+ +   +P +            +  L I +V + D G YECQ L P   + P R  + L ++ VP   + + N Q N      SI   + ++ +N+TCV  N  P P   W ++   +    K    + S   +N T     SL ++S +  +G ++TC        + F     I  T       + P      E+  +     +  G  + ++C     G+PP D+ W    ++  +     L  +S+   +N +     S+  +  E  C  +      P    + + VNYPP+ +E+     ++N+   + + + CK       S           +I W I        + + T  ++     +G    I SS  V     +  + +H ++     V C+  + E +    +Q  I++   P  P++T   L   +    G+   + C   GG+P  +L       + L +  ++MK S ++       G +      + V    N ++ +C  + N  +D     S+   L V  PP+++ ++   S D  L+  ++  + C T SS P A I W +            R+T  +   L    +    ++  +      +FT      T E+D + + C I  H +W      ++    + V YPP+ L      ND  T V+ +G++F   +    +P+I+ + W  N  P +   H    V     V +  ++++     Y+L   N++G       L + Y   +   S   I            ++ C A   PS+  + + W +      + E L    +G +K I    +R   T Q +                              G Y C   N    P   +T  LV    R  PV  + K+  A  + G ++  C    + VPTV+++ + K+E L   N  KY     Q +   +++ L I +    D  K + C+A N +G     + +  P  P +P N T+ N T  ++SV W  RF+GGS Q  ++ +R ++     +VN  + N  +      +  FF I              S+N    ++    P+I  T+N               + G N  +  R E ++   ++  IL+  V  +LL +   +I  FV  R  K RK REK
Sbjct:   19 QFFLESPS-NLSTIAGESITFRCSAEKSPEPIVYSQWKSNTGSLLGYHQEGILPGHQGRFSYIKQNAEELHLKITHVNLDDDGEYECQMLHP--EEGPIRAKSFLNII-VPPQLVYFSNYQPN------SIIAVKENTPLNITCVVPNVKPEPEVLWYMDGKVMSRDVK----QASTPHLNKTFTVYTSLVVQSDRNDHGKVITC--------EAFQKETDIRITTNTTLDVLFPPSDPTVEI--LRNPSALRSGDNVTIACSVTG-GNPPPDVFWY--HENKRLQSHSTLDTRSKEI-KNIYSFI-ASQNDNMAEYECRANNSRTGNPKRKAMKLEVNYPPASVELFG---ESNIRYGSSANIQCKSLPSNPAS-----------QITWIING------RSVPTPTQREFVVENG----IVSSSNVSVHSNELSVEAHQIN-----VECMATNPEGSSA--KQHVIKIIAPPKAPIIT--GLEDRKFF-EGDIVNVTCEAQGGNPLAELSWYRGSEKHLVKGRKKMKWSQVNGAHNEVAGFSSYSTLALRVDRTMNTQRLKCEAT-NAALDEPLIESQY--LSVYYPPRRVLIRPADSGDQRLLVGKSARLVCGTLSSNPAAHISWQFS-----------RATDDNKVHLGDVSLNETTRDNGFNVENVLSFTP-----TEEYDGTVVHC-IANHPEW---KHSVNTSFPLNVMYPPKML-----VNDPVTVVMSEGDSFKENLTVRGNPAISLWQWRKNGVPFD---HTIGRVFARGAVLSGKQLLSTDAGVYTLTATNSVGSTNITIKLAVEYSARITSISTPVIAAT-----GDTVLLECEADGEPSKANM-IHWYK------NGEILAAQHRGHKKAI----LRLNATEQQS------------------------------GEYTCKADNGIGVPAEGQTFLLVNSAPRVLPVARYAKT--AGILGGVAKARCKV--YAVPTVEFV-WEKDEQLIKKNSSKYSIVNTQIDYSTYESTLWIKNIVPDDYTKKVKCIARNSFGTDHLSIPIIPPTHPDEPFNLTMTNSTLNTISVAWEPRFDGGSDQIFEVKYRRQNDDLIHLVNTTHTNLRLSGLATANTYFFQIR-------------SINARGFASSWTSPVIFATLN---------------EDGVNVAM-IRNEKLKLTTWIPYILIFIVLFMLLNV---VICCFVCNRT-KKRKLREK 1078          
BLAST of NPHS1-1 vs. Ensembl Celegans
Match: syg-2 (Synaptogenesis protein syg-2 [Source:UniProtKB/Swiss-Prot;Acc:Q9U3P2])

HSP 1 Score: 109.768 bits (273), Expect = 9.643e-24
Identity = 194/910 (21.32%), Postives = 348/910 (38.24%), Query Frame = 2
Query: 1163 ELYCSGSQDNYAIPSSATVLILVNYPPSKIEMEAISIKTNVSLHNPSTVYCKEGQKVKLSCTSDNFFTDNVRILWFIKSSEESDWKPITTSFEKTVFTSDGRLKYITSSLEVPPSFVDKDISSHILSRLLSQVVCIVKSTEFNIEIRRQLKIELFEEPSVPVLTLNNLSKPQILTNGESAKLKCTVTGGHPTPQLRLLDERDREMKSSNLHEIGITRLEYNIEVKPRDNEKKFRCIVSYNNVMDFESASSELMALQVANPPKQLHMKIISSMDN-LIANQNFEMQCHTDSSFPEAKIEWWWHHSCKSSHTLGIRSTSKDVRSLCQSEILNEPQNINYQKSTQSTFTSINVKLTPEFDLSFIECMIIPHEKWITINKVLSKLIKIRVRYPPQFLNVHKLPNDVQTFVVEKGNNFSIAIKSIAHPSINGYTWLVNKQPMEKKIHIDTSVDKFSIVNAQPEMMAN----YSLLVENNLGKAAFDFFLNITYGPTLLGASQETIKVNPQMEHNHKAMIMCSAQANPSREQLTVEWIREISKILDQEELLDILKGQQKFISSDPIRCTNTHQWNKGKVNVNCISFGDVEIVTTMQIMPIDYRFIGSYRCIIKNSDKRPPAIKTIKLVYPT-RPNPVKNFRKSEFAAQIFGKSELFCYFIGFPVPTVKWMTFYKNESL--DNPVKYFTSVAQTEPGYFKAVLAISDTNESDLGKYI-CVAGNQYGESSHVVILNKPRSPTQPINFTVINVTETSVSVGWILRFNGGSKQQIKLYWRLRDT----VVNGDYQNANIFEDEEKDVQFFTIYNLYRNREYEISIISVNEYSPSAGIPKPIIIKTMNYVDPDPDSIHIQNDSKRGFNKQLEKRIEPVESNNFLIIILLATVGVLLLTIKIGLIVYFVRKRKLKHRKSREK 3853
            E  C  +      P    + + VNYPP+ +E+     ++N+   + + + CK       S           +I W I        + + T  ++     +G    I SS  V     +  + +H ++     V C+  + E +    +Q  I++   P  P++T   L   +    G+   + C   GG+P  +L      ++   + N      +     + V    N ++ +C  + N  +D     S+   L V  PP+++ ++   S D  L+  ++  + C T SS P A I W +            R+T  +   L    +    ++  +      +FT      T E+D + + C I  H +W      ++    + V YPP+ L      ND  T V+ +G++F   +    +P+I+ + W  N  P +   H    V     V +  ++++     Y+L   N++G       L + Y   +   S   I            ++ C A   PS+  + + W +      + E L    +G +K I    +R   T Q +                              G Y C   N    P   +T  LV    R  PV  + K+  A  + G ++  C    + VPTV+++ + K+E L   N  KY     Q +   +++ L I +    D  K + C+A N +G     + +  P  P +P N T+ N T  ++SV W  RF+GGS Q  ++ +R ++     +VN  + N  +      +  FF I              S+N    ++    P+I  T+N               + G N  +  R E ++   ++  IL+  V  +LL +   +I  FV  R  K RK REK
Sbjct:    3 EYECRANNSRTGNPKRKAMKLEVNYPPASVELFG---ESNIRYGSSANIQCKSLPSNPAS-----------QITWIING------RSVPTPTQREFVVENG----IVSSSNVSVHSNELSVEAHQIN-----VECMATNPEGSSA--KQHVIKIIAPPKAPIIT--GLEDRKFF-EGDIVNVTCEAQGGNPLAELSWYRGSEKVNGAHNEVAGFSSYSTLALRVDRTMNTQRLKCEAT-NAALDEPLIESQY--LSVYYPPRRVLIRPADSGDQRLLVGKSARLVCGTLSSNPAAHISWQFS-----------RATDDNKVHLGDVSLNETTRDNGFNVENVLSFTP-----TEEYDGTVVHC-IANHPEW---KHSVNTSFPLNVMYPPKML-----VNDPVTVVMSEGDSFKENLTVRGNPAISLWQWRKNGVPFD---HTIGRVFARGAVLSGKQLLSTDAGVYTLTATNSVGSTNITIKLAVEYSARITSISTPVIAAT-----GDTVLLECEADGEPSKANM-IHWYK------NGEILAAQHRGHKKAI----LRLNATEQQS------------------------------GEYTCKADNGIGVPAEGQTFLLVNSAPRVLPVARYAKT--AGILGGVAKARCKV--YAVPTVEFV-WEKDEQLIKKNSSKYSIVNTQIDYSTYESTLWIKNIVPDDYTKKVKCIARNSFGTDHLSIPIIPPTHPDEPFNLTMTNSTLNTISVAWEPRFDGGSDQIFEVKYRRQNDDLIHLVNTTHTNLRLSGLATANTYFFQIR-------------SINARGFASSWTSPVIFATLN---------------EDGVNVAM-IRNEKLKLTTWIPYILIFIVLFMLLNV---VICCFVCNRT-KKRKLREK 763          
BLAST of NPHS1-1 vs. Ensembl Celegans
Match: syg-2 (Synaptogenesis protein syg-2 [Source:UniProtKB/Swiss-Prot;Acc:Q9U3P2])

HSP 1 Score: 107.071 bits (266), Expect = 5.715e-23
Identity = 198/923 (21.45%), Postives = 355/923 (38.46%), Query Frame = 2
Query: 1163 ELYCSGSQDNYAIPSSATVLILVNYPPSKIEMEAISIKTNVSLHNPSTVYCKEGQKVKLSCTSDNFFTDNVRILWFIKSSEESDWKPITTSFEKTVFTSDGRLKYITSSLEVPPSFVDKDISSHILSRLLSQVVCIVKSTEFNIEIRRQLKIELFEEPSVPVLTLNNLSKPQILTNGESAKLKCTVTGGHPTPQL-------RLLDERDREMKSSNLHEI-----GITRLE-YNIEVKPRDNEKKFRCIVSYNNVMDFESASSELMALQVANPPKQLHMKIISSMDN-LIANQNFEMQCHTDSSFPEAKIEWWWHHSCKSSHTLGIRSTSKDVRSLCQSEILNEPQNINYQKSTQSTFTSINVKLTPEFDLSFIECMIIPHEKWITINKVLSKLIKIRVRYPPQFLNVHKLPNDVQTFVVEKGNNFSIAIKSIAHPSINGYTWLVNKQPMEKKIHIDTSVDKFSIVNAQPEMMAN----YSLLVENNLGKAAFDFFLNITYGPTLLGASQETIKVNPQMEHNHKAMIMCSAQANPSREQLTVEWIREISKILDQEELLDILKGQQKFISSDPIRCTNTHQWNKGKVNVNCISFGDVEIVTTMQIMPIDYRFIGSYRCIIKNSDKRPPAIKTIKLVYPT-RPNPVKNFRKSEFAAQIFGKSELFCYFIGFPVPTVKWMTFYKNESL--DNPVKYFTSVAQTEPGYFKAVLAISDTNESDLGKYI-CVAGNQYGESSHVVILNKPRSPTQPINFTVINVTETSVSVGWILRFNGGSKQQIKLYWRLRDT----VVNGDYQNANIFEDEEKDVQFFTIYNLYRNREYEISIISVNEYSPSAGIPKPIIIKTMNYVDPDPDSIHIQNDSKRGFNKQLEKRIEPVESNNFLIIILLATVGVLLLTIKIGLIVYFVRKRKLKHRKSREK 3853
            E  C  +      P    + + VNYPP+ +E+     ++N+   + + + CK       S           +I W I        + + T  ++     +G    I SS  V     +  + +H ++     V C+  + E +    +Q  I++   P  P++T   L   +    G+   + C   GG+P  +L       + L +  ++MK S ++       G +      + V    N ++ +C  + N  +D     S+   L V  PP+++ ++   S D  L+  ++  + C T SS P A I W +            R+T  +   L    +    ++  +      +FT      T E+D + + C I  H +W      ++    + V YPP+ L      ND  T V+ +G++F   +    +P+I+ + W  N  P +   H    V     V +  ++++     Y+L   N++G       L + Y   +   S   I            ++ C A   PS+  + + W +      + E L    +G +K I    +R   T Q +                              G Y C   N    P   +T  LV    R  PV  + K+  A  + G ++  C    + VPTV+++ + K+E L   N  KY     Q +   +++ L I +    D  K + C+A N +G     + +  P  P +P N T+ N T  ++SV W  RF+GGS Q  ++ +R ++     +VN  + N  +      +  FF I              S+N    ++    P+I  T+N               + G N  +  R E ++   ++  IL+  V  +LL +   +I  FV  R  K RK REK
Sbjct:    3 EYECRANNSRTGNPKRKAMKLEVNYPPASVELFG---ESNIRYGSSANIQCKSLPSNPAS-----------QITWIING------RSVPTPTQREFVVENG----IVSSSNVSVHSNELSVEAHQIN-----VECMATNPEGSSA--KQHVIKIIAPPKAPIIT--GLEDRKFF-EGDIVNVTCEAQGGNPLAELSWYRGSEKHLVKGRKKMKWSQVNGAHNEVAGFSSYSTLALRVDRTMNTQRLKCEAT-NAALDEPLIESQY--LSVYYPPRRVLIRPADSGDQRLLVGKSARLVCGTLSSNPAAHISWQFS-----------RATDDNKVHLGDVSLNETTRDNGFNVENVLSFTP-----TEEYDGTVVHC-IANHPEW---KHSVNTSFPLNVMYPPKML-----VNDPVTVVMSEGDSFKENLTVRGNPAISLWQWRKNGVPFD---HTIGRVFARGAVLSGKQLLSTDAGVYTLTATNSVGSTNITIKLAVEYSARITSISTPVIAAT-----GDTVLLECEADGEPSKANM-IHWYK------NGEILAAQHRGHKKAI----LRLNATEQQS------------------------------GEYTCKADNGIGVPAEGQTFLLVNSAPRVLPVARYAKT--AGILGGVAKARCKV--YAVPTVEFV-WEKDEQLIKKNSSKYSIVNTQIDYSTYESTLWIKNIVPDDYTKKVKCIARNSFGTDHLSIPIIPPTHPDEPFNLTMTNSTLNTISVAWEPRFDGGSDQIFEVKYRRQNDDLIHLVNTTHTNLRLSGLATANTYFFQIR-------------SINARGFASSWTSPVIFATLN---------------EDGVNVAM-IRNEKLKLTTWIPYILIFIVLFMLLNV---VICCFVCNRT-KKRKLREK 776          
BLAST of NPHS1-1 vs. Ensembl Celegans
Match: syg-2 (Synaptogenesis protein syg-2 [Source:UniProtKB/Swiss-Prot;Acc:Q9U3P2])

HSP 1 Score: 100.523 bits (249), Expect = 5.297e-21
Identity = 154/682 (22.58%), Postives = 268/682 (39.30%), Query Frame = 2
Query: 1847 NEKKFRCIVSYNNVMDFESASSELMALQVANPPKQLHMKIISSMDN-LIANQNFEMQCHTDSSFPEAKIEWWWHHSCKSSHTLGIRSTSKDVRSLCQSEILNEPQNINYQKSTQSTFTSINVKLTPEFDLSFIECMIIPHEKWITINKVLSKLIKIRVRYPPQFLNVHKLPNDVQTFVVEKGNNFSIAIKSIAHPSINGYTWLVNKQPMEKKIHIDTSVDKFSIVNAQPEMMAN----YSLLVENNLGKAAFDFFLNITYGPTLLGASQETIKVNPQMEHNHKAMIMCSAQANPSREQLTVEWIREISKILDQEELLDILKGQQKFISSDPIRCTNTHQWNKGKVNVNCISFGDVEIVTTMQIMPIDYRFIGSYRCIIKNSDKRPPAIKTIKLVYPT-RPNPVKNFRKSEFAAQIFGKSELFCYFIGFPVPTVKWMTFYKNESL--DNPVKYFTSVAQTEPGYFKAVLAISDTNESDLGKYI-CVAGNQYGESSHVVILNKPRSPTQPINFTVINVTETSVSVGWILRFNGGSKQQIKLYWRLRDT----VVNGDYQNANIFEDEEKDVQFFTIYNLYRNREYEISIISVNEYSPSAGIPKPIIIKTMNYVDPDPDSIHIQNDSKRGFNKQLEKRIEPVESNNFLIIILLATVGVLLLTIKIGLIVYFVRKRKLKHRKSREK 3853
            N ++ +C  + N  +D     S+   L V  PP+++ ++   S D  L+  ++  + C T SS P A I W +            R+T  +   L    +    ++  +      +FT      T E+D + + C I  H +W      ++    + V YPP+ L      ND  T V+ +G++F   +    +P+I+ + W  N  P +   H    V     V +  ++++     Y+L   N++G       L + Y   +   S   I            ++ C A   PS+  + + W +   +IL  +      +G +K I    +R   T Q +                              G Y C   N    P   +T  LV    R  PV  + K+  A  + G ++  C    + VPTV+++ + K+E L   N  KY     Q +   +++ L I +    D  K + C+A N +G     + +  P  P +P N T+ N T  ++SV W  RF+GGS Q  ++ +R ++     +VN  + N  +      +  FF I              S+N    ++    P+I  T+N               + G N  +  R E ++   ++  IL+  V  +LL +   +I  FV  R  K RK REK
Sbjct:    2 NTQRLKCEAT-NAALDEPLIESQY--LSVYYPPRRVLIRPADSGDQRLLVGKSARLVCGTLSSNPAAHISWQFS-----------RATDDNKVHLGDVSLNETTRDNGFNVENVLSFTP-----TEEYDGTVVHC-IANHPEW---KHSVNTSFPLNVMYPPKML-----VNDPVTVVMSEGDSFKENLTVRGNPAISLWQWRKNGVPFD---HTIGRVFARGAVLSGKQLLSTDAGVYTLTATNSVGSTNITIKLAVEYSARITSISTPVIAAT-----GDTVLLECEADGEPSKANM-IHWYKN-GEILAAQH-----RGHKKAI----LRLNATEQQS------------------------------GEYTCKADNGIGVPAEGQTFLLVNSAPRVLPVARYAKT--AGILGGVAKARCKV--YAVPTVEFV-WEKDEQLIKKNSSKYSIVNTQIDYSTYESTLWIKNIVPDDYTKKVKCIARNSFGTDHLSIPIIPPTHPDEPFNLTMTNSTLNTISVAWEPRFDGGSDQIFEVKYRRQNDDLIHLVNTTHTNLRLSGLATANTYFFQIR-------------SINARGFASSWTSPVIFATLN---------------EDGVNVAM-IRNEKLKLTTWIPYILIFIVLFMLLNV---VICCFVCNRT-KKRKLREK 568          
BLAST of NPHS1-1 vs. Ensembl Fly
Match: hbs (gene:FBgn0029082 transcript:FBtr0087414)

HSP 1 Score: 248.44 bits (633), Expect = 1.997e-66
Identity = 280/1208 (23.18%), Postives = 491/1208 (40.65%), Query Frame = 2
Query:  284 VLEGKDVLMGCRVAHQQGKLQWAFKGKMLGFDRNIPTYPRMRMTGNAVIGDHSLFIENVKVSDSGNYECQLSPAASQPPRRRMTKLTVLKVPSTPIIYQNGQSNKQNISVSIKKDEFDSNINLTCVSLNGNPVPTFEWSVNRSPLKHGFKFRGNKVSIETINDTA-------NSLSMKSSQIMNGDIVTCGVENNATRKMFNLTERIIKTQMRVFKRILPGKIVIKEVSDIEKTVYVTEGHQLQLSCVCNNPGDPPIDLKWNINEDDLMIAQDKILSVKSEHFSQNTFRMSNISRKWHRKELYCSGSQDNYAIPSSATVLILVNYPPSKIEMEAISIKTNVSLHNPSTVYCKEGQKVKLSCTSDNFFTDNVRILWFIKSSEESDWKPITTSFEKTVFTSDGRLKYITSSLEVPPSFVDKDISSHILSRLLSQV-VCIVKSTEFNIEIRRQLKIELFEEPSVPVLTLNNLSKPQILTNGESAKLKCTVTGGHPTPQLRLLDERDREMKSSNLHEIGITRLEYNIEVKPRDNEKKFRCIVSYNNVMDFESASSELMALQVANPPKQLHMKIISSMDNLIANQNFEMQCHTDSSFPEAKIEWWWHHSCKSSHTLGIRSTSKDVRSLCQSEILNEPQNINYQKSTQSTFTSINVKLTPEFDLSFIECMIIPHEKWITINKVLSKLIKIRVRYPPQFLNVHKLPNDVQTFVVEKGNNFSIAIKSIAHPSINGYTWLVNKQPMEKKIHIDTSVDKFSIVNAQPEMMANYSLLVENNL-----------GKAAFDFFLNITYGPTLLGASQETIKVNPQMEHNHKAMIMCSAQANPSREQLTVEWIREISKILDQEELLDILKGQQKFISSDPIRCTNTHQWNKGKVNVNCISFGDVEIVTTMQIMPIDYRFIGSYRCIIKNSDKRPPAIKTIKLVYPTRPNPVKNFRKSEFAAQIFGKSELFCYFIGFPVPTVKWMTFYKNESLDNPVKYFTSVAQTEPGYFKAVLAISDTNESDLGKYICVAGNQYGESSHVVILNKPRSPTQPINFTVINVTETSVSVGWILRFNGGSKQQIKLYWRLRDTVVNGDYQNANIFEDEEKDVQFFTIYNLYRNREYEISIISVNEYSPSAGIPKPIIIKTMNYVDPDPDSIHIQNDSKRGFNKQLEKRIEPVESNNFLIIILLATVGVLLLTIKIGLIVYFVRKRKLKHRKSRE 3850
            +LEG D L+ C V+++ GK+QW   G  LGF   IP +PR  +  +A    ++L I+N  + D   Y+CQ+ PAA  P  R   KL+++  PS+ +I    +   +N  V +++ +   N+ L C++ N NP     W     P+        +   I T+N TA       ++L ++     +    +C   + A        +  ++ Q+++     PG    +  S  E    +  G ++Q++C     G+PP  L W  N   +   Q       S   S+N ++ +  +   +   L C         P  A + + V Y P  + +   +               K G  V+LSC +        RI W I        +P+  S  KT  +SDG   +++SS          +IS  I S+  + + VC   +TE    +     + +   PS P+LT  N     IL +G   KL+C+  GG+P P L+           S L +  IT  E ++ V   DN   ++C V  N  +D    +++ + +    PP+ + + ++    NL+     ++ C + SS P AKI WW                 KD   +    + N P       ST   +    V +T + D     C    H +   + + + + I + + YPP+F    + P    TFV  +G  F + + +  +P +  YTW  +  P+        S+    +++  P +  N S L  N+            G A  +  + + Y PT+   S+    V         A++ C  QA P  E   V W R      D  +L        + ISS          +  G                 +QI  ++   IG++ CI+ N  +  PA + + LV  T P    +   + +AA++  +++L C  +  P P+  W    K+  +    K+ +   Q +   F++ L I +T+  D G+Y CV  N  G++S  +  +KP  P  P+   V NV++T V + W   F+GG    ++ Y+RLR   +    ++   + D +   Q  ++  L     Y  S+++ NE   S  +P                   I+    +G      +  E  E  N ++II + +  ++LL +   L+ +FV +R+ K +   E
Sbjct:   50 ILEGTDTLLRCEVSNRAGKVQWTKDGFALGFSAVIPGFPRYSVLVDAKQNAYNLQIKNATLEDDAEYQCQVGPAAGNPAIRANAKLSIVAAPSSIVI----EGYARNARVEVEERQ---NLTLHCIAENANPAAEIVWFQGEVPV--------STAPIVTVNQTAPKRFTTSSTLHLQPRAEDDYKEFSCEARHKALPP-----DVPMRAQVQLSVLYPPGAPFFEGYSQGET---LHRGQEVQIACRSRG-GNPPAQLTWYRNGVAISSPQRT-----SGRLSENVYKFTAAAED-NGANLVCEAKNLLATTPLRAELNLTVLYAPKDVYLSGAN-------------QAKVGDSVQLSCVTAPS-NPQARISWSING------RPLDNSTYKTTSSSDG--GWVSSS----------NISLTIDSQSRTFIAVCHALNTELTQNVVGSHTVNVLYPPSPPLLTGYN--DGDILISGSILKLQCSSAGGNPPPTLQWYKNDKIINAPSKLVDSKITS-ELSLLVNASDNNAIYKCKVQ-NAAIDIPLFATKTLGVHF--PPETVKISVVPK--NLVPGIRAKLICDSSSSNPPAKISWW-----------------KDGIPVEGLNLANRPGLWGGSVSTLEMY----VNITQDLDGIVYTCQ--SHNE--VLQRSVHETISLDILYPPKF----ETPQST-TFVGVEGAPFHVELLASGNPMVITYTWTKDGLPISSN-----SLSGQRLISDGPRL--NISRLSRNDAGVYICEALNSQGTALLEIQVAVEYAPTITAVSEGRSFV-----AGEPAVLACHIQARP-LEAAHVRWSR------DGYDL------ATRTISS----------FENG--------------TALLQIASVERSDIGNFTCIVDN-QRGAPAAQNVLLVVQTAPEIDHSPGFTRYAARLGVRAQLICRSLASPQPSFIWRRHGKDLKMQRRNKFKSVERQVDALNFESALLIENTSPDDYGQYECVVRNSLGQASTTLEFSKPSRPDAPLQLRVGNVSDTGVDLNWTPGFDGG----MQTYFRLR---LKQHGEDKYKYVDAKPGHQNISLDGLKPGATYYFSVMAANEAGGSKFMPD------------------IKLTLSKGSQPHSAEYTEKDELPN-VMIIGITSAAMVLLVLNAALVAWFVIRRQNKSQSEAE 1081          
BLAST of NPHS1-1 vs. Ensembl Fly
Match: hbs (gene:FBgn0029082 transcript:FBtr0345419)

HSP 1 Score: 248.44 bits (633), Expect = 1.997e-66
Identity = 280/1208 (23.18%), Postives = 491/1208 (40.65%), Query Frame = 2
Query:  284 VLEGKDVLMGCRVAHQQGKLQWAFKGKMLGFDRNIPTYPRMRMTGNAVIGDHSLFIENVKVSDSGNYECQLSPAASQPPRRRMTKLTVLKVPSTPIIYQNGQSNKQNISVSIKKDEFDSNINLTCVSLNGNPVPTFEWSVNRSPLKHGFKFRGNKVSIETINDTA-------NSLSMKSSQIMNGDIVTCGVENNATRKMFNLTERIIKTQMRVFKRILPGKIVIKEVSDIEKTVYVTEGHQLQLSCVCNNPGDPPIDLKWNINEDDLMIAQDKILSVKSEHFSQNTFRMSNISRKWHRKELYCSGSQDNYAIPSSATVLILVNYPPSKIEMEAISIKTNVSLHNPSTVYCKEGQKVKLSCTSDNFFTDNVRILWFIKSSEESDWKPITTSFEKTVFTSDGRLKYITSSLEVPPSFVDKDISSHILSRLLSQV-VCIVKSTEFNIEIRRQLKIELFEEPSVPVLTLNNLSKPQILTNGESAKLKCTVTGGHPTPQLRLLDERDREMKSSNLHEIGITRLEYNIEVKPRDNEKKFRCIVSYNNVMDFESASSELMALQVANPPKQLHMKIISSMDNLIANQNFEMQCHTDSSFPEAKIEWWWHHSCKSSHTLGIRSTSKDVRSLCQSEILNEPQNINYQKSTQSTFTSINVKLTPEFDLSFIECMIIPHEKWITINKVLSKLIKIRVRYPPQFLNVHKLPNDVQTFVVEKGNNFSIAIKSIAHPSINGYTWLVNKQPMEKKIHIDTSVDKFSIVNAQPEMMANYSLLVENNL-----------GKAAFDFFLNITYGPTLLGASQETIKVNPQMEHNHKAMIMCSAQANPSREQLTVEWIREISKILDQEELLDILKGQQKFISSDPIRCTNTHQWNKGKVNVNCISFGDVEIVTTMQIMPIDYRFIGSYRCIIKNSDKRPPAIKTIKLVYPTRPNPVKNFRKSEFAAQIFGKSELFCYFIGFPVPTVKWMTFYKNESLDNPVKYFTSVAQTEPGYFKAVLAISDTNESDLGKYICVAGNQYGESSHVVILNKPRSPTQPINFTVINVTETSVSVGWILRFNGGSKQQIKLYWRLRDTVVNGDYQNANIFEDEEKDVQFFTIYNLYRNREYEISIISVNEYSPSAGIPKPIIIKTMNYVDPDPDSIHIQNDSKRGFNKQLEKRIEPVESNNFLIIILLATVGVLLLTIKIGLIVYFVRKRKLKHRKSRE 3850
            +LEG D L+ C V+++ GK+QW   G  LGF   IP +PR  +  +A    ++L I+N  + D   Y+CQ+ PAA  P  R   KL+++  PS+ +I    +   +N  V +++ +   N+ L C++ N NP     W     P+        +   I T+N TA       ++L ++     +    +C   + A        +  ++ Q+++     PG    +  S  E    +  G ++Q++C     G+PP  L W  N   +   Q       S   S+N ++ +  +   +   L C         P  A + + V Y P  + +   +               K G  V+LSC +        RI W I        +P+  S  KT  +SDG   +++SS          +IS  I S+  + + VC   +TE    +     + +   PS P+LT  N     IL +G   KL+C+  GG+P P L+           S L +  IT  E ++ V   DN   ++C V  N  +D    +++ + +    PP+ + + ++    NL+     ++ C + SS P AKI WW                 KD   +    + N P       ST   +    V +T + D     C    H +   + + + + I + + YPP+F    + P    TFV  +G  F + + +  +P +  YTW  +  P+        S+    +++  P +  N S L  N+            G A  +  + + Y PT+   S+    V         A++ C  QA P  E   V W R      D  +L        + ISS          +  G                 +QI  ++   IG++ CI+ N  +  PA + + LV  T P    +   + +AA++  +++L C  +  P P+  W    K+  +    K+ +   Q +   F++ L I +T+  D G+Y CV  N  G++S  +  +KP  P  P+   V NV++T V + W   F+GG    ++ Y+RLR   +    ++   + D +   Q  ++  L     Y  S+++ NE   S  +P                   I+    +G      +  E  E  N ++II + +  ++LL +   L+ +FV +R+ K +   E
Sbjct:   50 ILEGTDTLLRCEVSNRAGKVQWTKDGFALGFSAVIPGFPRYSVLVDAKQNAYNLQIKNATLEDDAEYQCQVGPAAGNPAIRANAKLSIVAAPSSIVI----EGYARNARVEVEERQ---NLTLHCIAENANPAAEIVWFQGEVPV--------STAPIVTVNQTAPKRFTTSSTLHLQPRAEDDYKEFSCEARHKALPP-----DVPMRAQVQLSVLYPPGAPFFEGYSQGET---LHRGQEVQIACRSRG-GNPPAQLTWYRNGVAISSPQRT-----SGRLSENVYKFTAAAED-NGANLVCEAKNLLATTPLRAELNLTVLYAPKDVYLSGAN-------------QAKVGDSVQLSCVTAPS-NPQARISWSING------RPLDNSTYKTTSSSDG--GWVSSS----------NISLTIDSQSRTFIAVCHALNTELTQNVVGSHTVNVLYPPSPPLLTGYN--DGDILISGSILKLQCSSAGGNPPPTLQWYKNDKIINAPSKLVDSKITS-ELSLLVNASDNNAIYKCKVQ-NAAIDIPLFATKTLGVHF--PPETVKISVVPK--NLVPGIRAKLICDSSSSNPPAKISWW-----------------KDGIPVEGLNLANRPGLWGGSVSTLEMY----VNITQDLDGIVYTCQ--SHNE--VLQRSVHETISLDILYPPKF----ETPQST-TFVGVEGAPFHVELLASGNPMVITYTWTKDGLPISSN-----SLSGQRLISDGPRL--NISRLSRNDAGVYICEALNSQGTALLEIQVAVEYAPTITAVSEGRSFV-----AGEPAVLACHIQARP-LEAAHVRWSR------DGYDL------ATRTISS----------FENG--------------TALLQIASVERSDIGNFTCIVDN-QRGAPAAQNVLLVVQTAPEIDHSPGFTRYAARLGVRAQLICRSLASPQPSFIWRRHGKDLKMQRRNKFKSVERQVDALNFESALLIENTSPDDYGQYECVVRNSLGQASTTLEFSKPSRPDAPLQLRVGNVSDTGVDLNWTPGFDGG----MQTYFRLR---LKQHGEDKYKYVDAKPGHQNISLDGLKPGATYYFSVMAANEAGGSKFMPD------------------IKLTLSKGSQPHSAEYTEKDELPN-VMIIGITSAAMVLLVLNAALVAWFVIRRQNKSQSEAE 1081          
BLAST of NPHS1-1 vs. Ensembl Fly
Match: hbs (gene:FBgn0029082 transcript:FBtr0087413)

HSP 1 Score: 248.44 bits (633), Expect = 2.122e-66
Identity = 280/1208 (23.18%), Postives = 491/1208 (40.65%), Query Frame = 2
Query:  284 VLEGKDVLMGCRVAHQQGKLQWAFKGKMLGFDRNIPTYPRMRMTGNAVIGDHSLFIENVKVSDSGNYECQLSPAASQPPRRRMTKLTVLKVPSTPIIYQNGQSNKQNISVSIKKDEFDSNINLTCVSLNGNPVPTFEWSVNRSPLKHGFKFRGNKVSIETINDTA-------NSLSMKSSQIMNGDIVTCGVENNATRKMFNLTERIIKTQMRVFKRILPGKIVIKEVSDIEKTVYVTEGHQLQLSCVCNNPGDPPIDLKWNINEDDLMIAQDKILSVKSEHFSQNTFRMSNISRKWHRKELYCSGSQDNYAIPSSATVLILVNYPPSKIEMEAISIKTNVSLHNPSTVYCKEGQKVKLSCTSDNFFTDNVRILWFIKSSEESDWKPITTSFEKTVFTSDGRLKYITSSLEVPPSFVDKDISSHILSRLLSQV-VCIVKSTEFNIEIRRQLKIELFEEPSVPVLTLNNLSKPQILTNGESAKLKCTVTGGHPTPQLRLLDERDREMKSSNLHEIGITRLEYNIEVKPRDNEKKFRCIVSYNNVMDFESASSELMALQVANPPKQLHMKIISSMDNLIANQNFEMQCHTDSSFPEAKIEWWWHHSCKSSHTLGIRSTSKDVRSLCQSEILNEPQNINYQKSTQSTFTSINVKLTPEFDLSFIECMIIPHEKWITINKVLSKLIKIRVRYPPQFLNVHKLPNDVQTFVVEKGNNFSIAIKSIAHPSINGYTWLVNKQPMEKKIHIDTSVDKFSIVNAQPEMMANYSLLVENNL-----------GKAAFDFFLNITYGPTLLGASQETIKVNPQMEHNHKAMIMCSAQANPSREQLTVEWIREISKILDQEELLDILKGQQKFISSDPIRCTNTHQWNKGKVNVNCISFGDVEIVTTMQIMPIDYRFIGSYRCIIKNSDKRPPAIKTIKLVYPTRPNPVKNFRKSEFAAQIFGKSELFCYFIGFPVPTVKWMTFYKNESLDNPVKYFTSVAQTEPGYFKAVLAISDTNESDLGKYICVAGNQYGESSHVVILNKPRSPTQPINFTVINVTETSVSVGWILRFNGGSKQQIKLYWRLRDTVVNGDYQNANIFEDEEKDVQFFTIYNLYRNREYEISIISVNEYSPSAGIPKPIIIKTMNYVDPDPDSIHIQNDSKRGFNKQLEKRIEPVESNNFLIIILLATVGVLLLTIKIGLIVYFVRKRKLKHRKSRE 3850
            +LEG D L+ C V+++ GK+QW   G  LGF   IP +PR  +  +A    ++L I+N  + D   Y+CQ+ PAA  P  R   KL+++  PS+ +I    +   +N  V +++ +   N+ L C++ N NP     W     P+        +   I T+N TA       ++L ++     +    +C   + A        +  ++ Q+++     PG    +  S  E    +  G ++Q++C     G+PP  L W  N   +   Q       S   S+N ++ +  +   +   L C         P  A + + V Y P  + +   +               K G  V+LSC +        RI W I        +P+  S  KT  +SDG   +++SS          +IS  I S+  + + VC   +TE    +     + +   PS P+LT  N     IL +G   KL+C+  GG+P P L+           S L +  IT  E ++ V   DN   ++C V  N  +D    +++ + +    PP+ + + ++    NL+     ++ C + SS P AKI WW                 KD   +    + N P       ST   +    V +T + D     C    H +   + + + + I + + YPP+F    + P    TFV  +G  F + + +  +P +  YTW  +  P+        S+    +++  P +  N S L  N+            G A  +  + + Y PT+   S+    V         A++ C  QA P  E   V W R      D  +L        + ISS          +  G                 +QI  ++   IG++ CI+ N  +  PA + + LV  T P    +   + +AA++  +++L C  +  P P+  W    K+  +    K+ +   Q +   F++ L I +T+  D G+Y CV  N  G++S  +  +KP  P  P+   V NV++T V + W   F+GG    ++ Y+RLR   +    ++   + D +   Q  ++  L     Y  S+++ NE   S  +P                   I+    +G      +  E  E  N ++II + +  ++LL +   L+ +FV +R+ K +   E
Sbjct:   50 ILEGTDTLLRCEVSNRAGKVQWTKDGFALGFSAVIPGFPRYSVLVDAKQNAYNLQIKNATLEDDAEYQCQVGPAAGNPAIRANAKLSIVAAPSSIVI----EGYARNARVEVEERQ---NLTLHCIAENANPAAEIVWFQGEVPV--------STAPIVTVNQTAPKRFTTSSTLHLQPRAEDDYKEFSCEARHKALPP-----DVPMRAQVQLSVLYPPGAPFFEGYSQGET---LHRGQEVQIACRSRG-GNPPAQLTWYRNGVAISSPQRT-----SGRLSENVYKFTAAAED-NGANLVCEAKNLLATTPLRAELNLTVLYAPKDVYLSGAN-------------QAKVGDSVQLSCVTAPS-NPQARISWSING------RPLDNSTYKTTSSSDG--GWVSSS----------NISLTIDSQSRTFIAVCHALNTELTQNVVGSHTVNVLYPPSPPLLTGYN--DGDILISGSILKLQCSSAGGNPPPTLQWYKNDKIINAPSKLVDSKITS-ELSLLVNASDNNAIYKCKVQ-NAAIDIPLFATKTLGVHF--PPETVKISVVPK--NLVPGIRAKLICDSSSSNPPAKISWW-----------------KDGIPVEGLNLANRPGLWGGSVSTLEMY----VNITQDLDGIVYTCQ--SHNE--VLQRSVHETISLDILYPPKF----ETPQST-TFVGVEGAPFHVELLASGNPMVITYTWTKDGLPISSN-----SLSGQRLISDGPRL--NISRLSRNDAGVYICEALNSQGTALLEIQVAVEYAPTITAVSEGRSFV-----AGEPAVLACHIQARP-LEAAHVRWSR------DGYDL------ATRTISS----------FENG--------------TALLQIASVERSDIGNFTCIVDN-QRGAPAAQNVLLVVQTAPEIDHSPGFTRYAARLGVRAQLICRSLASPQPSFIWRRHGKDLKMQRRNKFKSVERQVDALNFESALLIENTSPDDYGQYECVVRNSLGQASTTLEFSKPSRPDAPLQLRVGNVSDTGVDLNWTPGFDGG----MQTYFRLR---LKQHGEDKYKYVDAKPGHQNISLDGLKPGATYYFSVMAANEAGGSKFMPD------------------IKLTLSKGSQPHSAEYTEKDELPN-VMIIGITSAAMVLLVLNAALVAWFVIRRQNKSQSEAE 1081          
BLAST of NPHS1-1 vs. Ensembl Fly
Match: sns (gene:FBgn0024189 transcript:FBtr0088635)

HSP 1 Score: 194.126 bits (492), Expect = 2.953e-49
Identity = 278/1215 (22.88%), Postives = 473/1215 (38.93%), Query Frame = 2
Query:  248 QCFRELPSPKYDVLEGKDVLMGCRVAHQQGKLQWAFKGKMLGFDRNIPTYPRMRMTGNAVIGDHSLFIENVKVSDSGNYECQLSPAASQPPRRRMTKLTVLKVPSTPIIYQNGQSNKQNISVSIKKDEFDSNINLTCVSLNGNPVPTFEWSVNRSPLKHGFKFRGNKVSIETIN--DTANSLSMKSSQIMNGDIVTCGVENNATRKMFNLTERIIKTQMRVFKRILPGKIVIKEVSDIEKTVYVTEGHQLQLSCVCNNPGDPPIDLKWNINEDDLMIAQDKILSVKSEHFSQNTFRMSNISRKWHRKELYCSGSQDNYA-IPSSATVLILVNYPPSKIEMEAISIKTNVSLHNPSTVYCKEGQKVKLSCTSDNFFTDNVRILWFIKSSEESDWKPITTSFEKTVFTSDGRLKYITSSLEVPPSFVDKDISSHILSRLLSQVVCIVKSTEFNIEIRRQLKIELFEEPSVPVLTLNNLSKPQILTNGESAKLKCTVTGGHPTPQLRLLDERDREMKSSNLHEIGITRLEYNIEVKPRDNEKKFRCIVSYNNVMDFESASSELMALQVANPPKQLHMKIISSMDNLIANQNFEMQCHTDSSFPEAKIEWWWHHSCKSSHTL-GIRSTSKDVRSLCQSEILNEPQNINYQKSTQSTFTSINVKLTPEFDLSFIECMIIPHEKWITINKVLSK----LIKIRVRYPPQFLNVHKLPNDVQTFVVEKGNNFSIAIKSIAHPSINGYTWLVNK----QPMEKKIHIDTSVDKFSIVNAQPEMMANYSLLVENNLGKAAFDFFLNITYGPTLLGASQETIKVNPQMEHNHKAMIMCSAQANPSREQLTVEWIREISKILDQEELLDILKGQQKFISSDPIRCTNTHQWNKGKVNVNCISFGDVEIVTTMQIMPIDYRFIGSYRCIIKNSDKRPPAIKTIKLVYPTRPNPVKNFRKSEFAAQIFGKSELFCYFIGFPVPTVKWMTFYKNESLDNPVKYFTSVAQTEPGYFKAVLAISDTNESDLGKYICVAGNQYGESSHVVILNKPRSPTQPINFTVINVTETSVSVGWILRFNGGSKQQIKLYWRLRDTVVNGDYQNANIFEDEEKDVQFFTIYNLYRNREYEISIISVNEYSPSAGIPKPIIIKTMNYVDPDPDSIHIQNDSKRGFNKQLEKRIEPVE-------SNNFLII-ILLATVGVLLLTIKIGLIVYFVRKRKLK 3832
            Q FR  P     VLEG + +M C VA+  G +QW   G  LGF   IP +PR  + G+   G ++L I N  ++D  +Y+CQ+ PA      R   KLTV+  P++  I   G S+   + V   +D     + L C+  N  P     W   R  +++  + R + V   T     T +SL +K     +    TC   + A      +   +   Q+ V     PG   I+  S  E    +  G  ++L C     G+PP  L W  N   + +A        S   S+N +              + + + DN A     A+ ++  N   +++E+  +   T+V++  P+    + G  V L+CT+         I W +   +      +  +  KT+ + +G     TS++    + V+ +  S +       V+C   + +    +     I +   P+ P+++     + QI+  G   KL C  +GG+P   L    + D+ + S           E  I     DN+ ++RC  S N+  +     S  +++  A  P+ + ++I    + L       + C + SS P AK+ WW     K    + GI +TSK                      T ST     V +T E +     C         + N+ L +     + + V Y P+F     +P    T V  +G +  +++++ A+P+   Y W  +     Q  + +I  D     F+ ++     +  YS    N+ G A  +  + + YG T+   S E I VNP       AM+ C+ +  P  E+  V+W R                     +  D    T+T          N  S+        + I       +G++RC+  N     P  + I L+    P   K       A+    +  L C   G P P   W    K+  ++   KY     + +   +++ L +     +D G Y CVA N+ GE+   V L     P  P++  ++NVT  +V++ W   F+GG K   ++ +R+ D      Y+  +   +  K     TI  L  N  Y  S++S NE   S+ +P                      D  R   K LE  + P E       + N +II I LA  G LL+   + +  +FV +R+ K
Sbjct:   72 QKFRTTPH-DLQVLEGAEAMMRCEVANVAGAVQWTKDGFALGFSAVIPGFPRYSVLGDRKQGIYNLRISNASINDDADYQCQVGPARLNSAIRANAKLTVISPPAS--IEIKGYSHNSKVEVRENQD-----LQLKCIVANAKPAAQIVWY--RGNVEYKPEKREDTVEESTAKRFTTTSSLKLKPGPDDDYTEYTCQARHKALSPDMPMRATV---QLSVL--YPPGPPYIEGYSAGET---LRRGQTVELMCRSRG-GNPPAQLIWYKNGSQIRMAYR-----TSGRLSENIY-------------TFTAEAGDNKARFRCEASNVMSQNPLKAEVELSVLFAPTHVTVMGPTE--ARVGDIVPLTCTTAP-SNPPAEIKWMVGGRQ------VRNATSKTIVSPEGGWT-TTSNIT---AVVEPNKRSLV-------VICHGLNMQLTENVVSTHTINVLYPPAPPLIS--GYMEGQIIPAGSVQKLLCVSSGGNPLATLTWY-KNDKRINSVIRAADKSVSAEITILANVSDNQAQYRCEAS-NSATEIPLFQSTTLSVHFA--PETVKIRI--EPEELRPGMEATIICDSSSSNPPAKLSWW-----KDGIPIEGINNTSKP----------------GLWGGTVSTL-EFRVNVTQEMNGQVYTCQ--------SANEALQRSAHEAVSLDVLYRPKF-----VPPPSSTAVGVEGESLQVSLQTRANPTPVTYKWTKDGTTIPQDGDHRIFADGGSLNFTRLHRDDAGI--YSCSASNSQGGATLNITVVVEYGTTIKSVS-ENIVVNP----GEDAMLSCTVEGKPLTEE-HVKWER---------------------VGYDMTVKTST-------TFANGTSY--------LHIKDAKREDVGNFRCVADNRVDN-PTNRDILLIVKFAPEIAKTPTLLRAASGTGERGRLPCRAQGSPKPQFIWRQDKKDLPINRTYKYEVEERKIDSLTYESTLIVDKVAPADYGAYECVARNELGEAVETVRLEITSQPDPPLSLNILNVTHDTVTLAWTPGFDGGLKASYRVRYRMAD---REQYKYIDGLPNSHK----LTIGGLRMNTLYLFSVMSWNELGQSSYLP----------------------DLARAETKGLE--LMPAELTEDSSNTPNLVIIGISLAAFGFLLVNASL-VAWFFVHQRRKK 1109          
BLAST of NPHS1-1 vs. Ensembl Fly
Match: sns (gene:FBgn0024189 transcript:FBtr0339277)

HSP 1 Score: 189.889 bits (481), Expect = 4.709e-48
Identity = 258/1132 (22.79%), Postives = 444/1132 (39.22%), Query Frame = 2
Query:  248 QCFRELPSPKYDVLEGKDVLMGCRVAHQQGKLQWAFKGKMLGFDRNIPTYPRMRMTGNAVIGDHSLFIENVKVSDSGNYECQLSPAASQPPRRRMTKLTVLKVPSTPIIYQNGQSNKQNISVSIKKDEFDSNINLTCVSLNGNPVPTFEWSVNRSPLKHGFKFRGNKVSIETIN--DTANSLSMKSSQIMNGDIVTCGVENNATRKMFNLTERIIKTQMRVFKRILPGKIVIKEVSDIEKTVYVTEGHQLQLSCVCNNPGDPPIDLKWNINEDDLMIAQDKILSVKSEHFSQNTFRMSNISRKWHRKELYCSGSQDNYA-IPSSATVLILVNYPPSKIEMEAISIKTNVSLHNPSTVYCKEGQKVKLSCTSDNFFTDNVRILWFIKSSEESDWKPITTSFEKTVFTSDGRLKYITSSLEVPPSFVDKDISSHILSRLLSQVVCIVKSTEFNIEIRRQLKIELFEEPSVPVLTLNNLSKPQILTNGESAKLKCTVTGGHPTPQLRLLDERDREMKSSNLHEIGITRLEYNIEVKPRDNEKKFRCIVSYNNVMDFESASSELMALQVANPPKQLHMKIISSMDNLIANQNFEMQCHTDSSFPEAKIEWWWHHSCKSSHTL-GIRSTSKDVRSLCQSEILNEPQNINYQKSTQSTFTSINVKLTPEFDLSFIECMIIPHEKWITINKVLSK----LIKIRVRYPPQFLNVHKLPNDVQTFVVEKGNNFSIAIKSIAHPSINGYTWLVNK----QPMEKKIHIDTSVDKFSIVNAQPEMMANYSLLVENNLGKAAFDFFLNITYGPTLLGASQETIKVNPQMEHNHKAMIMCSAQANPSREQLTVEWIREISKILDQEELLDILKGQQKFISSDPIRCTNTHQWNKGKVNVNCISFGDVEIVTTMQIMPIDYRFIGSYRCIIKNSDKRPPAIKTIKLVYPTRPNPVKNFRKSEFAAQIFGKSELFCYFIGFPVPTVKWMTFYKNESLDNPVKYFTSVAQTEPGYFKAVLAISDTNESDLGKYICVAGNQYGESSHVVILNKPRSPTQPINFTVINVTETSVSVGWILRFNGGSKQQIKLYWRLRDTVVNGDYQNANIFEDEEKDVQFFTIYNLYRNREYEISIISVNEYSPSAGIP 3607
            Q FR  P     VLEG + +M C VA+  G +QW   G  LGF   IP +PR  + G+   G ++L I N  ++D  +Y+CQ+ PA      R   KLTV+  P++  I   G S+   + V   +D     + L C+  N  P     W   R  +++  + R + V   T     T +SL +K     +    TC   + A      +   +   Q+ V     PG   I+  S  E    +  G  ++L C     G+PP  L W  N   + +A        S   S+N +              + + + DN A     A+ ++  N   +++E+  +   T+V++  P+    + G  V L+CT+         I W +   +      +  +  KT+ + +G     TS++    + V+ +  S +       V+C   + +    +     I +   P+ P+++     + QI+  G   KL C  +GG+P   L    + D+ + S           E  I     DN+ ++RC  S N+  +     S  +++  A  P+ + ++I    + L       + C + SS P AK+ WW     K    + GI +TSK                      T ST     V +T E +     C         + N+ L +     + + V Y P+F     +P    T V  +G +  +++++ A+P+   Y W  +     Q  + +I  D     F+ ++     +  YS    N+ G A  +  + + YG T+   S E I VNP       AM+ C+ +  P  E+  V+W R                     +  D    T+T          N  S+        + I       +G++RC+  N     P  + I L+    P   K       A+    +  L C   G P P   W    K+  ++   KY     + +   +++ L +     +D G Y CVA N+ GE+   V L     P  P++  ++NVT  +V++ W   F+GG K   ++ +R+ D      Y+  +   +  K     TI  L  N  Y  S++S NE   S+ +P
Sbjct:   72 QKFRTTPH-DLQVLEGAEAMMRCEVANVAGAVQWTKDGFALGFSAVIPGFPRYSVLGDRKQGIYNLRISNASINDDADYQCQVGPARLNSAIRANAKLTVISPPAS--IEIKGYSHNSKVEVRENQD-----LQLKCIVANAKPAAQIVWY--RGNVEYKPEKREDTVEESTAKRFTTTSSLKLKPGPDDDYTEYTCQARHKALSPDMPMRATV---QLSVL--YPPGPPYIEGYSAGET---LRRGQTVELMCRSRG-GNPPAQLIWYKNGSQIRMAYR-----TSGRLSENIY-------------TFTAEAGDNKARFRCEASNVMSQNPLKAEVELSVLFAPTHVTVMGPTE--ARVGDIVPLTCTTAP-SNPPAEIKWMVGGRQ------VRNATSKTIVSPEGGWT-TTSNIT---AVVEPNKRSLV-------VICHGLNMQLTENVVSTHTINVLYPPAPPLIS--GYMEGQIIPAGSVQKLLCVSSGGNPLATLTWY-KNDKRINSVIRAADKSVSAEITILANVSDNQAQYRCEAS-NSATEIPLFQSTTLSVHFA--PETVKIRI--EPEELRPGMEATIICDSSSSNPPAKLSWW-----KDGIPIEGINNTSKP----------------GLWGGTVSTL-EFRVNVTQEMNGQVYTCQ--------SANEALQRSAHEAVSLDVLYRPKF-----VPPPSSTAVGVEGESLQVSLQTRANPTPVTYKWTKDGTTIPQDGDHRIFADGGSLNFTRLHRDDAGI--YSCSASNSQGGATLNITVVVEYGTTIKSVS-ENIVVNP----GEDAMLSCTVEGKPLTEE-HVKWER---------------------VGYDMTVKTST-------TFANGTSY--------LHIKDAKREDVGNFRCVADNRVDN-PTNRDILLIVKFAPEIAKTPTLLRAASGTGERGRLPCRAQGSPKPQFIWRQDKKDLPINRTYKYEVEERKIDSLTYESTLIVDKVAPADYGAYECVARNELGEAVETVRLEITSQPDPPLSLNILNVTHDTVTLAWTPGFDGGLKASYRVRYRMAD---REQYKYIDGLPNSHK----LTIGGLRMNTLYLFSVMSWNELGQSSYLP 1051          
BLAST of NPHS1-1 vs. Ensembl Zebrafish
Match: kirrel3a (kirre like nephrin family adhesion molecule 3a [Source:ZFIN;Acc:ZDB-GENE-091117-44])

HSP 1 Score: 82.4185 bits (202), Expect = 3.859e-15
Identity = 53/195 (27.18%), Postives = 88/195 (45.13%), Query Frame = 2
Query:  284 VLEGKDVLMGCRVAHQQGKLQWAFKGKMLGFDRNIPTYPRMRMTGNAVIGDHSLFIENVKVSDSGNYECQLSPAASQPPRRRMTKLTVLKVPSTPIIYQNGQSNKQNISVSIKKDEFDSNINLTCVSLNGNPVPTFEWSVNRSPLKHGFKFRGNKVSIETIND-----TANSLSMKSSQIMNGDIVTCGVENNAT 853
            ++ G+ V + C +   QG + W   G  LG +R++  YPR  + G+   G++ L IE  ++ D G++ECQ    A    R R  +LTVL  P  P+I          I   +       ++NLTC + N  P  +  W      +++G    G   +   + D     T ++L + +S I +G  +TC   N A 
Sbjct:   32 IVAGEPVTLPCTIIGYQGMVLWVKDGLALGVNRDLSGYPRYDVIGDHSKGEYHLLIERTELVDDGSFECQAIQVAG---RSRPAQLTVLVPPDDPVI----------IGAPVVSLRAGDSLNLTCHANNAKPAASIIW------IRNGEVINGAAYTKTLLRDGKRESTVSTLHISASNIESGQQITCRASNKAA 207          
BLAST of NPHS1-1 vs. Ensembl Zebrafish
Match: kirrel3a (kirre like nephrin family adhesion molecule 3a [Source:ZFIN;Acc:ZDB-GENE-091117-44])

HSP 1 Score: 82.4185 bits (202), Expect = 3.859e-15
Identity = 53/195 (27.18%), Postives = 88/195 (45.13%), Query Frame = 2
Query:  284 VLEGKDVLMGCRVAHQQGKLQWAFKGKMLGFDRNIPTYPRMRMTGNAVIGDHSLFIENVKVSDSGNYECQLSPAASQPPRRRMTKLTVLKVPSTPIIYQNGQSNKQNISVSIKKDEFDSNINLTCVSLNGNPVPTFEWSVNRSPLKHGFKFRGNKVSIETIND-----TANSLSMKSSQIMNGDIVTCGVENNAT 853
            ++ G+ V + C +   QG + W   G  LG +R++  YPR  + G+   G++ L IE  ++ D G++ECQ    A    R R  +LTVL  P  P+I          I   +       ++NLTC + N  P  +  W      +++G    G   +   + D     T ++L + +S I +G  +TC   N A 
Sbjct:   32 IVAGEPVTLPCTIIGYQGMVLWVKDGLALGVNRDLSGYPRYDVIGDHSKGEYHLLIERTELVDDGSFECQAIQVAG---RSRPAQLTVLVPPDDPVI----------IGAPVVSLRAGDSLNLTCHANNAKPAASIIW------IRNGEVINGAAYTKTLLRDGKRESTVSTLHISASNIESGQQITCRASNKAA 207          
BLAST of NPHS1-1 vs. Ensembl Zebrafish
Match: kirrel3a (kirre like nephrin family adhesion molecule 3a [Source:ZFIN;Acc:ZDB-GENE-091117-44])

HSP 1 Score: 81.6481 bits (200), Expect = 3.946e-15
Identity = 53/195 (27.18%), Postives = 88/195 (45.13%), Query Frame = 2
Query:  284 VLEGKDVLMGCRVAHQQGKLQWAFKGKMLGFDRNIPTYPRMRMTGNAVIGDHSLFIENVKVSDSGNYECQLSPAASQPPRRRMTKLTVLKVPSTPIIYQNGQSNKQNISVSIKKDEFDSNINLTCVSLNGNPVPTFEWSVNRSPLKHGFKFRGNKVSIETIND-----TANSLSMKSSQIMNGDIVTCGVENNAT 853
            ++ G+ V + C +   QG + W   G  LG +R++  YPR  + G+   G++ L IE  ++ D G++ECQ    A    R R  +LTVL  P  P+I          I   +       ++NLTC + N  P  +  W      +++G    G   +   + D     T ++L + +S I +G  +TC   N A 
Sbjct:   32 IVAGEPVTLPCTIIGYQGMVLWVKDGLALGVNRDLSGYPRYDVIGDHSKGEYHLLIERTELVDDGSFECQAIQVAG---RSRPAQLTVLVPPDDPVI----------IGAPVVSLRAGDSLNLTCHANNAKPAASIIW------IRNGEVINGAAYTKTLLRDGKRESTVSTLHISASNIESGQQITCRASNKAA 207          
BLAST of NPHS1-1 vs. Ensembl Zebrafish
Match: kirrel1b (kirre like nephrin family adhesion molecule 1b [Source:ZFIN;Acc:ZDB-GENE-070912-173])

HSP 1 Score: 77.7962 bits (190), Expect = 9.647e-14
Identity = 77/295 (26.10%), Postives = 124/295 (42.03%), Query Frame = 2
Query:  236 IHRIQC---FRELPSPKYDVLEGKDVLMGCRVAHQQGKLQWAFKGKMLGFDRNIPTYPRMRMTGNAVIGDHSLFIENVKVSDSGNYECQLSPAASQPPRRRMTKLTVLKVPSTPIIYQNGQSNKQNISVSIKKDEFDSNINLTCVSLNGNPVPTFEWSVNRSPLKHGFKFRGNKVSIETINDTANSLSMKSSQIMNGDIVTCGVENNATRKMFNLTERIIKTQMRVFKRILPGKIVIKEVSDIEKTVYVTEGHQLQLSCVCNNPGDPPI-DLKWNINEDDLMIAQDKILSVKSEH 1108
            +HR+     F + P+ +  V+ G+ V++ C V +  G +QW   G  LG   ++  +PR R+     +G ++L I +  ++D   YECQ + AA    R R  KLTVL  P  P+I          I ++       ++ NLTCVS    P+ T EW       K G    G   S E ++D     +    +I   D  T     N T    NL   + K          P  +++     IE    V EG +++ +C      +PPI   +W      L  A++ +    ++H
Sbjct:   18 VHRVFSGPRFSQEPADQ-SVVIGERVVLSCVVFNYTGIVQWTKDGLALGIGEDLRAWPRYRVLRIMDVGQYNLEITSADLTDDSLYECQATEAAL---RSRRAKLTVLIPPDGPVI-----EGSPEILLTA-----GTSFNLTCVSRGAKPMSTIEW------YKDGIIVEGAHTSTEVLSDRKRVTTKSFLEIQPMDTDTG---RNFTCVASNLAAPLGKRSTVTLNIHHPPTVIL----SIEPRS-VLEGERVKFTCQAT--ANPPIMGYRWAKGGVILDGARESVFETTADH 282          
BLAST of NPHS1-1 vs. Ensembl Zebrafish
Match: kirrel1b (kirre like nephrin family adhesion molecule 1b [Source:ZFIN;Acc:ZDB-GENE-070912-173])

HSP 1 Score: 77.7962 bits (190), Expect = 1.004e-13
Identity = 77/295 (26.10%), Postives = 124/295 (42.03%), Query Frame = 2
Query:  236 IHRIQC---FRELPSPKYDVLEGKDVLMGCRVAHQQGKLQWAFKGKMLGFDRNIPTYPRMRMTGNAVIGDHSLFIENVKVSDSGNYECQLSPAASQPPRRRMTKLTVLKVPSTPIIYQNGQSNKQNISVSIKKDEFDSNINLTCVSLNGNPVPTFEWSVNRSPLKHGFKFRGNKVSIETINDTANSLSMKSSQIMNGDIVTCGVENNATRKMFNLTERIIKTQMRVFKRILPGKIVIKEVSDIEKTVYVTEGHQLQLSCVCNNPGDPPI-DLKWNINEDDLMIAQDKILSVKSEH 1108
            +HR+     F + P+ +  V+ G+ V++ C V +  G +QW   G  LG   ++  +PR R+     +G ++L I +  ++D   YECQ + AA    R R  KLTVL  P  P+I          I ++       ++ NLTCVS    P+ T EW       K G    G   S E ++D     +    +I   D  T     N T    NL   + K          P  +++     IE    V EG +++ +C      +PPI   +W      L  A++ +    ++H
Sbjct:   18 VHRVFSGPRFSQEPADQ-SVVIGERVVLSCVVFNYTGIVQWTKDGLALGIGEDLRAWPRYRVLRIMDVGQYNLEITSADLTDDSLYECQATEAAL---RSRRAKLTVLIPPDGPVI-----EGSPEILLTA-----GTSFNLTCVSRGAKPMSTIEW------YKDGIIVEGAHTSTEVLSDRKRVTTKSFLEIQPMDTDTG---RNFTCVASNLAAPLGKRSTVTLNIHHPPTVIL----SIEPRS-VLEGERVKFTCQAT--ANPPIMGYRWAKGGVILDGARESVFETTADH 282          
BLAST of NPHS1-1 vs. Ensembl Xenopus
Match: NPHS1 (NPHS1 nephrin [Source:NCBI gene;Acc:100494620])

HSP 1 Score: 123.635 bits (309), Expect = 1.570e-27
Identity = 181/852 (21.24%), Postives = 322/852 (37.79%), Query Frame = 2
Query:  248 QCFRELPSPKYDVLEGKDVLMGCRVAHQQGKLQWAFKGKMLGFDRNIPTYPRMRMTGNAVIGDHSLFIENVKVSDSGNYECQLSPA-ASQPPRRRMTKLTVLKVPSTPIIYQNGQSNKQNISVSIKKDEFDSNINLTCVSLNGNPVPTFEWSVNRSPLKHGFKFRGNKVSIETINDTANSLSMKSSQIMNGDIVTCGVENNATRKMFNLTERIIKTQMRVFKRILPGKIVIKEVSDIEKTV--YVTEGHQLQLSCVCNNPGDPPIDLKWNINEDDLMI--AQDKILSVKSEHFSQNTFRMSNISRKWHRKELYCSGSQDNYAIPSSATVLILVNYPPSKIEMEAISIKTNVSLHNPSTVYCKEGQKVKLSCTSDNFFTDN----VRILWFIKSSEESDWKPITTSFEKTVFTSDGRLKYITSSLEVPPSFVDKDISSHILSRLLSQVVCIVKSTEFNIEIRRQLKIELFEEPSVPVLTLNNLSKPQILTNGESAKLKCTVTGGHPTPQLRLLDERDREMKSSNLHEIGITRLEYNIEVKPRDNEKKFRCIVSYNNVMDFESASSELMALQVANPPKQLHMKIISSMDNLIANQNFEMQCHTDSSFPEAKIEWWWHHSCKSSHTLGIRSTSKDVRSLCQSEILNEPQNINYQKSTQSTFTSINVKLTPEFDLSFIECMIIPHEKWITINKVLSKLIKIRVRYPPQFLNVHKLPNDVQTFVVEKGNNFSIAIKSIAHPSINGYTW------LVNKQPMEKKIHIDTSVDKFSIVNAQPEMMANYSLLVENNLGKAAFDFFLNITYGPTLLGASQETIKVNPQMEHNHKAMIMCSAQANPSREQL----TVEWIR 2746
            Q FR  P     V++G   L+ C V H  G +QW   G +LG DRNIP + R  MTG+   G+++L IE  ++ D   Y CQ+  +  S     R   + VL  P  P   +    ++      ++         +TC + +  P      ++ +S L+       N  S + + +TA    +      NG ++TC   N A +     T   +   M V   + P    I     IE  +   V  G  L+L C+  + G+P   L+W+ N+D +      D+++     H + N     N++          S    N+  P +    I++N          + + T V++   S+    E   +  SC     FT      V+I W++   E      + T    +     G++     ++E     + ++    +     ++ +   KS    + ++   +    E P             +    G S K+ C  +GG+P P+L  + +       S +H   I   E  I   P DN   +RC  S        +AS++   L+V  P   + + IISS           + C T SS P + I W        +  LG + +     S      L      N ++ +   F+S+                         +N+ ++   K+ + +PP+FL+    P  VQ   VE G    I ++  A+P    YTW      L+        +  + +++ +++  A   +   Y++   N  GK +    L++ Y PT+       + +    E      I C+A ANP+ + +     + WIR
Sbjct:   19 QVFRVQPD-NITVVQGSTALLSCEVEHGTGMVQWEKNGLLLGPDRNIPGFLRYSMTGDPHKGEYNLRIERSELDDDAEYHCQVGRSEVSLGIISRTALINVLIPPKAPTFEEYAAGSRVTWVYGVE-------YTVTCQATDAKPAAAL--TIKKSGLEVSGDSSSNPGSRDKLENTAMVAKVIPQSSDNGKLLTCLALNPALQ-----TPITVSFTMNV---LFPPNAPI-----IEGYIGPSVKAGETLKLICISLS-GNPLATLQWSKNDDVVSTRWETDEVVRASRSHLTLNIKPADNMA--------VVSCEAVNHVTPETLKTSIILN---------VVFLPTEVTILGSSS--GPEKSNLTFSC-----FTAASNPPVQIRWWLGPKEL-----VNTIVTISDAVHGGKVTMSNLTMEA----LREEHGMALTCEAFNEAILYTKSNSVTLSVQYPPQNVWIEAPPA----------DKFFRAGTSVKMTCFSSGGNPPPRLTWIKDTKSLSGGSQIHSGKIVTKEITIITVPSDNMATYRCNASNIGKTPALTASTK---LKVQFP--AIDVNIISSAKEYRRGSTIILTCVTGSSNPASTISWVKDGEQLKAQDLGRKPSLYGGISSSSRVTLKAASKDNGRRVSCEAFSSV-------------------------LNEAVNTFYKLNILFPPEFLDDQ--PAVVQ--AVEHGAAL-IPVRVRANPPQINYTWSLWGEKLIRDGAYRHHLRGEGALEIWNVSRADSGV---YNVTCVNKEGKNSIVIRLDVQYSPTIRSLGDTEVDLGSDAE------IACTADANPATDSMFQWRWLVWIR 759          
BLAST of NPHS1-1 vs. Ensembl Xenopus
Match: eif4e (eukaryotic translation initiation factor 4E [Source:Xenbase;Acc:XB-GENE-855435])

HSP 1 Score: 87.0409 bits (214), Expect = 1.258e-16
Identity = 63/204 (30.88%), Postives = 96/204 (47.06%), Query Frame = 2
Query:  254 FRELPSPKYDVLEGKDVLMGCRVAHQQGKLQWAFKGKMLGFDRNIPTYPRMRMTGNAVIGDHSLFIENVKVSDSGNYECQLSPAASQPPRRRMTKLTVLKVPSTPIIYQNGQSNKQNISVSIKKDEFDSNINLTCVSLNGNPVPTFEWSVNRSPLKHGFKFRGNKVSIETIND-----TANSLSMKSSQIMNGDIVTCGVENNA 850
            F + PS K  ++ GK V + C V   +G +QW   G  LG +R++P + R  + G+  +G+H+L IE V++SD   YECQ + AA +  R R   LTVL  P  P+I  +  +N             +   NLTC++    P     W       + G K      + E ++D     +A+SL +  S   +G   TC V N A
Sbjct:   26 FSQQPSDKV-IVAGKSVTLPCVVIGYRGVVQWTMDGLALGAERDLPGWSRYSVVGDPSLGEHNLHIEGVELSDDAIYECQATQAALRSQRAR---LTVLLPPGDPMIPGSPVANVL----------LNVPYNLTCLAPVAKPAAEITW------YRDGKKLDSAVYTKELLSDGKSEGSASSLLITPSLADSGSSYTCRVRNEA 209          
BLAST of NPHS1-1 vs. Ensembl Xenopus
Match: eif4e (eukaryotic translation initiation factor 4E [Source:Xenbase;Acc:XB-GENE-855435])

HSP 1 Score: 86.6557 bits (213), Expect = 1.643e-16
Identity = 64/204 (31.37%), Postives = 98/204 (48.04%), Query Frame = 2
Query:  254 FRELPSPKYDVLEGKDVLMGCRVAHQQGKLQWAFKGKMLGFDRNIPTYPRMRMTGNAVIGDHSLFIENVKVSDSGNYECQLSPAASQPPRRRMTKLTVLKVPSTPIIYQNGQSNKQNISVSIKKDEFDSNINLTCVSLNGNPVPTFEWSVNRSPLKHGFKFRGNKVSIETIND-----TANSLSMKSSQIMNGDIVTCGVENNA 850
            F + PS K  ++ GK V + C V   +G +QW   G  LG +R++P + R  + G+  +G+H+L IE V++SD   YECQ + AA +  R R   LTVL  P  P+I     S   N+ +++         NLTC++    P     W       + G K      + E ++D     +A+SL +  S   +G   TC V N A
Sbjct:   30 FSQQPSDKV-IVAGKSVTLPCVVIGYRGVVQWTMDGLALGAERDLPGWSRYSVVGDPSLGEHNLHIEGVELSDDAIYECQATQAALRSQRAR---LTVLLPPGDPMI---PGSPVANVLLNVP-------YNLTCLAPVAKPAAEITW------YRDGKKLDSAVYTKELLSDGKSEGSASSLLITPSLADSGSSYTCRVRNEA 213          
BLAST of NPHS1-1 vs. Ensembl Xenopus
Match: eif4e (eukaryotic translation initiation factor 4E [Source:Xenbase;Acc:XB-GENE-855435])

HSP 1 Score: 86.6557 bits (213), Expect = 1.739e-16
Identity = 64/204 (31.37%), Postives = 98/204 (48.04%), Query Frame = 2
Query:  254 FRELPSPKYDVLEGKDVLMGCRVAHQQGKLQWAFKGKMLGFDRNIPTYPRMRMTGNAVIGDHSLFIENVKVSDSGNYECQLSPAASQPPRRRMTKLTVLKVPSTPIIYQNGQSNKQNISVSIKKDEFDSNINLTCVSLNGNPVPTFEWSVNRSPLKHGFKFRGNKVSIETIND-----TANSLSMKSSQIMNGDIVTCGVENNA 850
            F + PS K  ++ GK V + C V   +G +QW   G  LG +R++P + R  + G+  +G+H+L IE V++SD   YECQ + AA +  R R   LTVL  P  P+I     S   N+ +++         NLTC++    P     W       + G K      + E ++D     +A+SL +  S   +G   TC V N A
Sbjct:   30 FSQQPSDKV-IVAGKSVTLPCVVIGYRGVVQWTMDGLALGAERDLPGWSRYSVVGDPSLGEHNLHIEGVELSDDAIYECQATQAALRSQRAR---LTVLLPPGDPMI---PGSPVANVLLNVP-------YNLTCLAPVAKPAAEITW------YRDGKKLDSAVYTKELLSDGKSEGSASSLLITPSLADSGSSYTCRVRNEA 213          
BLAST of NPHS1-1 vs. Ensembl Xenopus
Match: eif4e (eukaryotic translation initiation factor 4E [Source:Xenbase;Acc:XB-GENE-855435])

HSP 1 Score: 86.6557 bits (213), Expect = 1.915e-16
Identity = 63/204 (30.88%), Postives = 96/204 (47.06%), Query Frame = 2
Query:  254 FRELPSPKYDVLEGKDVLMGCRVAHQQGKLQWAFKGKMLGFDRNIPTYPRMRMTGNAVIGDHSLFIENVKVSDSGNYECQLSPAASQPPRRRMTKLTVLKVPSTPIIYQNGQSNKQNISVSIKKDEFDSNINLTCVSLNGNPVPTFEWSVNRSPLKHGFKFRGNKVSIETIND-----TANSLSMKSSQIMNGDIVTCGVENNA 850
            F + PS K  ++ GK V + C V   +G +QW   G  LG +R++P + R  + G+  +G+H+L IE V++SD   YECQ + AA +  R R   LTVL  P  P+I  +  +N             +   NLTC++    P     W       + G K      + E ++D     +A+SL +  S   +G   TC V N A
Sbjct:   38 FSQQPSDKV-IVAGKSVTLPCVVIGYRGVVQWTMDGLALGAERDLPGWSRYSVVGDPSLGEHNLHIEGVELSDDAIYECQATQAALRSQRAR---LTVLLPPGDPMIPGSPVANVL----------LNVPYNLTCLAPVAKPAAEITW------YRDGKKLDSAVYTKELLSDGKSEGSASSLLITPSLADSGSSYTCRVRNEA 221          
BLAST of NPHS1-1 vs. Ensembl Mouse
Match: Kirrel (kirre like nephrin family adhesion molecule 1 [Source:MGI Symbol;Acc:MGI:1891396])

HSP 1 Score: 75.485 bits (184), Expect = 4.455e-13
Identity = 54/200 (27.00%), Postives = 87/200 (43.50%), Query Frame = 2
Query:  284 VLEGKDVLMGCRVAHQQGKLQWAFKGKMLGFDRNIPTYPRMRMTGNAVIGDHSLFIENVKVSDSGNYECQLSPAASQPPRRRMTKLTVL------KVPSTPIIYQNGQSNKQNISVSIKKDEFDSNINLTCVSLNGNPVPTFEWSVNRSPLKHGFKFRGNKVSIETIND-----TANSLSMKSSQIMNGDIVTCGVENNA 850
            V+ G+  ++ C + +  G +QW   G  LG  + +  +PR R+ G+A  G ++L I + ++SD  +YECQ + AA    R R  KLTVL      ++   P+I                     +  NLTC + N  P  T  W       + G +  G   S E + D     T + L ++ + +  G + TC   N A
Sbjct:   64 VVAGQRAVLPCVLLNYSGIVQWTKDGLALGMGQGLKAWPRYRVVGSADAGQYNLEITDAELSDDASYECQATEAAL---RSRRAKLTVLIPPEETRIDGGPVILLQA----------------GTPYNLTCRAFNAKPAATIIW------FRDGTQQEGAVTSTELLKDGKRETTISQLLIEPTDLDIGRVFTCRSMNEA 238          
BLAST of NPHS1-1 vs. Ensembl Mouse
Match: Kirrel (kirre like nephrin family adhesion molecule 1 [Source:MGI Symbol;Acc:MGI:1891396])

HSP 1 Score: 75.0998 bits (183), Expect = 7.182e-13
Identity = 56/201 (27.86%), Postives = 89/201 (44.28%), Query Frame = 2
Query:  284 VLEGKDVLMGCRVAHQQGKLQWAFKGKMLGFDRNIPTYPRMRMTGNAVIGDHSLFIENVKVSDSGNYECQLSPAASQPPRRRMTKLTVL------KVPSTPII-YQNGQSNKQNISVSIKKDEFDSNINLTCVSLNGNPVPTFEWSVNRSPLKHGFKFRGNKVSIETIND-----TANSLSMKSSQIMNGDIVTCGVENNA 850
            V+ G+  ++ C + +  G +QW   G  LG  + +  +PR R+ G+A  G ++L I + ++SD  +YECQ + AA    R R  KLTVL      ++   P+I  Q G                 +  NLTC + N  P  T  W       + G +  G   S E + D     T + L ++ + +  G + TC   N A
Sbjct:   64 VVAGQRAVLPCVLLNYSGIVQWTKDGLALGMGQGLKAWPRYRVVGSADAGQYNLEITDAELSDDASYECQATEAAL---RSRRAKLTVLIPPEETRIDGGPVILLQAG-----------------TPYNLTCRAFNAKPAATIIW------FRDGTQQEGAVTSTELLKDGKRETTISQLLIEPTDLDIGRVFTCRSMNEA 238          
BLAST of NPHS1-1 vs. Ensembl Mouse
Match: Kirrel (kirre like nephrin family adhesion molecule 1 [Source:MGI Symbol;Acc:MGI:1891396])

HSP 1 Score: 75.0998 bits (183), Expect = 7.182e-13
Identity = 56/201 (27.86%), Postives = 89/201 (44.28%), Query Frame = 2
Query:  284 VLEGKDVLMGCRVAHQQGKLQWAFKGKMLGFDRNIPTYPRMRMTGNAVIGDHSLFIENVKVSDSGNYECQLSPAASQPPRRRMTKLTVL------KVPSTPII-YQNGQSNKQNISVSIKKDEFDSNINLTCVSLNGNPVPTFEWSVNRSPLKHGFKFRGNKVSIETIND-----TANSLSMKSSQIMNGDIVTCGVENNA 850
            V+ G+  ++ C + +  G +QW   G  LG  + +  +PR R+ G+A  G ++L I + ++SD  +YECQ + AA    R R  KLTVL      ++   P+I  Q G                 +  NLTC + N  P  T  W       + G +  G   S E + D     T + L ++ + +  G + TC   N A
Sbjct:   64 VVAGQRAVLPCVLLNYSGIVQWTKDGLALGMGQGLKAWPRYRVVGSADAGQYNLEITDAELSDDASYECQATEAAL---RSRRAKLTVLIPPEETRIDGGPVILLQAG-----------------TPYNLTCRAFNAKPAATIIW------FRDGTQQEGAVTSTELLKDGKRETTISQLLIEPTDLDIGRVFTCRSMNEA 238          
BLAST of NPHS1-1 vs. Ensembl Mouse
Match: Kirrel3 (kirre like nephrin family adhesion molecule 3 [Source:MGI Symbol;Acc:MGI:1914953])

HSP 1 Score: 73.1738 bits (178), Expect = 2.214e-12
Identity = 54/194 (27.84%), Postives = 83/194 (42.78%), Query Frame = 2
Query:  284 VLEGKDVLMGCRVAHQQGKLQWAFKGKMLGFDRNIPTYPRMRMTGNAVIGDHSLFIENVKVSDSGNYECQLSPAASQPPRRRMTKLTVLKVPSTPIIYQNGQSNKQNISVSIKKDEFDSNINLTCVSLNGNPVPTFEWSVNRSPLKHGFKFRGNKVSIETIND-----TANSLSMKSSQIMNGDIVTCGVENNA 850
            V+ G+ V + C +    G + W   G  LG  R++ +YP+  + GN + G+H L I   ++ D   YECQ   AA    R R  +LTVL  P  PII            +S++  +    +NLTC + N  P  +  W      L+ G    G   S   + D       ++L +    + NG  + C   N A
Sbjct:   26 VVSGQPVTLLCAIPEYDGFVLWIKDGLALGVGRDLSSYPQYLVVGNHLSGEHHLKILRAELQDDAVYECQAIQAAI---RSRPARLTVLVPPDDPIILGGP-------VISLRAGD---PLNLTCHADNAKPAASIIW------LRKGEVINGATYSKTLLRDGKRESIVSTLFISPGDVENGQSIVCRATNKA 200          
BLAST of NPHS1-1 vs. Ensembl Mouse
Match: Nphs1 (nephrosis 1, nephrin [Source:MGI Symbol;Acc:MGI:1859637])

HSP 1 Score: 73.559 bits (179), Expect = 2.733e-12
Identity = 75/325 (23.08%), Postives = 128/325 (39.38%), Query Frame = 2
Query:  284 VLEGKDVLMGCRVAHQQGKLQWAFKGKMLGFDRNIPTYPRMRMTGNAVIGDHSLFIENVKVSDSGNYECQLSPAASQPPRRRMTKLTVLKVPSTPIIYQNGQSNKQNISVSIKKDEFDSNINLTCVSLNGNPVPTFEWSVNRSPLKHGFKFRGNKVSIETINDTANSLSMKSSQIMNGDIVTCGVENNATRKMFNLTERIIKTQMRVFKRILPGKIVIKEVSDIEKTVYVTEGHQLQLSCVCNNPGDPPIDLKWNINEDDLMIAQDKILSVKSEHFSQNTFRMSNISRKWHRKELYCSGSQDNYAIPSSATVLILVNYPPSKIEM 1258
            V+EG  V + C V      +QWA  G +LG +  IP +PR  + G++  G+  L IE   +SD   YECQ+  +   P    ++   +L +  +P + Q        ++    ++       +TCVS +  P P   + +             N+ S E +  T     +      NG ++ C   N A           IK    +     PG  VI      E   +V  G  L+L C+    G+PP  L+W  N   + IA     +  ++  + +   M+ +  + H   L C       A     ++ + V +PPS + +
Sbjct:   57 VVEGSTVKLWCGVRAPGSVVQWAKDGLLLGPNPKIPGFPRYSLEGDSAKGEFHLLIEACDLSDDAEYECQVGRSELGP--ELVSPSVILSILVSPKVLQLTPEAGSTVTWVAGQEYV-----VTCVSGDAKPAPDIIF-IQGGRTVEDVSSSVNEGSEEKLFFTEAEARVTPQSSDNGQLLVCEGSNPALATP-------IKASFTMNILFPPGPPVIDWPGLNEG--HVRAGENLELPCIARG-GNPPATLQWLKNGKPVSIAWG---TEHAQAVAHSVLVMT-VRPEDHGARLSCQSYNSVSAETQERSITLQVTFPPSAVTI 359          
BLAST of NPHS1-1 vs. UniProt/SwissProt
Match: sp|Q9U3P2|SYG2_CAEEL (Synaptogenesis protein syg-2 OS=Caenorhabditis elegans OX=6239 GN=syg-2 PE=1 SV=1)

HSP 1 Score: 121.709 bits (304), Expect = 3.260e-26
Identity = 259/1204 (21.51%), Postives = 457/1204 (37.96%), Query Frame = 2
Query:  443 LFIENVKVSDSGNYECQ-LSPAASQPPRRRMTKLTVLKVPSTPIIYQNGQSNKQNISVSIKKDEFDSNINLTCVSLNGNPVPTFEWSVNRSPLKHGFKFRGNKVSIETINDT---ANSLSMKSSQIMNGDIVTCGVENNATRKMFNLTERIIKTQMRVFKRILPGKIVIKEVSDIEKTVYVTEGHQLQLSCVCNNPGDPPIDLKWNINEDDLMIAQDKILSVKSEHFSQNTFRMSNISRKWHRKELYCSGSQDNYAIPSSATVLILVNYPPSKIEMEAISIKTNVSLHNPSTVYCKEGQKVKLSCTSDNFFTDNVRILWFIKSSEESDWKPITTSFEKTVFTSDGRLKYITSSLEVPPSFVDKDISSHILSRLLSQVVCIVKSTEFNIEIRRQLKIELFEEPSVPVLTLNNLSKPQILTNGESAKLKCTVTGGHPTPQL-------RLLDERDREMKSSNLHEIGITRLEYNIEVKP----RDNEKKF---------RCIV--SYNNVMDFESASS----------------------------ELMALQVANPPKQLHMKIISSMDN-LIANQNFEMQCHTDSSFPEAKIEWWWHHSCKSSHTLGIRSTSKDVRSLCQSEILNEPQNINYQKSTQSTFTSINVKLTPEFDLSFIECMIIPHEKWITINKVLSKLIKIRVRYPPQFLNVHKLPNDVQTFVVEKGNNFSIAIKSIAHPSINGYTWLVNKQPMEKKIHIDTSVDKFSIVNAQPEMMAN----YSLLVENNLGKAAFDFFLNITYGPTLLGASQETIKVNPQMEHNHKAMIMCSAQANPSREQLTVEWIREISKILDQEELLDILKGQQKFISSDPIRCTNTHQWNKGKVNVNCISFGDVEIVTTMQIMPIDYRFIGSYRCIIKNSDKRPPAIKTIKLVYPT-RPNPVKNFRKSEFAAQIFGKSELFCYFIGFPVPTVKWMTFYKNESL--DNPVKYFTSVAQTEPGYFKAVLAISDTNESDLGKYI-CVAGNQYGESSHVVILNKPRSPTQPINFTVINVTETSVSVGWILRFNGGSKQQIKLYWRLRDT----VVNGDYQNANIFEDEEKDVQFFTIYNLYRNREYEISIISVNEYSPSAGIPKPIIIKTMNYVDPDPDSIHIQNDSKRGFNKQLEKRIEPVESNNFLIIILLATVGVLLLTIKIGLIVYFVRKRKLKHRKSREK 3853
            L I +V + D G YECQ L P   + P R  + L ++ VP   + + N Q N      SI   + ++ +N+TCV  N  P P   W ++   +    K    + S   +N T     SL ++S +  +G ++TC        + F     I  T       + P      E+  +     +  G  + ++C     G+PP D+ W    ++  +     L  +S+   +N +     S+  +  E  C  +      P    + + VNYPP+ +E+     ++N+   + + + CK       S           +I W I        + + T  ++     +G    I SS  V     +  + +H ++     V C+  + E +    +Q  I++   P  P++T   L   +    G+   + C   GG+P  +L       + L +  ++MK S + +  +  L    EV      R ++  F          C V  ++N V  F S S+                            E   L V  PP+++ ++   S D  L+  ++  + C T SS P A I W +            R+T  +   L    +    ++  +      +FT      T E+D + + C I  H +W      ++    + V YPP+ L      ND  T V+ +G++F   +    +P+I+ + W  N  P +   H    V     V +  ++++     Y+L   N++G       L + Y   +   S   I            ++ C A   PS+  + + W +      + E L    +G +K I    +R   T Q +                              G Y C   N    P   +T  LV    R  PV  + K+  A  + G ++  C    + VPTV+++ + K+E L   N  KY     Q +   +++ L I +    D  K + C+A N +G     + +  P  P +P N T+ N T  ++SV W  RF+GGS Q  ++ +R ++     +VN  + N  +      +  FF I              S+N    ++    P+I  T+N               + G N  +  R E ++   ++  IL+  V  +LL +   +I  FV  R  K RK REK
Sbjct:   89 LKITHVNLDDDGEYECQMLHP--EEGPIRAKSFLNII-VPPQLVYFSNYQPN------SIIAVKENTPLNITCVVPNVKPEPEVLWYMDGKVMSRDVK----QASTPHLNKTFTVYTSLVVQSDRNDHGKVITC--------EAFQKETDIRITTNTTLDVLFPPSDPTVEI--LRNPSALRSGDNVTIACSVTG-GNPPPDVFWY--HENKRLQSHSTLDTRSKEI-KNIYSFI-ASQNDNMAEYECRANNSRTGNPKRKAMKLEVNYPPASVELFG---ESNIRYGSSANIQCKSLPSNPAS-----------QITWIING------RSVPTPTQREFVVENG----IVSSSNVSVHSNELSVEAHQIN-----VECMATNPEGSSA--KQHVIKIIAPPKAPIIT--GLEDRKFF-EGDIVNVTCEAQGGNPLAELSWYRGSEKHLVKGRKKMKWSQVKKKLVMSLLCLCEVVIMNFFRFSKNVFYFFRFTLFIECGVNGAHNEVAGFSSYSTLALRVDRTMNTQRLKCEATNAALDEPLIESQYLSVYYPPRRVLIRPADSGDQRLLVGKSARLVCGTLSSNPAAHISWQFS-----------RATDDNKVHLGDVSLNETTRDNGFNVENVLSFTP-----TEEYDGTVVHC-IANHPEW---KHSVNTSFPLNVMYPPKML-----VNDPVTVVMSEGDSFKENLTVRGNPAISLWQWRKNGVPFD---HTIGRVFARGAVLSGKQLLSTDAGVYTLTATNSVGSTNITIKLAVEYSARITSISTPVIAAT-----GDTVLLECEADGEPSKANM-IHWYK------NGEILAAQHRGHKKAI----LRLNATEQQS------------------------------GEYTCKADNGIGVPAEGQTFLLVNSAPRVLPVARYAKT--AGILGGVAKARCKV--YAVPTVEFV-WEKDEQLIKKNSSKYSIVNTQIDYSTYESTLWIKNIVPDDYTKKVKCIARNSFGTDHLSIPIIPPTHPDEPFNLTMTNSTLNTISVAWEPRFDGGSDQIFEVKYRRQNDDLIHLVNTTHTNLRLSGLATANTYFFQIR-------------SINARGFASSWTSPVIFATLN---------------EDGVNVAM-IRNEKLKLTTWIPYILIFIVLFMLLNV---VICCFVCNRT-KKRKLREK 1118          
BLAST of NPHS1-1 vs. UniProt/SwissProt
Match: sp|O60500|NPHN_HUMAN (Nephrin OS=Homo sapiens OX=9606 GN=NPHS1 PE=1 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 6.902e-14
Identity = 132/560 (23.57%), Postives = 211/560 (37.68%), Query Frame = 2
Query:  254 FRELPSPKYDVLEGKDVLMGCRVAHQQGKLQWAFKGKMLGFDRNIPTYPRMRMTGNAVIGDHSLFIENVKVSDSGNYECQLSPAASQP----PRRRMTKLTVLKV------PSTPIIYQNGQSNKQNISVSIKKDEFDSNINLTCVSLNGNPVPTFEWSVNRSPLKHGFKFRGNKVSIETINDTANSLSMKSSQIMNGDIVTCGVENNATRKMFNLTERIIKTQMRVFKRILPGKIVIKEVSDIEKTVYVTEGHQLQLSCVCNNPGDPPIDLKWNINEDDLMIAQDKILSVKSEHFSQNTFRMSNISRKWHRKELYCSGSQDNYAIPSSATVLILVNYPPSKIEMEAISIKTNVSLHNPSTVYCKEGQKVKLSCTSDNFFTDNVRILWFIKSSEESDWKPITTSFEKTVFTSDGRLKYITSSLEVPPSFVDKDISSHILSRLLSQVVCIVKSTEFNIEIRRQLKIELFEEPSVPVLTLNNLSKPQILTNGESAKLKCTVTGGHPTPQLRL-----------LDERDREMKSSNLHEIGIT-RLEYNIEVKPRDNEKKFRC 1867
            F  LP     V+EG  V + C V+     +QWA  G +LG D  IP +PR R+ G+   G+  L IE   +SD   YECQ+  +   P    PR  ++ L   K+        T + +  GQ    N      K   D  I      L+G  +     +VN           G++  + T+  TA  ++ +SS   N  ++ C   + A        E  IK    V     PG  VI+     E   +V  G  L+L CV    G+P   L+W  N   +  A     +  ++  +++   M+ +  + H  +L C       A      + + V +PPS I +   + +T             E + V LSC S +     V + W++       W+ +    E+TV           S+L       D  ++          + C   S  F  E  ++  I   + P+   L +    + Q L  G   +L C   GG+P P L             L +  R +   ++ + G T   E  +   P DN+ KF C
Sbjct:   34 FWALPE-NLTVVEGASVELRCGVSTPGSAVQWAKDGLLLGPDPRIPGFPRYRLEGDPARGEFHLHIEACDLSDDAEYECQVGRSEMGPELVSPRVILSILVPPKLLLLTPEAGTMVTWVAGQEYVVNCVSGDAKPAPDITI-----LLSGQTISDISANVN----------EGSQQKLFTVEATAR-VTPRSSD--NRQLLVCEASSPA-------LEAPIKASFTVNVLFPPGPPVIEWPGLDEG--HVRAGQSLELPCVARG-GNPLATLQWLKNGQPVSTAWG---TEHTQAVARSVLVMT-VRPEDHGAQLSCEAHNSVSAGTQEHGITLQVTFPPSAIIILGSASQT-------------ENKNVTLSCVSKS-SRPRVLLRWWL------GWRQL-LPMEETVMDGLHGGHISMSNLTFLARREDNGLT----------LTCEAFSEAFTKETFKKSLILNVKYPAQ-KLWIEGPPEGQKLRAGTRVRLVCLAIGGNPEPSLMWYKDSRTVTESRLPQESRRVHLGSVEKSGSTFSRELVLVTGPSDNQAKFTC 528          
BLAST of NPHS1-1 vs. UniProt/SwissProt
Match: sp|B1Q236|SYG1_CAEEL (Synaptogenesis protein syg-1 OS=Caenorhabditis elegans OX=6239 GN=syg-1 PE=1 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 7.216e-13
Identity = 49/140 (35.00%), Postives = 74/140 (52.86%), Query Frame = 2
Query:  293 GKDVLMGCRVAHQQGKLQWAFKGKMLGFDRN--IPTYPRMRMTGNAVIGDHSLFIENVKVSDSGNYECQLSPA-ASQPPRRRMTKLTVLKVPSTPIIYQNGQSNKQNISVSIKKDEFDSNINLTCVSLNGNPVPTFEWSV 703
            G+  ++ CRV HQQG +QW      LG DR+  +P   R RM G+A  G+++L I NV + D  ++ CQ+S +  ++       KLTVL  P+ P I ++  S K     +I  D     I  +C+S  G P PT  W++
Sbjct:   37 GETAILTCRVEHQQGPVQWMKDDFGLGTDRDKPLPGNKRYRMVGSAANGEYNLEISNVTLFDDDDFACQISESDHAKAVVSSKAKLTVLVRPTPPKIVKSHHSLK-----AIAGDP----ITQSCLSRKGKPPPTIGWAI 167          
BLAST of NPHS1-1 vs. UniProt/SwissProt
Match: sp|Q08180|ICCR_DROME (Irregular chiasm C-roughest protein OS=Drosophila melanogaster OX=7227 GN=rst PE=1 SV=2)

HSP 1 Score: 76.2554 bits (186), Expect = 2.264e-12
Identity = 78/319 (24.45%), Postives = 124/319 (38.87%), Query Frame = 2
Query:  293 GKDVLMGCRVAHQQGKLQWAFKGKMLGFDRNIPTYPRMRMTGNAVIGDHSLFIENVKVSDSGNYECQLSPAASQPPRRRMT--KLTVLKVPSTPIIYQNGQSNKQNISVSIKKDEFDSNINLTCVSLNGNPVPTFEW------------SVNRSPLKHGFKFRGNKVSIETINDTANSLSMKSSQIMNGDIVTCGVENNATRKMFNLTERI-IKTQMRVFKRI---LPGKIVIKEVSDIEKTVYVTEG------HQLQLSCVCN-NPGDPPIDLKWNINEDDLMIAQDKILSVKSEHFSQNTFRMSNISRKWHRKELYC 1174
            G  V + CRV ++QG LQW      LG  R++  + R  M G+   GD+SL I  V + D   Y+CQ+SP     P  R T   LTVL  P  P I Q            +     D  + + CVS+ G P     W                 PL    +F    V           L +   +  +    +C  +N A R   +   R+ +K   +V   +   LPG            +V+++ G       Q++L C  + NP D  +  +W IN++ ++  Q   + ++            N++RK+H   + C
Sbjct:   42 GARVTLPCRVINKQGTLQWTKDDFGLGTSRDLSGFERYAMVGSDEEGDYSLDIYPVMLDDDARYQCQVSPGPEGQPAIRSTFAGLTVLVPPEAPKITQG----------DVIYATEDRKVEIECVSVGGKPAAEITWIDGLGNVLTDNIEYTVIPLPDQRRFTAKSV-----------LRLTPKKEHHNTNFSCQAQNTADRTYRSAKIRVEVKYAPKVKVNVMGSLPGGAGGSVGGAGGGSVHMSTGSRIVEHSQVRLECRADANPSD--VRYRWFINDEPIIGGQKTEMVIR------------NVTRKFHDAIVKC 325          
BLAST of NPHS1-1 vs. UniProt/SwissProt
Match: sp|Q96J84|KIRR1_HUMAN (Kin of IRRE-like protein 1 OS=Homo sapiens OX=9606 GN=KIRREL1 PE=1 SV=2)

HSP 1 Score: 75.0998 bits (183), Expect = 3.979e-12
Identity = 56/201 (27.86%), Postives = 88/201 (43.78%), Query Frame = 2
Query:  284 VLEGKDVLMGCRVAHQQGKLQWAFKGKMLGFDRNIPTYPRMRMTGNAVIGDHSLFIENVKVSDSGNYECQLSPAASQPPRRRMTKLTVL------KVPSTPII-YQNGQSNKQNISVSIKKDEFDSNINLTCVSLNGNPVPTFEWSVNRSPLKHGFKFRGNKVSIETIND-----TANSLSMKSSQIMNGDIVTCGVENNA 850
            V+ G+  ++ C + +  G +QW   G  LG  + +  +PR R+ G+A  G ++L I + ++SD  +YECQ + AA    R R  KLTVL      ++   P+I  Q G  +                 NLTC + N  P  T  W       + G +  G   S E + D     T + L +  + +  G + TC   N A
Sbjct:   32 VVAGQRAVLPCVLLNYSGIVQWTKDGLALGMGQGLKAWPRYRVVGSADAGQYNLEITDAELSDDASYECQATEAAL---RSRRAKLTVLIPPEDTRIDGGPVILLQAGTPH-----------------NLTCRAFNAKPAATIIW------FRDGTQQEGAVASTELLKDGKRETTVSQLLINPTDLDIGRVFTCRSMNEA 206          
BLAST of NPHS1-1 vs. TrEMBL
Match: A0A0H3YFQ1 (NPHS1-1 OS=Schmidtea mediterranea OX=79327 GN=NPHS1-1 PE=2 SV=1)

HSP 1 Score: 3360.47 bits (8712), Expect = 0.000e+0
Identity = 1621/1621 (100.00%), Postives = 1621/1621 (100.00%), Query Frame = 2
Query:   77 MLNFWMICVFVLSNTFINRIEFVLCQDPFNVDDLDAAESISLSQSSTCTEKDDIHRIQCFRELPSPKYDVLEGKDVLMGCRVAHQQGKLQWAFKGKMLGFDRNIPTYPRMRMTGNAVIGDHSLFIENVKVSDSGNYECQLSPAASQPPRRRMTKLTVLKVPSTPIIYQNGQSNKQNISVSIKKDEFDSNINLTCVSLNGNPVPTFEWSVNRSPLKHGFKFRGNKVSIETINDTANSLSMKSSQIMNGDIVTCGVENNATRKMFNLTERIIKTQMRVFKRILPGKIVIKEVSDIEKTVYVTEGHQLQLSCVCNNPGDPPIDLKWNINEDDLMIAQDKILSVKSEHFSQNTFRMSNISRKWHRKELYCSGSQDNYAIPSSATVLILVNYPPSKIEMEAISIKTNVSLHNPSTVYCKEGQKVKLSCTSDNFFTDNVRILWFIKSSEESDWKPITTSFEKTVFTSDGRLKYITSSLEVPPSFVDKDISSHILSRLLSQVVCIVKSTEFNIEIRRQLKIELFEEPSVPVLTLNNLSKPQILTNGESAKLKCTVTGGHPTPQLRLLDERDREMKSSNLHEIGITRLEYNIEVKPRDNEKKFRCIVSYNNVMDFESASSELMALQVANPPKQLHMKIISSMDNLIANQNFEMQCHTDSSFPEAKIEWWWHHSCKSSHTLGIRSTSKDVRSLCQSEILNEPQNINYQKSTQSTFTSINVKLTPEFDLSFIECMIIPHEKWITINKVLSKLIKIRVRYPPQFLNVHKLPNDVQTFVVEKGNNFSIAIKSIAHPSINGYTWLVNKQPMEKKIHIDTSVDKFSIVNAQPEMMANYSLLVENNLGKAAFDFFLNITYGPTLLGASQETIKVNPQMEHNHKAMIMCSAQANPSREQLTVEWIREISKILDQEELLDILKGQQKFISSDPIRCTNTHQWNKGKVNVNCISFGDVEIVTTMQIMPIDYRFIGSYRCIIKNSDKRPPAIKTIKLVYPTRPNPVKNFRKSEFAAQIFGKSELFCYFIGFPVPTVKWMTFYKNESLDNPVKYFTSVAQTEPGYFKAVLAISDTNESDLGKYICVAGNQYGESSHVVILNKPRSPTQPINFTVINVTETSVSVGWILRFNGGSKQQIKLYWRLRDTVVNGDYQNANIFEDEEKDVQFFTIYNLYRNREYEISIISVNEYSPSAGIPKPIIIKTMNYVDPDPDSIHIQNDSKRGFNKQLEKRIEPVESNNFLIIILLATVGVLLLTIKIGLIVYFVRKRKLKHRKSREKLSSPPTHQRMDTVGFISNDDSIEMRPPSLVRSGIESNLYAQSISDHMSQNGSDTGLKLNYYKTHSDDQFSSPFLGPELDLVASVRGRNNYDINALSPNFHPGYIQFAESSSMTSAQDPYIKGYYTQRPYYNSQTPSHGVIRKSSHSSNDTVTLPQYPISSSYQKRMDKVCFPQSAVSISTNSGDSNCSQSPPRKYIGYSPMVNQSGAPSTVEEYLSSGNSASESHRFGINGSDEYFTSPMSSFRLNQGLDSMSNKDFYSQLCSTNQQNQESAQEFAIQRIMYGNDVSAITPYRAYNDHQRLSTSSDNEHLLKPPLDFSGIESNNSNNIQSPMADAHKLSYVDLIAHSSPSVIRFTGPISENL 4939
            MLNFWMICVFVLSNTFINRIEFVLCQDPFNVDDLDAAESISLSQSSTCTEKDDIHRIQCFRELPSPKYDVLEGKDVLMGCRVAHQQGKLQWAFKGKMLGFDRNIPTYPRMRMTGNAVIGDHSLFIENVKVSDSGNYECQLSPAASQPPRRRMTKLTVLKVPSTPIIYQNGQSNKQNISVSIKKDEFDSNINLTCVSLNGNPVPTFEWSVNRSPLKHGFKFRGNKVSIETINDTANSLSMKSSQIMNGDIVTCGVENNATRKMFNLTERIIKTQMRVFKRILPGKIVIKEVSDIEKTVYVTEGHQLQLSCVCNNPGDPPIDLKWNINEDDLMIAQDKILSVKSEHFSQNTFRMSNISRKWHRKELYCSGSQDNYAIPSSATVLILVNYPPSKIEMEAISIKTNVSLHNPSTVYCKEGQKVKLSCTSDNFFTDNVRILWFIKSSEESDWKPITTSFEKTVFTSDGRLKYITSSLEVPPSFVDKDISSHILSRLLSQVVCIVKSTEFNIEIRRQLKIELFEEPSVPVLTLNNLSKPQILTNGESAKLKCTVTGGHPTPQLRLLDERDREMKSSNLHEIGITRLEYNIEVKPRDNEKKFRCIVSYNNVMDFESASSELMALQVANPPKQLHMKIISSMDNLIANQNFEMQCHTDSSFPEAKIEWWWHHSCKSSHTLGIRSTSKDVRSLCQSEILNEPQNINYQKSTQSTFTSINVKLTPEFDLSFIECMIIPHEKWITINKVLSKLIKIRVRYPPQFLNVHKLPNDVQTFVVEKGNNFSIAIKSIAHPSINGYTWLVNKQPMEKKIHIDTSVDKFSIVNAQPEMMANYSLLVENNLGKAAFDFFLNITYGPTLLGASQETIKVNPQMEHNHKAMIMCSAQANPSREQLTVEWIREISKILDQEELLDILKGQQKFISSDPIRCTNTHQWNKGKVNVNCISFGDVEIVTTMQIMPIDYRFIGSYRCIIKNSDKRPPAIKTIKLVYPTRPNPVKNFRKSEFAAQIFGKSELFCYFIGFPVPTVKWMTFYKNESLDNPVKYFTSVAQTEPGYFKAVLAISDTNESDLGKYICVAGNQYGESSHVVILNKPRSPTQPINFTVINVTETSVSVGWILRFNGGSKQQIKLYWRLRDTVVNGDYQNANIFEDEEKDVQFFTIYNLYRNREYEISIISVNEYSPSAGIPKPIIIKTMNYVDPDPDSIHIQNDSKRGFNKQLEKRIEPVESNNFLIIILLATVGVLLLTIKIGLIVYFVRKRKLKHRKSREKLSSPPTHQRMDTVGFISNDDSIEMRPPSLVRSGIESNLYAQSISDHMSQNGSDTGLKLNYYKTHSDDQFSSPFLGPELDLVASVRGRNNYDINALSPNFHPGYIQFAESSSMTSAQDPYIKGYYTQRPYYNSQTPSHGVIRKSSHSSNDTVTLPQYPISSSYQKRMDKVCFPQSAVSISTNSGDSNCSQSPPRKYIGYSPMVNQSGAPSTVEEYLSSGNSASESHRFGINGSDEYFTSPMSSFRLNQGLDSMSNKDFYSQLCSTNQQNQESAQEFAIQRIMYGNDVSAITPYRAYNDHQRLSTSSDNEHLLKPPLDFSGIESNNSNNIQSPMADAHKLSYVDLIAHSSPSVIRFTGPISENL
Sbjct:    1 MLNFWMICVFVLSNTFINRIEFVLCQDPFNVDDLDAAESISLSQSSTCTEKDDIHRIQCFRELPSPKYDVLEGKDVLMGCRVAHQQGKLQWAFKGKMLGFDRNIPTYPRMRMTGNAVIGDHSLFIENVKVSDSGNYECQLSPAASQPPRRRMTKLTVLKVPSTPIIYQNGQSNKQNISVSIKKDEFDSNINLTCVSLNGNPVPTFEWSVNRSPLKHGFKFRGNKVSIETINDTANSLSMKSSQIMNGDIVTCGVENNATRKMFNLTERIIKTQMRVFKRILPGKIVIKEVSDIEKTVYVTEGHQLQLSCVCNNPGDPPIDLKWNINEDDLMIAQDKILSVKSEHFSQNTFRMSNISRKWHRKELYCSGSQDNYAIPSSATVLILVNYPPSKIEMEAISIKTNVSLHNPSTVYCKEGQKVKLSCTSDNFFTDNVRILWFIKSSEESDWKPITTSFEKTVFTSDGRLKYITSSLEVPPSFVDKDISSHILSRLLSQVVCIVKSTEFNIEIRRQLKIELFEEPSVPVLTLNNLSKPQILTNGESAKLKCTVTGGHPTPQLRLLDERDREMKSSNLHEIGITRLEYNIEVKPRDNEKKFRCIVSYNNVMDFESASSELMALQVANPPKQLHMKIISSMDNLIANQNFEMQCHTDSSFPEAKIEWWWHHSCKSSHTLGIRSTSKDVRSLCQSEILNEPQNINYQKSTQSTFTSINVKLTPEFDLSFIECMIIPHEKWITINKVLSKLIKIRVRYPPQFLNVHKLPNDVQTFVVEKGNNFSIAIKSIAHPSINGYTWLVNKQPMEKKIHIDTSVDKFSIVNAQPEMMANYSLLVENNLGKAAFDFFLNITYGPTLLGASQETIKVNPQMEHNHKAMIMCSAQANPSREQLTVEWIREISKILDQEELLDILKGQQKFISSDPIRCTNTHQWNKGKVNVNCISFGDVEIVTTMQIMPIDYRFIGSYRCIIKNSDKRPPAIKTIKLVYPTRPNPVKNFRKSEFAAQIFGKSELFCYFIGFPVPTVKWMTFYKNESLDNPVKYFTSVAQTEPGYFKAVLAISDTNESDLGKYICVAGNQYGESSHVVILNKPRSPTQPINFTVINVTETSVSVGWILRFNGGSKQQIKLYWRLRDTVVNGDYQNANIFEDEEKDVQFFTIYNLYRNREYEISIISVNEYSPSAGIPKPIIIKTMNYVDPDPDSIHIQNDSKRGFNKQLEKRIEPVESNNFLIIILLATVGVLLLTIKIGLIVYFVRKRKLKHRKSREKLSSPPTHQRMDTVGFISNDDSIEMRPPSLVRSGIESNLYAQSISDHMSQNGSDTGLKLNYYKTHSDDQFSSPFLGPELDLVASVRGRNNYDINALSPNFHPGYIQFAESSSMTSAQDPYIKGYYTQRPYYNSQTPSHGVIRKSSHSSNDTVTLPQYPISSSYQKRMDKVCFPQSAVSISTNSGDSNCSQSPPRKYIGYSPMVNQSGAPSTVEEYLSSGNSASESHRFGINGSDEYFTSPMSSFRLNQGLDSMSNKDFYSQLCSTNQQNQESAQEFAIQRIMYGNDVSAITPYRAYNDHQRLSTSSDNEHLLKPPLDFSGIESNNSNNIQSPMADAHKLSYVDLIAHSSPSVIRFTGPISENL 1621          
BLAST of NPHS1-1 vs. TrEMBL
Match: A0A0H3YFQ6 (NPHS1-6 OS=Schmidtea mediterranea OX=79327 GN=NPHS1-6 PE=2 SV=1)

HSP 1 Score: 385.956 bits (990), Expect = 5.410e-106
Identity = 376/1510 (24.90%), Postives = 673/1510 (44.57%), Query Frame = 2
Query:   71 NEMLNFWMICVFVLSNTFINRIEFVLCQDP---FNVDDLDAAESIS---LSQSSTCTEKDDIHRIQCFRELPSPKYDVLEGKDVLMGCRVAHQQGKLQWAFKGKMLGFDRNIPTYPRMRMTGNAVIGDHSLFIENVKVSDSGNYECQLSPAASQPP-RRRMTKLTVLKVPSTP-IIYQNGQSNKQNISV-SIKKDEFDSNINLTCVSLNGNPVPTFEWSVNRSPLKHGFKFRGNKVSIETINDTANSLSMKSSQIMNGDIVTCGVENNATRKMFNLTERIIKTQMRVFKRILPGKIVIKEVSDIEKTVYVTEGHQLQLSCVCNNPGDPPIDLKWNI----------NEDDLMIAQDKILSVKSEHFSQN----TFRMSNISRKWHRKELYCSGSQDNYAIPSSATVLILVNYPPS---KIEMEAISIKT-NVSLHNPSTVYCKEGQKVKLSCTSDNFFTDNVRILWFIK----------SSEESDWKPITTSFEKTVFTSDGRLKYITSSLEVPPSFVDKDISSHILSRLLSQVVCIVKSTEFNIEIRRQLKIELFEEPSVPVLTLNNLSKPQILTNGESAKLKCTVTGGHPTPQLRLLDERDREMKSSNLHEIGITRLEYNIEVKPRDNEKKFRCIVSYNNV-MDFESASSELMALQVANPPKQLHMKIISSMDNLIANQNFEMQCHTDSSFPEAKIEWWWHHSCKSSHTLGIRSTSKDVRSLCQSEILNEPQNINYQKSTQSTFTSINVKLTPEFD--LSFIECMIIPHEKWITINKVLSKLIKIRVRYPPQFLNVHKLPNDVQTFVVEKGNNFSIAIKSIAHPSINGYTWLVNKQPMEKK-IH-IDTSVDKFSIVNAQPEMMANYSLLVENNLGKAAFDFFLNITYGPTLLG---ASQETIKVNPQMEHNHKAMIMCSAQANPSREQLTVEWIREISKILDQEELLDILKGQQKFISSDPIRCTNTHQWNKGKVN-----------------------VNCISFGDVEIVTTMQIMPIDYRFIGSYRCIIKNSDKRPPAIKTIKLVYPTRPNPVKNFRKSEFAAQIFGKSELFCYFIGFPVPTVKWMTFYKNESLDNPVKYFTSVAQTEPGYFKAVLAISDTNESDLGKYICVAGNQYGESSHVVILNKPRSPTQPINFTVINVTETSVSVGWILRFNGGSKQQIKLYWRLRDTVVNGDYQNANIFEDEEKDVQFFTIYNLYRNREYEISIISVNEYSPSAGIPKPIIIKTMNYVDPDPDSIHIQNDSKRGFNKQLEKRIEP--VESNNFLIIILLATVGVLLLTIKIGLIVYFVRKRKLKHRKSR--EKLSSPPTHQRMDTVGFISNDDSIEMRPPSLVRSGIESNLYAQSISDHMSQNGSDTGLKLNYYKTHS------DDQ--FSSPFLGPELDLVASVRGRNNYDINALSPNFHPGYIQFAESSSMTSAQDPYIKGYYTQRPYYNSQTP---SHGVIRKSSHSSNDTVTLPQYPISSSYQKRM 4351
            N  L F+++ + + S        FV  Q P   F+  DL  +E  S   + QS  CT ++ ++RIQCF+E+P P Y+V +G    + C V +Q GK+QW     +LG+DRNIP  P  R+ G+ V G+H L I NV V D+G YECQ+ P   + P  RR TKL VL  P  P I Y+  Q N   + + SIK+   D     TCVS NG P   F+W +N + ++       N   +E +N + + LS+K+S+  +GD++ C V N AT    +   R + T++ +     PG+  I +++  + T YV + + + ++C  +  G P   L W            N  +    +D       +  S+N    T  +  ++ K H  +L+C  +    +  S+A  L +++ P      +   ++S +T      N + +Y + G++  ++CT+D ++ +   I W             S  E  WK      E   F  +  +K I  + +   SF+D    S I S                  ++ ++K+ +   P  P +   N+ KP  L +  + ++ C+  GG+P P+L+   +  + ++SS + +    +    I + P  N+ K +      ++ +     +S+ + L V  PP  + +K +S  + +   +  ++QC    S P A + W  +   +    LG R     V++ C  E+L+   +         +      ++ P +   L +++C +  +  +   ++VL K I+I V + PQF  +         F +E+G + ++ ++ IA+P I  YTW  N   + +K +H I TS  K  I NA+P  + NY+L+V N+ G++    +LNITY P ++G     +E I+ N ++E        CS Q+NP+   ++ +W    +K++  +   DI       + +  I C  +  ++K   N                         C+     E+ + + I  +D   +G YRC++ N   R   +KTI+L     P  +   + S+ A  +  +  LFCY    P P + W     N S+    KY  ++ +   G++ A L I +   +D G Y+C A N  G  S  + ++   +P  P+   V+N +++ + + WI  F+GGS Q  ++ W+ +       Y+  ++  D+ K    F I  L  +  Y ISI S N    ++   K I+  TM+             D+++  N+     I+P  ++ N  L I+  +  G ++L + I +I++ +R+R+ + R ++   + ++P +         +S DDS++    + +RS +   LY + +        S   L  N ++ HS      DDQ  FSS   G +      +R +  +    + PN   G        S+  A DP     Y       S TP    HG+  +      DT++    PI    Q+++
Sbjct:    7 NCFLKFFLVLILIGS--------FVSSQHPDQSFDDSDLTDSEMSSGAKIKQSIECTNEEIVNRIQCFQEIPKPVYEVAQGSAATLRCIVRNQYGKVQWRAVPVLLGYDRNIPGRPTYRVVGSVVKGEHFLEISNVTVKDAGIYECQVQPVGQEHPLLRRKTKLVVLVRPDQPQIFYKGFQPNGDQVIINSIKQ---DVRTEFTCVSDNGQPKVKFQWFLNNNLIQDN----ENSALLEELNYSRSRLSLKTSKFKDGDVIKCRVSNRATEVHQDPERRSLSTEVFIVIHTPPGQPQIVDMNPHKTTPYVVDDN-IIMTCESSPSGKPAGSLLWRWKYPKVRELYNNRFENYTTKDISPQYYQQTISKNKMVSTLTIPALTSKEHGAQLFCVATNPVISYQSTAVKLYILHIPNKVVISVSDGSLSSRTIGKDGLNENVIYGEAGEEKTITCTTDPYYNE-ATIKWVFSPNPAINNDFISPVEKIWK------EDESFRRNSTIK-IKINKQFDQSFLDCQAWSGIKS------------------VQSRVKLHITYSPEKPTIQGYNVGKPVKLNH--NFEMTCSTIGGNPYPELQWFRD-SKPIQSSFIAQQVGNQKTLKIIITPSINDNKVKYFCQAKSISLKSSPLNSDEVTLIVLFPPMTIGLKSLSGAE-VENGKLLKLQCTAGESNPPAVVRWKLNRCGQMMSELGRRP----VQTTCNEELLSASSSNTINGKFGGSLIQSYFEIYPSWKDHLDYVDCEVF-NPDYGEEHQVLRKRIQINVTFSPQFEGIINY-----NFYIEEGQSQTLNLEPIANPPIKDYTWFRNSTKLSRKNVHSISTSKAKLIIRNAKPVDIDNYTLVVVNDRGESQITIYLNITYQPIIIGDKFERKEIIRQNAELE--------CSVQSNPANPHMSYKW----TKLVPGKGYNDI--SSSDLVPAFTIGCNQSLPFSKEYKNEKPKPYSKAEWKGTPEKSNFKYFSKCMVKSQFEMTSLLIIYDVDRNDVGLYRCVVNNG-IRGDVVKTIELTKEFTPQILSLPKFSKAAGNLGEEVSLFCYIRSHPSPKMTWFFGRYNTSVSANSKYRINITRFRTGFYVAQLKIVNLQRTDHGSYVCKAENGKGSDSRKIEVSGTSTPDVPLEIQVVNKSQSQIEISWIQGFDGGSIQTFQVRWKEKSPT--SLYRYEDVASDDTKITLSFIITGLKSDTAYLISINSRNSKHGTSQFSKTIMTNTMSA------------DNEKENNQPTYPIIQPNKLQDNTILFIVAASVFGFVILVVNILVIIFVLRRRRQRSRTAKLEARYNNPKSLLAASNGLILSRDDSLKDSNFNYLRSDM-VELYPRGLD-------SSQILHHNPHQIHSLRRSIPDDQKTFSSFETGSDDAREDLLRRQKEFGCCGIDPNSQKG--------SIIVAYDPITNSSYYAPANATSPTPIYLQHGMYDQ------DTMSTLLSPIHEGGQRQL 1409          
BLAST of NPHS1-1 vs. TrEMBL
Match: A0A4E0RLR1 (Nephrin OS=Fasciola hepatica OX=6192 GN=D915_000783 PE=4 SV=1)

HSP 1 Score: 374.785 bits (961), Expect = 1.131e-101
Identity = 352/1446 (24.34%), Postives = 594/1446 (41.08%), Query Frame = 2
Query:  200 LSQSSTCTEKDDIHRIQCFRELPSPKYDVLEGKDVLMGCRVAHQQGKLQWAFKGKMLGFDRNIPTYPRMRMTGNAVIGDHSLFIENVKVSDSGNYECQLSPAASQPPRRRMTKLTVLKVPSTPIIYQ-NGQ---SNKQNISVSIKKDEFDSN--INLTCVSLNGNPVPTFEW-----SVNRSPLKHGFKF-----RGNKVS--IETINDTANSLSMKSSQIMNGDIVTCGVENNATRKMFNLTERIIKTQMRVFKRILPGKIVIKEVS-DIEKTVYVTEGHQLQLSCVCNNPGDPPIDLKWNINEDDLMIAQDK--------------ILSVKSEHFSQ--------NTFRMSNISRKWHRKELYCSGSQDNYAIPSSATVLILVNYPPSKIEM----EAISI---------------KTNVSLHNPSTV--YCKEGQKVKLSCTSDNFFTDNVRILWFIKSSEESDWKPITTSFEKTVFTSDGRLKYI---------TSSLEVPPSFVDKDISSHILSRLLSQVVCIVKSTEFNIEIRRQLKIELFEEPSVPVLTLNNLSKPQILTNGESAKLKCTVTGGHPTPQLRLLDER-DREMKSSNLHEI------------GITRLEYNIEVKPRDNEKKFRCIVSYNNVMDFESASSELMALQVANPPKQLHMKIISSMDNLI-------------------------------ANQNFEMQCHTDSSFPEAKIEWWWHHSCKSSHTLGIRSTSKDVRSLCQSEILNEPQNINYQKSTQSTF------TSINVKLTPEFDLSFIECMIIPHEKWITINKVLSKLIK-------IRVRY------------PPQFLN-----------VHKLPNDVQTFVVEKGNNFSIAIKSIAHPSINGYTWLVNKQPMEKKIHIDTSVDK-----FSIVNAQP---EMMANYSLLVENNLGKAAFDFFLNITYGPTLLGASQETIKVNPQMEHNHKAMIMCSAQANPSREQLTVEWIREISKIL------------------------DQEELLDILKGQQKFISSDPIRCTNTHQWNKG-KVNVNCISFGDVEIVTTMQIMPIDYRFIGSYRCIIKNSDKRPPAIKTIKLVYPTRPN--PVKNFRKS----------------EFAAQIFGKSELFCYFIGFPVPTVKWMTFYKNESLDNPVKYFTSVAQTEPGYFKAVLAISDTNESDLGKYICVAGNQYGESSHVVILNKPRSPTQPINFTVINVTETSVSVGWILRFNGGSKQQIKLYWRLRDTVVNGD-YQNANIFEDEEKDVQFFTIYNLYRNREYEISIISVNEYSPSAGIPKPIIIKTMNYVDPDPDSIHIQNDSK-RGF---------------NKQLEKR-------IEPVESNNFLIIILLATVGVLLLTIKIGLIVYFV-RKRKLKHRKSREKL 3856
            + QS+TCT + D  RIQC RELP+  Y+VLEG+DV M CRVAHQ+GK QW  +  +LG+ RNIP++PR  M G+   G+H L I NV   D+G YECQ+SP A Q P RR T L++L  PS P+I   +G+   +    ++V ++         + L+C S  GNP P FEW      +N++       F     RG+  +  I  +   +  L +   Q+  GD + C + N AT++   L+++ ++ ++ V     PG   I + S     +  +TEG  L+ +C  +  G+PP +L W         A+ K              I  + +E+  Q        +  R++ ++   H  +L C+  +       SA + + V Y P  +++    E + +               + N    N ++   Y  + +   L C +  +F D  +I W+   +    W PI      T   + G+  +I         T+S   P  +      S       + +   V   E N  + + + ++ +  P  P  +++   +  +   G +  L C    G P   L  L+    +       H +            G+ R    I++    N   ++C          E   S+ + + VA     + M +       +                               A     ++CH D S P  KI+W  +     +  L  + + KD+   C  E +   Q I Y+ + ++ F      + I + L        IEC+  P   W      +S  IK       +R R             P Q LN            H+LP     F+V  G    + ++  A+P +  + W  N++ +        S D+      S++  +P     MANY+LL  N+LG A F FFLN+TYGP L+G+    I V        KA++ C A+ANP+  +  V W R IS                            Q+ + D +KG         IRC N   W+ G K    C +     + +++ I  +    +G Y+C + N+   P A++ + L+YP  P   PV  + KS                + +A +F ++ L C     P PTV+W+    N +L    ++ + +    PG + AVL ++   + DLGKY C A N  GE +  V L  P +P  P    ++N T T+++V W   +NGGS Q+ KL W   +   N D +  A+I ED +++   + I  L +   Y +++ + N    ++G  + ++  T    DP PD   + ++++ + F               N + ++R       ++  E    +III  +  G L+L   + +I +   R RK  H++ R  +
Sbjct:  109 IDQSNTCTPQQDAQRIQCLRELPAESYEVLEGEDVQMRCRVAHQRGKAQWRARHYLLGYKRNIPSWPRYSMQGDPRQGEHDLVITNVTHEDAGTYECQVSPVAGQSPLRRQTTLSILVKPSQPVIVAPSGEPQPTPNGRLTVPLRHSTPGERNLLRLSCQSHGGNPPPIFEWFHNGLVLNKTTTSSDTDFLTNTGRGDDFAFRIPGVEYHSAELILDKEQLRTGDRLVCLISNKATQRSKKLSQQKLRAELYVIIHSPPGNPEIIDWSLKSNASQILTEGAPLEATCRSSPAGNPPGELVWRWESSSSDSAEGKASLTPNPVTRIPQIITPIPAEYAVQQHMDEKLLSKVRITQVNSSQHGMDLVCA-VKHPIGPEKSARIPVFVRYGPQSVDIHGPEETVDLLKEAMDKRLHLFQTDRDNRGTRNATSAIRYVYQDRPQYLLCLTSPYF-DRAQIQWYGLLNISGQWHPIAPLESFTRVLATGQKNFILASMIQLVSTNSERTPLRWTAIKCVSKADVTDAAGIHKDVSDLESNKAVMKIIDLKSYVPPGKP--SISGYKQNMLYQEGTNITLSCEARAGIPPGYLVWLESSVAKASAEKTRHSLVIPNTTTLAGPDGMIRSTLIIQLTREQNGHFYQCASENKGFPRSEVRVSDSVQMGVAFAATSITMTVADETGRALFPRDHTLSQNSNPNQSVRLDKSHNPPIVSAQAGGKVAVKCHMDLSNPRPKIQWRLYRCPTHTVNLSEQISFKDLTKDCVIETI---QGIIYRGTEENVFDEKVIESQILLALNWSHHGDIIECVAEPQVPWAMGPDQVSVHIKDGLSQPRLRERVLMNILFAPLFLRPAQHLNWPVEKMHVGLFEHRLPQ----FIVVDGGAVDLDLEPSANPEVTSFVWYKNEEMLSTSAATSGSFDERISVHHSVLRIKPVRVADMANYTLLATNSLGTARFRFFLNVTYGPQLIGSPILNITVA-----GRKALLECQAKANPTPSENAVRW-RRISHSFAHLDPVHKFYRASNNAVTMSESNEQQQSIADSVKG---------IRC-NKGTWHNGFKYFAKCWNPSPGVLASSLTIYDLGPSDVGRYQCHMDNAVGSP-AVRIVDLIYPFAPQVVPVPRWTKSAPGKGYEGLVNNSSDEDPSAGVF-RARLTCVIAAEPKPTVEWIREPANLTLVEGGQFRSQIKAVRPGLYHAVLFLNKPRDVDLGKYYCKAKNLVGEDAGQVELGTPTAPDLPTKPRLLNATSTTLAVAWTQGYNGGSLQKFKLRWASNE---NPDKFTEADISEDLDRETIAYEIKGLQKITSYRVAVSASNAEHGTSGFTQYLLASTTAR-DPIPDKEAMHDEARVKSFSTLGHWDTKGSGPDDNDESQRRLARAGLDVQTSEDKAVVIIIAASIFGSLVLVANLLIIAFLAQRHRKKLHQQRRSSI 1521          
BLAST of NPHS1-1 vs. TrEMBL
Match: A0A4S2LBK4 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_008491 PE=4 SV=1)

HSP 1 Score: 358.992 bits (920), Expect = 4.235e-97
Identity = 326/1328 (24.55%), Postives = 584/1328 (43.98%), Query Frame = 2
Query:  170 DDLDAAESISLSQSSTCTEKDDIHRIQCFRELPSPKYDVLEGKDVLMGCRVAHQQGKLQWAFKGKMLGFDRNIPTYPRMRMTGNAVIGDHSLFIENVKVSDSGNYECQLSP--AASQPPRRRMTKLTVLKVPSTPIIYQNGQSNKQNISVSIKKDEFDSNINLTCVSLNGNPVPTFEWSVNRS-----PLKHGFKF---RGNKVSIETINDTA-----NSLSMKSSQIMNGDIVTCGVENNATRKMFNLTERIIKTQMRVFKRILPGKIVIKEVSDIEKTVYVTEGHQLQLSCVCNNPGDPPIDLKWN--------------------------INE-------------------DDLMIAQDKILS--VKSEHFSQN--------TFRMSNISRKWHRKELYCSGSQDNYAIPSS--ATVLILVNYPPSK--IEMEAISIKTN-VSLHNPSTVYCKEGQKVKLSCTSDNFFTDNVRILWFIKSSEESDWKPITTSFEKT--VFTSDGRLKYITSSLEVPPSFVDKDISSHILSRLLSQVVCIVKSTEFNIEIRRQLKIELFEEPSVPVLTLNNLSKPQILTNGESAKLKCTVTGGHPTPQLRLLDERDREMKSSNLHEIGITRLEYNIEVK--PR--DNEKKFRCIVSYNNVMDFESASSELMALQVANPPKQLHMKIISSMDNLIANQNFEMQCHTDSSFPEAKIEWWWHHSCKSSHTLGIRSTSKDV------------RSLCQSEIL--NEPQNINYQKSTQSTFTSINVKLTPEFDLSFIECMIIPHEKWITINKVLSKLIKIRVRYPPQFLNVHKLPNDVQTFVVEKGNNFSIAIKSIAHPSINGYTWLVNKQPMEKK---------IHIDTSVDKF-SIVNAQPEMMANYSLLVENNLGKAAFDFFLNITYGPTLLGASQETIKVNPQMEHNHKAMIMCSAQANPSREQLTVEWIREISKILDQEELLDILKGQQKFISSDPIRCTNTHQWNKGKVNVNCISFGDVEIVTTMQIMPIDYRFIGSYRCIIKNSDKRPPAIKTIKLVYPTRPNPVKNFRKSEFAAQIFGKSELFCYFIGFPVPTVKWM----TFYKNESLDNPV---KYFTSVAQTEPGYFKAVLAISDTNESDLGKYICVAGNQYGESSHVVILNKPRSPTQPINFTVINVTETSVSVGWILRFNGGSKQQIKLYWRLRDTVVNGDYQNANIFEDEEKDVQFFTIYNLYRNREYEISIISVNEYSPSAGIPKPIIIKTMNYVDPDPDSIHIQNDSKRGFNKQLEKRIEPVESNNFLIIILLATVGVLLLTIKIGLIVYFVR 3817
            D +DAA  I   QSS CT ++   RIQCF  LP  +Y V  G  V M C V +Q GK+QW  K  +LG+DR++P YPR R+ G+   G H+L I +V++ D+G YECQ++P  A + P  RR T+L VL  PS P I         N  +  + D     I + C ++ G+P P+F W +N       PL+        RG    ++ I +T      + LS+  + + +GD +TC V N AT+   ++ +R + TQ+ +     PG   I  +S   K  Y+ EG +L+  CV + PG+P   L W                           +NE                   D++      ++S  V+  H++ N        T  +  I+R++H  +L C   +  + + S+   ++ I V Y P+   I ++  S++   VS    S VY + G+   L C +  +F     I W  +SS+    KP    F +T  + T DG+     S ++V     ++D   ++  R+ S         E ++ +  ++++++   P VPV+T     +P  + +  S ++ C  +GG+P P+L     RD++ +  N  E+ +   + ++++K  P+  DN   + C  + N        +S+ + L V  PP+ + +        + + Q   + C  DSS P A I WW H  C  +H       SK              R+ C+SE L   E   +          + + ++ T  + + +IEC     E       V    +++ + + PQFL +      V    + +G   ++ +   ++P +   +W V  +P+  +         +H    + +  ++       MANY+++  N++ +++  FFLN+T+  +L GA++E +        + +  ++C A ANPS       W R +      +   D+ + + +  +  P   ++       K  ++C     + + + + I  I+   +G+Y C I N    P   K I  VY   P+ V+  R ++ A +      L C     P P + W+      Y ++   +     K+ T   +  PG +K+ L +++  ++D G Y C A N  GE+   V L+   +P  P+N  ++N T  S+ V W   F+GG  Q  ++ WRL  T  N  ++ A++  ++      + I  L    EY++S+ S+N    ++     I ++T  + D +P S  +   S  G          P + N  LII+     G ++L I + ++ + V+
Sbjct:   36 DSVDAARVI---QSSACTPRERQDRIQCFDVLPQDQYSVPLGNTVNMQCVVLNQHGKVQWRAKKILLGYDRSLPGYPRYRIIGDVGRGQHTLQIMDVQLEDAGEYECQVTPVPANNHPLLRRKTELVVLVKPSVPRILYPDVPPPDNQLIISQPDPI-VRITVLCATVGGSPAPSFTWIINNQEIPMKPLQASAGRHPDRGPWAKLDPIINTETEKQESRLSLLKAGLKDGDQLTCSVTNAATQLHHDIQQRNLTTQVVIRVHTPPGPPRI--ISPETKYEYL-EGEELKAVCVASPPGNPFGGLFWRWLLQPSQVGDQKTGRIIGFGGRGGARMNEYSDVEAYLKTAEHLGSQSADEMSQGMSDLISEDVQPLHYTLNKEKDQLINTLVIPRITRRYHAAKLIC---ETGHPVGSAHQTSIEIFVKYAPANVTISVDGGSVREELVSGRRESVVYGQAGEIKTLICRTSPYF-KQANIKWITQSSDSGPMKPPRQLFGQTKIMRTPDGKSWLQESRVDV--KISEEDDRGYVDCRVWS---------EGDLRVDARVRMDIIYPPGVPVITGYRSLQPVKMAH--SLEMTCVTSGGNPPPELAWF--RDKQ-QLPNAEEVILLGRQSSLKLKLVPQRDDNGAHYHC-AARNAATGNVGIASDAVVLNVVFPPQGVSVNF-HGPSVVPSGQPLVISCQADSSNPVATINWW-HFRCGPAHAFSQFKASKTTIEEALYDRRTSERAKCKSEKLEGTEENPVPGTAGGLKAQSRLWLRPTWHYHMDYIECRT---ENPEYGPPVWHDRLQLNITFAPQFLGLQTRKEQV----IREGTTVNLDLGPYSNPPVTSVSWFVEGRPIPPETPPAAARTGVHTSGRLGELLALHKISRTHMANYTVVARNDIAESSAVFFLNVTFPASLAGAAEENVT----QTTSDQVTLVCQATANPSIATQAFTWYRYVPPPGWPQ---DVNEAEVQLSAPMPCNQSDASPSVDDKYFIHCQRDDSIHMTSRLSIYRINRDDVGTYVCEINNGLGDP-VRKNIHFVYHFTPSIVRLPRYTKAAGEQGSTVTLTCLVRTEPTPQIGWLKAGQMIYDSQREGSGALTQKHQTQFLRIRPGLYKSTLTLTNLQKTDFGVYQCQAVNIKGEAMLEVSLSGTSTPDVPLNLRLLNSTANSLRVAWTQGFDGGLTQTFQVRWRLA-TGSNNMFKYADVAANDNHHAVEYLITGLESGAEYQVSVNSMNAKHGASAHTDFIHVRTEAF-DREPGSPLVPPLSSAG----------PSDDNALLIIVAACVFGFIVLIINLVVVTFLVK 1306          
BLAST of NPHS1-1 vs. TrEMBL
Match: A0A4S2LB20 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_008491 PE=4 SV=1)

HSP 1 Score: 358.992 bits (920), Expect = 4.308e-97
Identity = 326/1328 (24.55%), Postives = 584/1328 (43.98%), Query Frame = 2
Query:  170 DDLDAAESISLSQSSTCTEKDDIHRIQCFRELPSPKYDVLEGKDVLMGCRVAHQQGKLQWAFKGKMLGFDRNIPTYPRMRMTGNAVIGDHSLFIENVKVSDSGNYECQLSP--AASQPPRRRMTKLTVLKVPSTPIIYQNGQSNKQNISVSIKKDEFDSNINLTCVSLNGNPVPTFEWSVNRS-----PLKHGFKF---RGNKVSIETINDTA-----NSLSMKSSQIMNGDIVTCGVENNATRKMFNLTERIIKTQMRVFKRILPGKIVIKEVSDIEKTVYVTEGHQLQLSCVCNNPGDPPIDLKWN--------------------------INE-------------------DDLMIAQDKILS--VKSEHFSQN--------TFRMSNISRKWHRKELYCSGSQDNYAIPSS--ATVLILVNYPPSK--IEMEAISIKTN-VSLHNPSTVYCKEGQKVKLSCTSDNFFTDNVRILWFIKSSEESDWKPITTSFEKT--VFTSDGRLKYITSSLEVPPSFVDKDISSHILSRLLSQVVCIVKSTEFNIEIRRQLKIELFEEPSVPVLTLNNLSKPQILTNGESAKLKCTVTGGHPTPQLRLLDERDREMKSSNLHEIGITRLEYNIEVK--PR--DNEKKFRCIVSYNNVMDFESASSELMALQVANPPKQLHMKIISSMDNLIANQNFEMQCHTDSSFPEAKIEWWWHHSCKSSHTLGIRSTSKDV------------RSLCQSEIL--NEPQNINYQKSTQSTFTSINVKLTPEFDLSFIECMIIPHEKWITINKVLSKLIKIRVRYPPQFLNVHKLPNDVQTFVVEKGNNFSIAIKSIAHPSINGYTWLVNKQPMEKK---------IHIDTSVDKF-SIVNAQPEMMANYSLLVENNLGKAAFDFFLNITYGPTLLGASQETIKVNPQMEHNHKAMIMCSAQANPSREQLTVEWIREISKILDQEELLDILKGQQKFISSDPIRCTNTHQWNKGKVNVNCISFGDVEIVTTMQIMPIDYRFIGSYRCIIKNSDKRPPAIKTIKLVYPTRPNPVKNFRKSEFAAQIFGKSELFCYFIGFPVPTVKWM----TFYKNESLDNPV---KYFTSVAQTEPGYFKAVLAISDTNESDLGKYICVAGNQYGESSHVVILNKPRSPTQPINFTVINVTETSVSVGWILRFNGGSKQQIKLYWRLRDTVVNGDYQNANIFEDEEKDVQFFTIYNLYRNREYEISIISVNEYSPSAGIPKPIIIKTMNYVDPDPDSIHIQNDSKRGFNKQLEKRIEPVESNNFLIIILLATVGVLLLTIKIGLIVYFVR 3817
            D +DAA  I   QSS CT ++   RIQCF  LP  +Y V  G  V M C V +Q GK+QW  K  +LG+DR++P YPR R+ G+   G H+L I +V++ D+G YECQ++P  A + P  RR T+L VL  PS P I         N  +  + D     I + C ++ G+P P+F W +N       PL+        RG    ++ I +T      + LS+  + + +GD +TC V N AT+   ++ +R + TQ+ +     PG   I  +S   K  Y+ EG +L+  CV + PG+P   L W                           +NE                   D++      ++S  V+  H++ N        T  +  I+R++H  +L C   +  + + S+   ++ I V Y P+   I ++  S++   VS    S VY + G+   L C +  +F     I W  +SS+    KP    F +T  + T DG+     S ++V     ++D   ++  R+ S         E ++ +  ++++++   P VPV+T     +P  + +  S ++ C  +GG+P P+L     RD++ +  N  E+ +   + ++++K  P+  DN   + C  + N        +S+ + L V  PP+ + +        + + Q   + C  DSS P A I WW H  C  +H       SK              R+ C+SE L   E   +          + + ++ T  + + +IEC     E       V    +++ + + PQFL +      V    + +G   ++ +   ++P +   +W V  +P+  +         +H    + +  ++       MANY+++  N++ +++  FFLN+T+  +L GA++E +        + +  ++C A ANPS       W R +      +   D+ + + +  +  P   ++       K  ++C     + + + + I  I+   +G+Y C I N    P   K I  VY   P+ V+  R ++ A +      L C     P P + W+      Y ++   +     K+ T   +  PG +K+ L +++  ++D G Y C A N  GE+   V L+   +P  P+N  ++N T  S+ V W   F+GG  Q  ++ WRL  T  N  ++ A++  ++      + I  L    EY++S+ S+N    ++     I ++T  + D +P S  +   S  G          P + N  LII+     G ++L I + ++ + V+
Sbjct:   36 DSVDAARVI---QSSACTPRERQDRIQCFDVLPQDQYSVPLGNTVNMQCVVLNQHGKVQWRAKKILLGYDRSLPGYPRYRIIGDVGRGQHTLQIMDVQLEDAGEYECQVTPVPANNHPLLRRKTELVVLVKPSVPRILYPDVPPPDNQLIISQPDPI-VRITVLCATVGGSPAPSFTWIINNQEIPMKPLQASAGRHPDRGPWAKLDPIINTETEKQESRLSLLKAGLKDGDQLTCSVTNAATQLHHDIQQRNLTTQVVIRVHTPPGPPRI--ISPETKYEYL-EGEELKAVCVASPPGNPFGGLFWRWLLQPSQVGDQKTGRIIGFGGRGGARMNEYSDVEAYLKTAEHLGSQSADEMSQGMSDLISEDVQPLHYTLNKEKDQLINTLVIPRITRRYHAAKLIC---ETGHPVGSAHQTSIEIFVKYAPANVTISVDGGSVREELVSGRRESVVYGQAGEIKTLICRTSPYF-KQANIKWITQSSDSGPMKPPRQLFGQTKIMRTPDGKSWLQESRVDV--KISEEDDRGYVDCRVWS---------EGDLRVDARVRMDIIYPPGVPVITGYRSLQPVKMAH--SLEMTCVTSGGNPPPELAWF--RDKQ-QLPNAEEVILLGRQSSLKLKLVPQRDDNGAHYHC-AARNAATGNVGIASDAVVLNVVFPPQGVSVNF-HGPSVVPSGQPLVISCQADSSNPVATINWW-HFRCGPAHAFSQFKASKTTIEEALYDRRTSERAKCKSEKLEGTEENPVPGTAGGLKAQSRLWLRPTWHYHMDYIECRT---ENPEYGPPVWHDRLQLNITFAPQFLGLQTRKEQV----IREGTTVNLDLGPYSNPPVTSVSWFVEGRPIPPETPPAAARTGVHTSGRLGELLALHKISRTHMANYTVVARNDIAESSAVFFLNVTFPASLAGAAEENVT----QTTSDQVTLVCQATANPSIATQAFTWYRYVPPPGWPQ---DVNEAEVQLSAPMPCNQSDASPSVDDKYFIHCQRDDSIHMTSRLSIYRINRDDVGTYVCEINNGLGDP-VRKNIHFVYHFTPSIVRLPRYTKAAGEQGSTVTLTCLVRTEPTPQIGWLKAGQMIYDSQREGSGALTQKHQTQFLRIRPGLYKSTLTLTNLQKTDFGVYQCQAVNIKGEAMLEVSLSGTSTPDVPLNLRLLNSTANSLRVAWTQGFDGGLTQTFQVRWRLA-TGSNNMFKYADVAANDNHHAVEYLITGLESGAEYQVSVNSMNAKHGASAHTDFIHVRTEAF-DREPGSPLVPPLSSAG----------PSDDNALLIIVAACVFGFIVLIINLVVVTFLVK 1306          
BLAST of NPHS1-1 vs. Ensembl Cavefish
Match: kirrel3a (kirre like nephrin family adhesion molecule 3a [Source:ZFIN;Acc:ZDB-GENE-091117-44])

HSP 1 Score: 75.485 bits (184), Expect = 3.436e-13
Identity = 54/195 (27.69%), Postives = 86/195 (44.10%), Query Frame = 2
Query:  284 VLEGKDVLMGCRVAHQQGKLQWAFKGKMLGFDRNIPTYPRMRMTGNAVIGDHSLFIENVKVSDSGNYECQLSPAASQPPRRRMTKLTVLKVPSTPIIYQNGQSNKQNISVSIKKDEFDSNINLTCVSLNGNPVPTFEWSVNRSPLKHGFKFRGNKVSIETIND-----TANSLSMKSSQIMNGDIVTCGVENNAT 853
            V+ G+ V + C +    G + W   G  LG +R++  YPR  + G+   G++ L I+  ++ D G++ECQ   A     R R  +LTVL  P  P+I          I   I        +NLTC + N  P  +  W      +++G    G   S   + D     T ++L + +S I +G  +TC   N A 
Sbjct:   40 VVAGQPVTLPCSITGFHGMVLW--DGLALGVNRDLSGYPRYDVIGDHSKGEYHLLIQRTELGDDGSFECQGIQAGI---RSRPARLTVLVPPDDPVI----------IGAPIVSLRAGDPLNLTCHADNAKPAASIIW------IRNGEVLNGAMYSKTLLRDGQRESTVSTLYISASNIESGQRITCRASNKAA 213          
BLAST of NPHS1-1 vs. Ensembl Cavefish
Match: KIRREL3 (kirre like nephrin family adhesion molecule 3 [Source:HGNC Symbol;Acc:HGNC:23204])

HSP 1 Score: 74.7146 bits (182), Expect = 7.274e-13
Identity = 55/194 (28.35%), Postives = 85/194 (43.81%), Query Frame = 2
Query:  284 VLEGKDVLMGCRVAHQQGKLQWAFKGKMLGFDRNIPTYPRMRMTGNAVIGDHSLFIENVKVSDSGNYECQLSPAASQPPRRRMTKLTVLKVPSTPIIYQNGQSNKQNISVSIKKDEFDSNINLTCVSLNGNPVPTFEWSVNRSPLKHGFKFRGNKVSIETIND-----TANSLSMKSSQIMNGDIVTCGVENNA 850
            V+ G+ V + C +    G + W   G  LG  R++  YPR  + G+   G+H L I+ V++ D   +ECQ   AA    R R  +LTVL  P  P+I            VS++  +    +NLTC + N  P  +  W      +++G    G   S   + D     T ++L +  S I  G  + C   N A
Sbjct:   11 VVAGQPVTLPCSIPGYHGVVLWIKDGLALGVGRDLSGYPRYTVVGDHSSGEHHLRIQRVELMDDAVFECQAIQAAM---RSRPARLTVLVPPEDPVI-------DGGPIVSLRAGD---PLNLTCHADNAKPAASIIW------IRNGEVLNGAMYSKTLLRDGRRESTVSTLYISPSNIETGQKIICRASNKA 185          
BLAST of NPHS1-1 vs. Ensembl Cavefish
Match: KIRREL3 (kirre like nephrin family adhesion molecule 3 [Source:HGNC Symbol;Acc:HGNC:23204])

HSP 1 Score: 74.3294 bits (181), Expect = 7.449e-13
Identity = 55/194 (28.35%), Postives = 85/194 (43.81%), Query Frame = 2
Query:  284 VLEGKDVLMGCRVAHQQGKLQWAFKGKMLGFDRNIPTYPRMRMTGNAVIGDHSLFIENVKVSDSGNYECQLSPAASQPPRRRMTKLTVLKVPSTPIIYQNGQSNKQNISVSIKKDEFDSNINLTCVSLNGNPVPTFEWSVNRSPLKHGFKFRGNKVSIETIND-----TANSLSMKSSQIMNGDIVTCGVENNA 850
            V+ G+ V + C +    G + W   G  LG  R++  YPR  + G+   G+H L I+ V++ D   +ECQ   AA    R R  +LTVL  P  P+I            VS++  +    +NLTC + N  P  +  W      +++G    G   S   + D     T ++L +  S I  G  + C   N A
Sbjct:   11 VVAGQPVTLPCSIPGYHGVVLWIKDGLALGVGRDLSGYPRYTVVGDHSSGEHHLRIQRVELMDDAVFECQAIQAAM---RSRPARLTVLVPPEDPVI-------DGGPIVSLRAGD---PLNLTCHADNAKPAASIIW------IRNGEVLNGAMYSKTLLRDGRRESTVSTLYISPSNIETGQKIICRASNKA 185          
BLAST of NPHS1-1 vs. Ensembl Cavefish
Match: kirrel3l (kirre like nephrin family adhesion molecule 3, like [Source:ZFIN;Acc:ZDB-GENE-070831-1])

HSP 1 Score: 73.559 bits (179), Expect = 1.631e-12
Identity = 41/138 (29.71%), Postives = 67/138 (48.55%), Query Frame = 2
Query:  284 VLEGKDVLMGCRVAHQQGKLQWAFKGKMLGFDRNIPTYPRMRMTGNAVIGDHSLFIENVKVSDSGNYECQLSPAASQPPRRRMTKLTVLKVPSTPIIYQNGQSNKQNISVSIKKDEFDSNINLTCVSLNGNPVPTFEW 697
            V+ G+ V + C +   +G +QW   G  LG +R++P + R  + G+   G+HSL IE+ +++D   YECQ + A  +  R R   LTVL  PS P++              + + +  +  NLTC +    P     W
Sbjct:   27 VVAGQSVTLPCVIVGYRGMVQWTKDGLALGGERDLPGWTRYSLLGDPASGEHSLVIESSELADDAVYECQATQAGLRSHRAR---LTVLVPPSDPVVDGG----------PVVRLKAHTPHNLTCRATGAKPAAEITW 151          
BLAST of NPHS1-1 vs. Ensembl Cavefish
Match: kirrel3l (kirre like nephrin family adhesion molecule 3, like [Source:ZFIN;Acc:ZDB-GENE-070831-1])

HSP 1 Score: 73.1738 bits (178), Expect = 1.741e-12
Identity = 41/138 (29.71%), Postives = 67/138 (48.55%), Query Frame = 2
Query:  284 VLEGKDVLMGCRVAHQQGKLQWAFKGKMLGFDRNIPTYPRMRMTGNAVIGDHSLFIENVKVSDSGNYECQLSPAASQPPRRRMTKLTVLKVPSTPIIYQNGQSNKQNISVSIKKDEFDSNINLTCVSLNGNPVPTFEW 697
            V+ G+ V + C +   +G +QW   G  LG +R++P + R  + G+   G+HSL IE+ +++D   YECQ + A  +  R R   LTVL  PS P++              + + +  +  NLTC +    P     W
Sbjct:   24 VVAGQSVTLPCVIVGYRGMVQWTKDGLALGGERDLPGWTRYSLLGDPASGEHSLVIESSELADDAVYECQATQAGLRSHRAR---LTVLVPPSDPVVDGG----------PVVRLKAHTPHNLTCRATGAKPAAEITW 148          
BLAST of NPHS1-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002463.1 (pep scaffold:Pmarinus_7.0:GL476400:5068:120393:-1 gene:ENSPMAG00000002229.1 transcript:ENSPMAT00000002463.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.1434 bits (126), Expect = 7.173e-7
Identity = 58/214 (27.10%), Postives = 88/214 (41.12%), Query Frame = 2
Query: 3077 GKSELFCYFIGFPVPTVKWMTFYKNESLDNPVKYFTSVAQTEPGYFKAVLAISDTNESDLGKYICVAGNQYGESSHVVILNKPRSPTQPINFTVINVTETSVSVGWILRF-NGGSKQQIKLYWRLRDTVVNGDYQNANIFEDEEKDVQFFTIYNLYRNREYEISIISVNEYSPSAGIPK--PIIIKTMNYVDPDPDSIHIQNDSKRGFNKQLEK 3709
            G   LF    G P P V+W      E  DN   +    AQ E      +L + + N  D GKY     N  G+ S  V +    SP+ P+NF V +VT+  VSV W     +GGSK    +  +   T      + A +          F + +L     Y   +++VNE+    GIP   P  ++   Y  P P  + +++ +K   +   EK
Sbjct: 11027 GTLRLFVPIKGRPDPEVRW------EKEDN--VHLRDRAQIEVTSSYTMLVVDNVNRFDSGKYTLNLENSSGKKSAFVNVRILDSPSAPVNFKVKDVTKNYVSVTWDPPLIDGGSKITAYIVEKREST------RKAYVTVTNSCHKTSFKVEDLLEGCHYYFRVVAVNEF--GMGIPADTPEAVRAAEYPLP-PGKVTLRDVTKNSASISWEK 11223          

HSP 2 Score: 49.6766 bits (117), Expect = 8.732e-6
Identity = 48/170 (28.24%), Postives = 78/170 (45.88%), Query Frame = 2
Query: 3101 FIGFPVPTVKWMTFYKNESLDNPVKYFTSVAQTEPGYFKAVLAISDTNESDLGKYICVAGNQYGESSHVVILNKPRSPTQPINFTVINVTETSVSVGW-ILRFNGGSKQQIKLYWRLRDTVVNGDYQNANIFEDEEKDVQFFTIYNLYRNREYEISIISVNEYSPSAGIP 3607
            F G PVP +KW+        DN +   +  AQ E G     ++I + +  D GKY+    N  G  S  V +    +P  P+N TV ++T+ S ++ W     +GG++  IK Y  + D   +     ANI     K+   F ++NL     +   +++ NEY    G+P
Sbjct: 9952 FRGRPVPDIKWL------KDDNEI---SDKAQIERGLNYTSISIDNCDRYDAGKYVLNLENSAGTKSAFVSVKVFDTPGPPLNLTVKDITKDSATLTWEPPAIDGGAR--IKNY--VIDKRESTRKAYANITTQCHKN--SFKVHNLLEGGIFYFRVMAENEY--GLGVP 10104          
BLAST of NPHS1-1 vs. Ensembl Nematostella
Match: EDO45224 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTJ3])

HSP 1 Score: 48.521 bits (114), Expect = 9.967e-6
Identity = 30/102 (29.41%), Postives = 45/102 (44.12%), Query Frame = 2
Query: 3038 KNFRKSEFAAQIFGKSELFCYFIGFPVPTVKWMTFYKNESLDNPVKYFTSVAQTEPGYFKAVLAISDTNESDLGKYICVAGNQYGESSHVVILNKPRSPTQP 3343
            ++  KS  ++ +     L CY  G P P + W          NP  + TSV    PG   +VL ++  +E D G Y C A N  G   HV+ + +   P +P
Sbjct:   19 RSLSKSNTSSWVEHTVSLHCYVSGSPPPVITWY---------NPASHVTSV----PG--GSVLTVTTRSEQDYGSYTCRAVNSVGSHEHVISVIQWTPPGKP 105          
BLAST of NPHS1-1 vs. Ensembl Medaka
Match: nphs1 (NPHS1 adhesion molecule, nephrin [Source:NCBI gene;Acc:101155460])

HSP 1 Score: 118.627 bits (296), Expect = 2.814e-26
Identity = 246/1127 (21.83%), Postives = 422/1127 (37.44%), Query Frame = 2
Query:  248 QCFRELPSPKYDVLEGKDVLMGCRVAHQQGKLQWAFKGKMLGFDRNIPTYPRMRMTGNAVIGDHSLFIENVKVSDSGNYECQLSPA-ASQPPRRRMTKLTVLKVPSTPIIYQNGQSNKQNISVSIKKDEFDSNINLTCVSLNGNPVPTFEWSVNRSPLKHGFKFRGNKVSIETINDTANSLSMKSSQIMNGDIVTCGVENNATRKMFNLTERIIKTQMRVFKRILPGKIVIKEVSDIEKTVYVTEGHQLQLSCVCNNPGDPPIDLKWNINEDDLMIAQDKILSVKSEHFSQNTFRMSNISRKWHRKELYCSGSQDNYAIPSSATVLILVNYPPSKIEMEAISIKTNVSLHNPSTVYCKEGQKVKLSCTSDNFFTDNVRILWFIKSSEESDWKPITTSFEKTVFT-SDGRLKYITSSLEVPPSFVDKDISSHILSRLLSQVVCIVKSTEFNIEIRRQLKIELFEEPSVPVLTLNNLSKPQILTNGESAKLKCTVTGGHPTPQLRLLDERDREMKS--SNLHEIGITRLEYNIEVKPRDNEKKFRCIVSYNNVMDFESASSELMALQVANPPKQLHMKIISSMDNLIANQNFEMQCHTDSSFPEAKIEWWWHHSCKSSHTLGIRSTSKDVRSLCQSEILNEPQNINYQKSTQSTFTSINVKLTPEFDLSFIECMIIPHEKWITINKVLSK----LIKIRVRYPPQFLNVHKLPNDVQTFVVEKGNNFSIAIKSIAHPSINGYTWLVNKQPMEKKIHIDTSVDKFSIVNAQPEMMANYSLLVENNLGKAAFDFFLNITYGPTLLGASQETIKVNPQMEHNHKAMIMCSAQANP-SREQLTVEWIREISKILDQEELLDILKGQQKFISSDPIRCTNTHQWNKGKVNVNCISFGDVEIVTTMQIMPIDYRFIGSYRCIIKNSDKRPPAIKTIKLVYPTRPNPVKNFRKSEFAAQIFGK--SELFCYFIGFPVPTVKWMTFYKNESLDNPVKYFTSVAQTEPGYFKAVLAISDTNESDLGKYICVAGNQYGESSHVVILNKPRSPTQPINFTVINVTETSVSVGWILRFNGGSKQQIKLYWRLRDTVVNGDYQNANIFEDEEKDVQFFTIYNLYRNREYEISIISVNEYSPS 3595
            Q FR  P     V  G   ++ C V    G +QW   G +LG  R++P +PR  M G    G + L IEN ++ D   YECQ   +  S+        L VL  PS P    +        +  +  + +D    +TCV+ +  P             +H F      V I T      S  + +    NG ++ C  +N A  K       +    M V+    P    I  +   E    V  G  L L CV +  G+P   L+W+ N +   I      + +    S++  +M  I+   ++ EL C         P S T  + V + P ++ +               ++   EGQ+V LSC + +     V I W++   E             TVF   +G    +T+   V   F  +D      + L+       K T F+    +  KI ++  P    + L+  ++   L  G    L C  TGG+PTP L  L        +      ++   R E ++ + P DN   +RC  + NN     SA ++L+    A     + MKI +  + L   +   ++C  +SS P A I W        +   G+  ++K                  +Q    +  +++ + LT +     + C           N VL +      ++ V +PP+F +    P ++Q   VE+    +I +   A+P      WL  ++ + K    D S++   I NA       Y++  EN  G +     L++ Y   +  A ++ + VN        A ++C A ANP   +  + +W+        + E +++ +  Q+  SS                               + I  +     G Y+C   N      ++  ++LV   +P   K  +  + A++  G   +EL C   G P     W        L NP +Y     +    +   +  ++ +   D   + C A N  GE    + L     P  P  F  ++ T  SV++ WI  FNGG +Q+ ++ ++   +V    +Q  ++F     D   FT+  L     Y  SI ++N    S
Sbjct:   50 QAFRIEPR-NLTVRMGATAVLKCEVLRASGTVQWVKDGLLLGPQRSLPGFPRYSMIGKR--GQYHLRIENAQLEDDTFYECQAGQSDTSEGIISNAVWLDVLIPPSNPYFTMD------MAAYWVAGESYD----VTCVAPDAKP-----------EAEHFF------VCIFTFGSCVTSERVTALSSDNGRLLACHAKNAALSKPV-----VTTVTMNVYYP--PDAPFIVNLDRDE----VRAGRMLMLECV-SGSGNPLAALRWSKNGE---IVSTTWEADEFARKSRSVLKMV-ITPADNQAELSCESFNAVSLSPLSITRKLDVFFDPEELTLSG-------------SLEAIEGQEVVLSCFAAS-SNPPVDIRWWLGYKE----------LNNTVFIREEGDNGGMTTVSNVTYRFSRED------NGLMLNCEAFNKGTRFS--KIKDAKISVYYPPQ--KVWLDAPAQDVPLNAGTKVTLICHSTGGNPTPTLTWLKNGKAVAHAPKQTSSDMAAAR-ELHLVLTPSDNMATYRCDAT-NNAKKTISAHAKLLVYFTA-----VSMKITAHQEVLRQGEVLTLECLAESSNPTANIFW-----SVGAVRFGVTLSTK------------------HQSGAVTVNSTLLLNLTSQHHKQNVICQ--------AYNPVLEEGANTYYRLNVLHPPEFSSAQ--PTEIQ---VEEDEMATIPLLVSANPEGVSCVWLHRRETLVKG-DPDGSLE---IRNATRRDAGLYTIKCENEEGVSQTAITLDVLYACDVT-AEKDPVFVN----LGGTADLICVADANPIISDMFSWKWL--------EGERVEMGEETQEDESS------------------------------LLTIRNVTRAHSGLYQCTANNGIGLSGSVN-MQLVVQFKPELQKGPQWRKVASRGDGSTTAELVCRAEGIPRIDFSWEKKGVFLDLANP-RYEEKTVREGSFHTSTLRVVNVSAVMDYAVFSCYARNSLGEDKVDIQLVSTNHPDPPSMFRHVSSTHDSVTLEWIPGFNGGLQQKFRIRYQWDQSV---SFQYVDVF---PPDATTFTVTGLQPVTVYNFSINALNAIGES 998          
BLAST of NPHS1-1 vs. Ensembl Medaka
Match: nphs1 (NPHS1 adhesion molecule, nephrin [Source:NCBI gene;Acc:101155460])

HSP 1 Score: 110.153 bits (274), Expect = 1.029e-23
Identity = 250/1142 (21.89%), Postives = 417/1142 (36.51%), Query Frame = 2
Query:  248 QCFRELPSPKYDVLEGKDVLMGCRVAHQQGKLQWAFKGKMLGFDRNIPTYPRMRMTGNAVIGDHSLFIENVKVSDSGNYECQLSPA-ASQPPRRRMTKLTVLKVPSTPIIYQNGQSNKQNISVSIKKDEFDSNINLTCVSLNGNPVPTFEWSVNRSPLKHGFKFRGNKVSI-----ETINDTANSLSMKSSQIMNGDIVTCGVENNATRKMFNLTERIIKTQMRVFKRILPGKIVIKEVSDIEKTVYVTEGHQLQLSCVCNNPGDPPIDLKWNINEDDLMIAQDKILSVKSEHFSQNTFRMSNISRKWHRKELYCSGSQDNYAIPSSATVLILVNYPPSKIEMEAISIKTNVSLHNPSTVYCKEGQKVKLSCTSDNFFTDNVRILWFIKSSEESDWKPITTSFEKTVFT-SDGRLKYITSSLEVPPSFVDKDISSHILSRLLSQVVCIVKSTEFNIEIRRQLKIELFEEPSVPVLTLNNLSKPQILTNGESAKLKCTVTGGHPTPQLRLLDERDREMKS--SNLHEIGITRLEYNIEVKPRDNEKKFRCIVSYNNVMDFESASSELMALQVANPPKQLHMKIISSMDNLIANQNFEMQCHTDSSFPEAKIEWWWHHSCKSSHTLGIRSTSKDVRSLCQSEILNEPQNINYQKSTQSTFTS-INVKLTPEFDLSFIECMIIPHEKWITINKVLSK----LIKIRVRYPPQFLNVHKLPNDVQTFVVEKGNNFSIAIKSIAHPSINGYTWLVNKQPMEKK---IHIDTSVDKFSIVNAQPEMMANYSLLVENNLGKAAFDFFLNITYGPTLLGASQETIKVNPQMEHNHKAMIMCSAQANP-SREQLTVEWIREISKIL------DQEELLDILKGQQKFISSDPIRCTNTHQWNKGKVNVNCISFGDVEIVTTMQIMPIDYRFIGSYRCIIKNSDKRPPAIKTIKLVYPTRPNPVKNFRKSEFAAQIFGK--SELFCYFIGFPVPTVKWMTFYKNESLDNPVKYFTSVAQTEPGYFKAVLAISDTNESDLGKYICVAGNQYGESSHVVILNKPRSPTQPINFTVINVTETSVSVGWILRFNGGSKQQIKLYWRLRDTVVNGDYQNANIFEDEEKDVQFFTIYNLYRNREYEISIISVNEYSPS 3595
            Q FR  P     V  G   ++ C V    G +QW   G +LG  R++P +PR  M G    G + L IEN ++ D   YECQ   +  S+        L VL  PS P    +        +  +  + +D    +TCV+ +  P             K G K  G + S      + + +T   +++ +    NG ++ C  +N A  K       +    M V+    P    I  +   E    V  G  L L CV  + G+P   L+W+ N +   I      + +    S++  +M  I+   ++ EL C         P S T  + V + P ++ +               ++   EGQ+V LSC + +     V I W++   E             TVF   +G    +T+   V   F  +D      + L+       K T F+    +  KI ++  P    + L+  ++   L  G    L C  TGG+PTP L  L        +      ++   R E ++ + P DN   +RC  + NN     SA ++L+    A     + MKI +  + L   +   ++C  +SS P A I W                      S+         Q  +  KS   T  S + + LT +     + C           N VL +      ++ V +PP+F +    P ++Q   VE+    +I +   A+P      WL  ++ + K     H         I NA       Y++  EN  G +     L++ Y   +  A ++ + VN        A ++C A ANP   +  + +W+ E    +      D+  LL I               T  H                                 G Y+C   N      ++  ++LV   +P   K  +  + A++  G   +EL C   G P     W        L NP +Y     +    +   +  ++ +   D   + C A N  GE    + L     P  P  F  ++ T  SV++ WI  FNGG +Q+ ++ ++   +V    +Q  ++F     D   FT+  L     Y  SI ++N    S
Sbjct:   27 QAFRIEPR-NLTVRMGATAVLKCEVLRASGTVQWVKDGLLLGPQRSLPGFPRYSMIGKR--GQYHLRIENAQLEDDTFYECQAGQSDTSEGIISNAVWLDVLIPPSNPYFTMD------MAAYWVAGESYD----VTCVAPDAKP------EAEVILYKDGVKLTGVESSSVSGSKDKLLNTLAEVTVTALSSDNGRLLACHAKNAALSKPV-----VTTVTMNVYYP--PDAPFIVNLDRDE----VRAGRMLMLECVSGS-GNPLAALRWSKNGE---IVSTTWEADEFARKSRSVLKMV-ITPADNQAELSCESFNAVSLSPLSITRKLDVFFDPEELTLSG-------------SLEAIEGQEVVLSCFAAS-SNPPVDIRWWLGYKE----------LNNTVFIREEGDNGGMTTVSNVTYRFSRED------NGLMLNCEAFNKGTRFS--KIKDAKISVYYPPQ--KVWLDAPAQDVPLNAGTKVTLICHSTGGNPTPTLTWLKNGKAVAHAPKQTSSDMAAAR-ELHLVLTPSDNMATYRCDAT-NNAKKTISAHAKLLVYFTA-----VSMKITAHQEVLRQGEVLTLECLAESSNPTANIFW----------------------SVGAVRFQKAEQTHSKDKSGAVTVNSTLLLNLTSQHHKQNVICQ--------AYNPVLEEGANTYYRLNVLHPPEFSSAQ--PTEIQ---VEEDEMATIPLLVSANPEGVSCVWLHRRETLVKGNNLHHYWLEDGSLEIRNATRRDAGLYTIKCENEEGVSQTAITLDVLYACDVT-AEKDPVFVN----LGGTADLICVADANPIISDMFSWKWLGEEEVEMGEETQEDESSLLTIRN------------VTRAHS--------------------------------GLYQCTANNGIGLSGSVN-MQLVVQFKPELQKGPQWRKVASRGDGSTTAELVCRAEGIPRIDFSWEKKGVFLDLANP-RYEEKTVREGSFHTSTLRVVNVSAVMDYAVFSCYARNSLGEDKVDIQLVSTNHPDPPSMFRHVSSTHDSVTLEWIPGFNGGLQQKFRIRYQWDQSV---SFQYVDVF---PPDATTFTVTGLQPVTVYNFSINALNAIGES 1000          
BLAST of NPHS1-1 vs. Ensembl Medaka
Match: KIRREL3 (kirre like nephrin family adhesion molecule 3 [Source:NCBI gene;Acc:101170290])

HSP 1 Score: 78.1814 bits (191), Expect = 5.169e-14
Identity = 58/195 (29.74%), Postives = 86/195 (44.10%), Query Frame = 2
Query:  284 VLEGKDVLMGCRVAHQQGKLQWAFKGKMLGFDRNIPTYPRMRMTGNAVIGDHSLFIENVKVSDSGNYECQLSPAASQPPRRRMTKLTVLKVPSTPIIYQNGQSNKQNISVSIKKDEFDSNINLTCVSLNGNPVPTFEWSVNRSPLKHGFKFRGNKVSIETI------NDTANSLSMKSSQIMNGDIVTCGVENNA 850
            V+ G+ V + C +    G + W   G  LG  R++  YPR  + G+   G+H L I+ V++ D   +ECQ   AA    R R  +LTVL  P  P+I            VS++  +    +NLTC + N  P  +  W  N   L        +KVSIE +        T ++L +  S I  G  + C   N A
Sbjct:   29 VVAGQPVTLPCSIPGYHGIVLWIKDGLALGVGRDLSGYPRYTVIGDHGSGEHHLRIQRVELMDDAVFECQAVQAAM---RSRPARLTVLVPPDDPVI-------GGGPVVSLRAGD---PLNLTCHADNAKPAASIIWMRNGEVLNGAMY---SKVSIEALVRDGRRESTVSTLYLSPSNIETGQQIICRASNKA 207          
BLAST of NPHS1-1 vs. Ensembl Medaka
Match: KIRREL3 (kirre like nephrin family adhesion molecule 3 [Source:NCBI gene;Acc:101170290])

HSP 1 Score: 75.485 bits (184), Expect = 3.571e-13
Identity = 55/194 (28.35%), Postives = 85/194 (43.81%), Query Frame = 2
Query:  284 VLEGKDVLMGCRVAHQQGKLQWAFKGKMLGFDRNIPTYPRMRMTGNAVIGDHSLFIENVKVSDSGNYECQLSPAASQPPRRRMTKLTVLKVPSTPIIYQNGQSNKQNISVSIKKDEFDSNINLTCVSLNGNPVPTFEWSVNRSPLKHGFKFRGNKVSIETIND-----TANSLSMKSSQIMNGDIVTCGVENNA 850
            V+ G+ V + C +    G + W   G  LG  R++  YPR  + G+   G+H L I+ V++ D   +ECQ   AA    R R  +LTVL  P  P+I            VS++  +    +NLTC + N  P  +  W      +++G    G   S   + D     T ++L +  S I  G  + C   N A
Sbjct:   57 VVAGQPVTLPCSIPGYHGIVLWIKDGLALGVGRDLSGYPRYTVIGDHGSGEHHLRIQRVELMDDAVFECQAVQAAM---RSRPARLTVLVPPDDPVI-------GGGPVVSLRAGD---PLNLTCHADNAKPAASIIW------MRNGEVLNGAMYSKALVRDGRRESTVSTLYLSPSNIETGQQIICRASNKA 231          
BLAST of NPHS1-1 vs. Ensembl Medaka
Match: KIRREL3 (kirre like nephrin family adhesion molecule 3 [Source:NCBI gene;Acc:101170290])

HSP 1 Score: 75.485 bits (184), Expect = 3.845e-13
Identity = 55/194 (28.35%), Postives = 85/194 (43.81%), Query Frame = 2
Query:  284 VLEGKDVLMGCRVAHQQGKLQWAFKGKMLGFDRNIPTYPRMRMTGNAVIGDHSLFIENVKVSDSGNYECQLSPAASQPPRRRMTKLTVLKVPSTPIIYQNGQSNKQNISVSIKKDEFDSNINLTCVSLNGNPVPTFEWSVNRSPLKHGFKFRGNKVSIETIND-----TANSLSMKSSQIMNGDIVTCGVENNA 850
            V+ G+ V + C +    G + W   G  LG  R++  YPR  + G+   G+H L I+ V++ D   +ECQ   AA    R R  +LTVL  P  P+I            VS++  +    +NLTC + N  P  +  W      +++G    G   S   + D     T ++L +  S I  G  + C   N A
Sbjct:   99 VVAGQPVTLPCSIPGYHGIVLWIKDGLALGVGRDLSGYPRYTVIGDHGSGEHHLRIQRVELMDDAVFECQAVQAAM---RSRPARLTVLVPPDDPVI-------GGGPVVSLRAGD---PLNLTCHADNAKPAASIIW------MRNGEVLNGAMYSKALVRDGRRESTVSTLYLSPSNIETGQQIICRASNKA 273          
BLAST of NPHS1-1 vs. Planmine SMEST
Match: SMESG000003359.1 (SMESG000003359.1)

HSP 1 Score: 3348.53 bits (8681), Expect = 0.000e+0
Identity = 1614/1616 (99.88%), Postives = 1615/1616 (99.94%), Query Frame = 2
Query:   92 MICVFVLSNTFINRIEFVLCQDPFNVDDLDAAESISLSQSSTCTEKDDIHRIQCFRELPSPKYDVLEGKDVLMGCRVAHQQGKLQWAFKGKMLGFDRNIPTYPRMRMTGNAVIGDHSLFIENVKVSDSGNYECQLSPAASQPPRRRMTKLTVLKVPSTPIIYQNGQSNKQNISVSIKKDEFDSNINLTCVSLNGNPVPTFEWSVNRSPLKHGFKFRGNKVSIETINDTANSLSMKSSQIMNGDIVTCGVENNATRKMFNLTERIIKTQMRVFKRILPGKIVIKEVSDIEKTVYVTEGHQLQLSCVCNNPGDPPIDLKWNINEDDLMIAQDKILSVKSEHFSQNTFRMSNISRKWHRKELYCSGSQDNYAIPSSATVLILVNYPPSKIEMEAISIKTNVSLHNPSTVYCKEGQKVKLSCTSDNFFTDNVRILWFIKSSEESDWKPITTSFEKTVFTSDGRLKYITSSLEVPPSFVDKDISSHILSRLLSQVVCIVKSTEFNIEIRRQLKIELFEEPSVPVLTLNNLSKPQILTNGESAKLKCTVTGGHPTPQLRLLDERDREMKSSNLHEIGITRLEYNIEVKPRDNEKKFRCIVSYNNVMDFESASSELMALQVANPPKQLHMKIISSMDNLIANQNFEMQCHTDSSFPEAKIEWWWHHSCKSSHTLGIRSTSKDVRSLCQSEILNEPQNINYQKSTQSTFTSINVKLTPEFDLSFIECMIIPHEKWITINKVLSKLIKIRVRYPPQFLNVHKLPNDVQTFVVEKGNNFSIAIKSIAHPSINGYTWLVNKQPMEKKIHIDTSVDKFSIVNAQPEMMANYSLLVENNLGKAAFDFFLNITYGPTLLGASQETIKVNPQMEHNHKAMIMCSAQANPSREQLTVEWIREISKILDQEELLDILKGQQKFISSDPIRCTNTHQWNKGKVNVNCISFGDVEIVTTMQIMPIDYRFIGSYRCIIKNSDKRPPAIKTIKLVYPTRPNPVKNFRKSEFAAQIFGKSELFCYFIGFPVPTVKWMTFYKNESLDNPVKYFTSVAQTEPGYFKAVLAISDTNESDLGKYICVAGNQYGESSHVVILNKPRSPTQPINFTVINVTETSVSVGWILRFNGGSKQQIKLYWRLRDTVVNGDYQNANIFEDEEKDVQFFTIYNLYRNREYEISIISVNEYSPSAGIPKPIIIKTMNYVDPDPDSIHIQNDSKRGFNKQLEKRIEPVESNNFLIIILLATVGVLLLTIKIGLIVYFVRKRKLKHRKSREKLSSPPTHQRMDTVGFISNDDSIEMRPPSLVRSGIESNLYAQSISDHMSQNGSDTGLKLNYYKTHSDDQFSSPFLGPELDLVASVRGRNNYDINALSPNFHPGYIQFAESSSMTSAQDPYIKGYYTQRPYYNSQTPSHGVIRKSSHSSNDTVTLPQYPISSSYQKRMDKVCFPQSAVSISTNSGDSNCSQSPPRKYIGYSPMVNQSGAPSTVEEYLSSGNSASESHRFGINGSDEYFTSPMSSFRLNQGLDSMSNKDFYSQLCSTNQQNQESAQEFAIQRIMYGNDVSAITPYRAYNDHQRLSTSSDNEHLLKPPLDFSGIESNNSNNIQSPMADAHKLSYVDLIAHSSPSVIRFTGPISENL 4939
            MICVFVLSNTFINRIEFVLCQDPFNVDDLDAAESISLSQSSTCTEKDDIHRIQCFRELPSPKYDVLEGKDVLMGCRVAHQQGKLQWAFKGKMLGFDRNIPTYPRMRMTGNAVIGDHSLFIENVKVSDSGNYECQLSPAASQPPRRRMTKLTVLKVPSTPIIYQNGQSNKQNISVSIKKDEFDSNINLTCVSLNGNPVPTFEWSVNRSPLKHGFKFRGNKVSIETINDTANSLSMKSSQIMNGDIVTCGVENNATRKMFNLTERIIKTQMRVFKRILPGKIVIKEVSDIEKTVYVTEGHQLQLSCVCNNPGDPPIDLKWNINEDDLMIAQDKILSVKSEHFSQNTFRMSNISRKWHRKELYCSGSQDNYAIPSSATVLILVNYPPSKIEMEAIS+KTNVSLHNPSTVYCKEGQKVKLSCTSDNFFTDNVRILWFIKSSEESDWKPITTSFEKTVFTSDGRLKYITSSLEVPPSFVDKDISSHILSRLLSQVVCIVKSTEFNIEIRRQLKIELFEEPSVPVLTLNNLSKPQILTNGESAKLKCTVTGGHPTPQLRLLDERDREMKSSNLHEIGITRLEYNIEVKPRDNEKKFRCIVSYNNVMDFESASSELMALQVANPPKQLHMKIISSMDNLIANQNFEMQCHTDSSFPEAKIEWWWHHSCKSSHTLGIRSTSKDVRSLCQSEILNEPQNINYQKSTQSTFTSINVKLTPEFDLSFIECMIIPHEKWITINKVLSKLIKIRVRYPPQFLNVHKLPNDVQTFVVEKGNNFSIAIKSIAHPSINGYTWLVNKQPMEKKIHIDTSVDKFSIVNAQPEMMANYSLLVENNLGKAAFDFFLNITYGPTLLGASQETIKVNPQMEHNHKAMIMCSAQANPSREQLTVEWIREISKILDQEELLDILKGQQKFISSDPIRCTNTHQWNKGKVNVNCISFGDVEIVTTMQIMPIDYRFIGSYRCIIKNSDKRPPAIKTIKLVYPTRPNPVKNFRKSEFAAQIFGKSELFCYFIGFPVPTVKWMTFYKNESLDNPVKYFTSVAQTEPGYFKAVLAISDTNESDLGKYICVAGNQYGESSHVVILNKPRSPTQPINFTVINVTETSVSVGWILRFNGGSKQQIKLYWRLRDTVVNGDYQNANIFEDEEKDVQFFTIYNLYRNREYEISIISVNEYSPSAGIPKPIIIKTMNYVDPDPDSIHIQNDSKRGFNKQLEKRIEPVESNNFLIIILLATVGVLLLTIKIGLIVYFVRKRKLKHRKSREKLSSPPTHQRMDTVGFISNDDSIEMRPPSLVRSGIESNLYAQSISDHMSQNGSDTGLKLNYYKTHSDDQFSSPFLGPELDLVASVRGRNNYDINALSPNFHPGYIQFAESSSMTSAQDPYIKGYYTQRPYYNSQTPSHGVIRKSSHSSNDTVTLPQYPISS YQKRMDKVCFPQSAVSISTNSGDSNCSQSPPRKYIGYSPMVNQSGAPSTVEEYLSSGNSASESHRFGINGSDEYFTSPMSSFRLNQGLDSMSNKDFYSQLCSTNQQNQESAQEFAIQRIMYGNDVSAITPYRAYNDHQRLSTSSDNEHLLKPPLDFSGIESNNSNNIQSPMADAHKLSYVDLIAHSSPSVIRFTGPISENL
Sbjct:    1 MICVFVLSNTFINRIEFVLCQDPFNVDDLDAAESISLSQSSTCTEKDDIHRIQCFRELPSPKYDVLEGKDVLMGCRVAHQQGKLQWAFKGKMLGFDRNIPTYPRMRMTGNAVIGDHSLFIENVKVSDSGNYECQLSPAASQPPRRRMTKLTVLKVPSTPIIYQNGQSNKQNISVSIKKDEFDSNINLTCVSLNGNPVPTFEWSVNRSPLKHGFKFRGNKVSIETINDTANSLSMKSSQIMNGDIVTCGVENNATRKMFNLTERIIKTQMRVFKRILPGKIVIKEVSDIEKTVYVTEGHQLQLSCVCNNPGDPPIDLKWNINEDDLMIAQDKILSVKSEHFSQNTFRMSNISRKWHRKELYCSGSQDNYAIPSSATVLILVNYPPSKIEMEAISVKTNVSLHNPSTVYCKEGQKVKLSCTSDNFFTDNVRILWFIKSSEESDWKPITTSFEKTVFTSDGRLKYITSSLEVPPSFVDKDISSHILSRLLSQVVCIVKSTEFNIEIRRQLKIELFEEPSVPVLTLNNLSKPQILTNGESAKLKCTVTGGHPTPQLRLLDERDREMKSSNLHEIGITRLEYNIEVKPRDNEKKFRCIVSYNNVMDFESASSELMALQVANPPKQLHMKIISSMDNLIANQNFEMQCHTDSSFPEAKIEWWWHHSCKSSHTLGIRSTSKDVRSLCQSEILNEPQNINYQKSTQSTFTSINVKLTPEFDLSFIECMIIPHEKWITINKVLSKLIKIRVRYPPQFLNVHKLPNDVQTFVVEKGNNFSIAIKSIAHPSINGYTWLVNKQPMEKKIHIDTSVDKFSIVNAQPEMMANYSLLVENNLGKAAFDFFLNITYGPTLLGASQETIKVNPQMEHNHKAMIMCSAQANPSREQLTVEWIREISKILDQEELLDILKGQQKFISSDPIRCTNTHQWNKGKVNVNCISFGDVEIVTTMQIMPIDYRFIGSYRCIIKNSDKRPPAIKTIKLVYPTRPNPVKNFRKSEFAAQIFGKSELFCYFIGFPVPTVKWMTFYKNESLDNPVKYFTSVAQTEPGYFKAVLAISDTNESDLGKYICVAGNQYGESSHVVILNKPRSPTQPINFTVINVTETSVSVGWILRFNGGSKQQIKLYWRLRDTVVNGDYQNANIFEDEEKDVQFFTIYNLYRNREYEISIISVNEYSPSAGIPKPIIIKTMNYVDPDPDSIHIQNDSKRGFNKQLEKRIEPVESNNFLIIILLATVGVLLLTIKIGLIVYFVRKRKLKHRKSREKLSSPPTHQRMDTVGFISNDDSIEMRPPSLVRSGIESNLYAQSISDHMSQNGSDTGLKLNYYKTHSDDQFSSPFLGPELDLVASVRGRNNYDINALSPNFHPGYIQFAESSSMTSAQDPYIKGYYTQRPYYNSQTPSHGVIRKSSHSSNDTVTLPQYPISSGYQKRMDKVCFPQSAVSISTNSGDSNCSQSPPRKYIGYSPMVNQSGAPSTVEEYLSSGNSASESHRFGINGSDEYFTSPMSSFRLNQGLDSMSNKDFYSQLCSTNQQNQESAQEFAIQRIMYGNDVSAITPYRAYNDHQRLSTSSDNEHLLKPPLDFSGIESNNSNNIQSPMADAHKLSYVDLIAHSSPSVIRFTGPISENL 1616          
BLAST of NPHS1-1 vs. Planmine SMEST
Match: SMESG000003359.1 (SMESG000003359.1)

HSP 1 Score: 3172.87 bits (8225), Expect = 0.000e+0
Identity = 1529/1531 (99.87%), Postives = 1530/1531 (99.93%), Query Frame = 2
Query:   77 MLNFWMICVFVLSNTFINRIEFVLCQDPFNVDDLDAAESISLSQSSTCTEKDDIHRIQCFRELPSPKYDVLEGKDVLMGCRVAHQQGKLQWAFKGKMLGFDRNIPTYPRMRMTGNAVIGDHSLFIENVKVSDSGNYECQLSPAASQPPRRRMTKLTVLKVPSTPIIYQNGQSNKQNISVSIKKDEFDSNINLTCVSLNGNPVPTFEWSVNRSPLKHGFKFRGNKVSIETINDTANSLSMKSSQIMNGDIVTCGVENNATRKMFNLTERIIKTQMRVFKRILPGKIVIKEVSDIEKTVYVTEGHQLQLSCVCNNPGDPPIDLKWNINEDDLMIAQDKILSVKSEHFSQNTFRMSNISRKWHRKELYCSGSQDNYAIPSSATVLILVNYPPSKIEMEAISIKTNVSLHNPSTVYCKEGQKVKLSCTSDNFFTDNVRILWFIKSSEESDWKPITTSFEKTVFTSDGRLKYITSSLEVPPSFVDKDISSHILSRLLSQVVCIVKSTEFNIEIRRQLKIELFEEPSVPVLTLNNLSKPQILTNGESAKLKCTVTGGHPTPQLRLLDERDREMKSSNLHEIGITRLEYNIEVKPRDNEKKFRCIVSYNNVMDFESASSELMALQVANPPKQLHMKIISSMDNLIANQNFEMQCHTDSSFPEAKIEWWWHHSCKSSHTLGIRSTSKDVRSLCQSEILNEPQNINYQKSTQSTFTSINVKLTPEFDLSFIECMIIPHEKWITINKVLSKLIKIRVRYPPQFLNVHKLPNDVQTFVVEKGNNFSIAIKSIAHPSINGYTWLVNKQPMEKKIHIDTSVDKFSIVNAQPEMMANYSLLVENNLGKAAFDFFLNITYGPTLLGASQETIKVNPQMEHNHKAMIMCSAQANPSREQLTVEWIREISKILDQEELLDILKGQQKFISSDPIRCTNTHQWNKGKVNVNCISFGDVEIVTTMQIMPIDYRFIGSYRCIIKNSDKRPPAIKTIKLVYPTRPNPVKNFRKSEFAAQIFGKSELFCYFIGFPVPTVKWMTFYKNESLDNPVKYFTSVAQTEPGYFKAVLAISDTNESDLGKYICVAGNQYGESSHVVILNKPRSPTQPINFTVINVTETSVSVGWILRFNGGSKQQIKLYWRLRDTVVNGDYQNANIFEDEEKDVQFFTIYNLYRNREYEISIISVNEYSPSAGIPKPIIIKTMNYVDPDPDSIHIQNDSKRGFNKQLEKRIEPVESNNFLIIILLATVGVLLLTIKIGLIVYFVRKRKLKHRKSREKLSSPPTHQRMDTVGFISNDDSIEMRPPSLVRSGIESNLYAQSISDHMSQNGSDTGLKLNYYKTHSDDQFSSPFLGPELDLVASVRGRNNYDINALSPNFHPGYIQFAESSSMTSAQDPYIKGYYTQRPYYNSQTPSHGVIRKSSHSSNDTVTLPQYPISSSYQKRMDKVCFPQSAVSISTNSGDSNCSQSPPRKYIGYSPMVNQSGAPSTVEEYLSSGNSASESHRFGINGSDEYFTSPMSSFRLNQGLDSMSNKDFYSQLCSTNQQNQESA 4669
            MLNFWMICVFVLSNTFINRIEFVLCQDPFNVDDLDAAESISLSQSSTCTEKDDIHRIQCFRELPSPKYDVLEGKDVLMGCRVAHQQGKLQWAFKGKMLGFDRNIPTYPRMRMTGNAVIGDHSLFIENVKVSDSGNYECQLSPAASQPPRRRMTKLTVLKVPSTPIIYQNGQSNKQNISVSIKKDEFDSNINLTCVSLNGNPVPTFEWSVNRSPLKHGFKFRGNKVSIETINDTANSLSMKSSQIMNGDIVTCGVENNATRKMFNLTERIIKTQMRVFKRILPGKIVIKEVSDIEKTVYVTEGHQLQLSCVCNNPGDPPIDLKWNINEDDLMIAQDKILSVKSEHFSQNTFRMSNISRKWHRKELYCSGSQDNYAIPSSATVLILVNYPPSKIEMEAIS+KTNVSLHNPSTVYCKEGQKVKLSCTSDNFFTDNVRILWFIKSSEESDWKPITTSFEKTVFTSDGRLKYITSSLEVPPSFVDKDISSHILSRLLSQVVCIVKSTEFNIEIRRQLKIELFEEPSVPVLTLNNLSKPQILTNGESAKLKCTVTGGHPTPQLRLLDERDREMKSSNLHEIGITRLEYNIEVKPRDNEKKFRCIVSYNNVMDFESASSELMALQVANPPKQLHMKIISSMDNLIANQNFEMQCHTDSSFPEAKIEWWWHHSCKSSHTLGIRSTSKDVRSLCQSEILNEPQNINYQKSTQSTFTSINVKLTPEFDLSFIECMIIPHEKWITINKVLSKLIKIRVRYPPQFLNVHKLPNDVQTFVVEKGNNFSIAIKSIAHPSINGYTWLVNKQPMEKKIHIDTSVDKFSIVNAQPEMMANYSLLVENNLGKAAFDFFLNITYGPTLLGASQETIKVNPQMEHNHKAMIMCSAQANPSREQLTVEWIREISKILDQEELLDILKGQQKFISSDPIRCTNTHQWNKGKVNVNCISFGDVEIVTTMQIMPIDYRFIGSYRCIIKNSDKRPPAIKTIKLVYPTRPNPVKNFRKSEFAAQIFGKSELFCYFIGFPVPTVKWMTFYKNESLDNPVKYFTSVAQTEPGYFKAVLAISDTNESDLGKYICVAGNQYGESSHVVILNKPRSPTQPINFTVINVTETSVSVGWILRFNGGSKQQIKLYWRLRDTVVNGDYQNANIFEDEEKDVQFFTIYNLYRNREYEISIISVNEYSPSAGIPKPIIIKTMNYVDPDPDSIHIQNDSKRGFNKQLEKRIEPVESNNFLIIILLATVGVLLLTIKIGLIVYFVRKRKLKHRKSREKLSSPPTHQRMDTVGFISNDDSIEMRPPSLVRSGIESNLYAQSISDHMSQNGSDTGLKLNYYKTHSDDQFSSPFLGPELDLVASVRGRNNYDINALSPNFHPGYIQFAESSSMTSAQDPYIKGYYTQRPYYNSQTPSHGVIRKSSHSSNDTVTLPQYPISS YQKRMDKVCFPQSAVSISTNSGDSNCSQSPPRKYIGYSPMVNQSGAPSTVEEYLSSGNSASESHRFGINGSDEYFTSPMSSFRLNQGLDSMSNKDFYSQLCSTNQQNQESA
Sbjct:    1 MLNFWMICVFVLSNTFINRIEFVLCQDPFNVDDLDAAESISLSQSSTCTEKDDIHRIQCFRELPSPKYDVLEGKDVLMGCRVAHQQGKLQWAFKGKMLGFDRNIPTYPRMRMTGNAVIGDHSLFIENVKVSDSGNYECQLSPAASQPPRRRMTKLTVLKVPSTPIIYQNGQSNKQNISVSIKKDEFDSNINLTCVSLNGNPVPTFEWSVNRSPLKHGFKFRGNKVSIETINDTANSLSMKSSQIMNGDIVTCGVENNATRKMFNLTERIIKTQMRVFKRILPGKIVIKEVSDIEKTVYVTEGHQLQLSCVCNNPGDPPIDLKWNINEDDLMIAQDKILSVKSEHFSQNTFRMSNISRKWHRKELYCSGSQDNYAIPSSATVLILVNYPPSKIEMEAISVKTNVSLHNPSTVYCKEGQKVKLSCTSDNFFTDNVRILWFIKSSEESDWKPITTSFEKTVFTSDGRLKYITSSLEVPPSFVDKDISSHILSRLLSQVVCIVKSTEFNIEIRRQLKIELFEEPSVPVLTLNNLSKPQILTNGESAKLKCTVTGGHPTPQLRLLDERDREMKSSNLHEIGITRLEYNIEVKPRDNEKKFRCIVSYNNVMDFESASSELMALQVANPPKQLHMKIISSMDNLIANQNFEMQCHTDSSFPEAKIEWWWHHSCKSSHTLGIRSTSKDVRSLCQSEILNEPQNINYQKSTQSTFTSINVKLTPEFDLSFIECMIIPHEKWITINKVLSKLIKIRVRYPPQFLNVHKLPNDVQTFVVEKGNNFSIAIKSIAHPSINGYTWLVNKQPMEKKIHIDTSVDKFSIVNAQPEMMANYSLLVENNLGKAAFDFFLNITYGPTLLGASQETIKVNPQMEHNHKAMIMCSAQANPSREQLTVEWIREISKILDQEELLDILKGQQKFISSDPIRCTNTHQWNKGKVNVNCISFGDVEIVTTMQIMPIDYRFIGSYRCIIKNSDKRPPAIKTIKLVYPTRPNPVKNFRKSEFAAQIFGKSELFCYFIGFPVPTVKWMTFYKNESLDNPVKYFTSVAQTEPGYFKAVLAISDTNESDLGKYICVAGNQYGESSHVVILNKPRSPTQPINFTVINVTETSVSVGWILRFNGGSKQQIKLYWRLRDTVVNGDYQNANIFEDEEKDVQFFTIYNLYRNREYEISIISVNEYSPSAGIPKPIIIKTMNYVDPDPDSIHIQNDSKRGFNKQLEKRIEPVESNNFLIIILLATVGVLLLTIKIGLIVYFVRKRKLKHRKSREKLSSPPTHQRMDTVGFISNDDSIEMRPPSLVRSGIESNLYAQSISDHMSQNGSDTGLKLNYYKTHSDDQFSSPFLGPELDLVASVRGRNNYDINALSPNFHPGYIQFAESSSMTSAQDPYIKGYYTQRPYYNSQTPSHGVIRKSSHSSNDTVTLPQYPISSGYQKRMDKVCFPQSAVSISTNSGDSNCSQSPPRKYIGYSPMVNQSGAPSTVEEYLSSGNSASESHRFGINGSDEYFTSPMSSFRLNQGLDSMSNKDFYSQLCSTNQQNQESA 1531          
BLAST of NPHS1-1 vs. Planmine SMEST
Match: SMESG000003359.1 (SMESG000003359.1)

HSP 1 Score: 3162.47 bits (8198), Expect = 0.000e+0
Identity = 1524/1526 (99.87%), Postives = 1525/1526 (99.93%), Query Frame = 2
Query:   92 MICVFVLSNTFINRIEFVLCQDPFNVDDLDAAESISLSQSSTCTEKDDIHRIQCFRELPSPKYDVLEGKDVLMGCRVAHQQGKLQWAFKGKMLGFDRNIPTYPRMRMTGNAVIGDHSLFIENVKVSDSGNYECQLSPAASQPPRRRMTKLTVLKVPSTPIIYQNGQSNKQNISVSIKKDEFDSNINLTCVSLNGNPVPTFEWSVNRSPLKHGFKFRGNKVSIETINDTANSLSMKSSQIMNGDIVTCGVENNATRKMFNLTERIIKTQMRVFKRILPGKIVIKEVSDIEKTVYVTEGHQLQLSCVCNNPGDPPIDLKWNINEDDLMIAQDKILSVKSEHFSQNTFRMSNISRKWHRKELYCSGSQDNYAIPSSATVLILVNYPPSKIEMEAISIKTNVSLHNPSTVYCKEGQKVKLSCTSDNFFTDNVRILWFIKSSEESDWKPITTSFEKTVFTSDGRLKYITSSLEVPPSFVDKDISSHILSRLLSQVVCIVKSTEFNIEIRRQLKIELFEEPSVPVLTLNNLSKPQILTNGESAKLKCTVTGGHPTPQLRLLDERDREMKSSNLHEIGITRLEYNIEVKPRDNEKKFRCIVSYNNVMDFESASSELMALQVANPPKQLHMKIISSMDNLIANQNFEMQCHTDSSFPEAKIEWWWHHSCKSSHTLGIRSTSKDVRSLCQSEILNEPQNINYQKSTQSTFTSINVKLTPEFDLSFIECMIIPHEKWITINKVLSKLIKIRVRYPPQFLNVHKLPNDVQTFVVEKGNNFSIAIKSIAHPSINGYTWLVNKQPMEKKIHIDTSVDKFSIVNAQPEMMANYSLLVENNLGKAAFDFFLNITYGPTLLGASQETIKVNPQMEHNHKAMIMCSAQANPSREQLTVEWIREISKILDQEELLDILKGQQKFISSDPIRCTNTHQWNKGKVNVNCISFGDVEIVTTMQIMPIDYRFIGSYRCIIKNSDKRPPAIKTIKLVYPTRPNPVKNFRKSEFAAQIFGKSELFCYFIGFPVPTVKWMTFYKNESLDNPVKYFTSVAQTEPGYFKAVLAISDTNESDLGKYICVAGNQYGESSHVVILNKPRSPTQPINFTVINVTETSVSVGWILRFNGGSKQQIKLYWRLRDTVVNGDYQNANIFEDEEKDVQFFTIYNLYRNREYEISIISVNEYSPSAGIPKPIIIKTMNYVDPDPDSIHIQNDSKRGFNKQLEKRIEPVESNNFLIIILLATVGVLLLTIKIGLIVYFVRKRKLKHRKSREKLSSPPTHQRMDTVGFISNDDSIEMRPPSLVRSGIESNLYAQSISDHMSQNGSDTGLKLNYYKTHSDDQFSSPFLGPELDLVASVRGRNNYDINALSPNFHPGYIQFAESSSMTSAQDPYIKGYYTQRPYYNSQTPSHGVIRKSSHSSNDTVTLPQYPISSSYQKRMDKVCFPQSAVSISTNSGDSNCSQSPPRKYIGYSPMVNQSGAPSTVEEYLSSGNSASESHRFGINGSDEYFTSPMSSFRLNQGLDSMSNKDFYSQLCSTNQQNQESA 4669
            MICVFVLSNTFINRIEFVLCQDPFNVDDLDAAESISLSQSSTCTEKDDIHRIQCFRELPSPKYDVLEGKDVLMGCRVAHQQGKLQWAFKGKMLGFDRNIPTYPRMRMTGNAVIGDHSLFIENVKVSDSGNYECQLSPAASQPPRRRMTKLTVLKVPSTPIIYQNGQSNKQNISVSIKKDEFDSNINLTCVSLNGNPVPTFEWSVNRSPLKHGFKFRGNKVSIETINDTANSLSMKSSQIMNGDIVTCGVENNATRKMFNLTERIIKTQMRVFKRILPGKIVIKEVSDIEKTVYVTEGHQLQLSCVCNNPGDPPIDLKWNINEDDLMIAQDKILSVKSEHFSQNTFRMSNISRKWHRKELYCSGSQDNYAIPSSATVLILVNYPPSKIEMEAIS+KTNVSLHNPSTVYCKEGQKVKLSCTSDNFFTDNVRILWFIKSSEESDWKPITTSFEKTVFTSDGRLKYITSSLEVPPSFVDKDISSHILSRLLSQVVCIVKSTEFNIEIRRQLKIELFEEPSVPVLTLNNLSKPQILTNGESAKLKCTVTGGHPTPQLRLLDERDREMKSSNLHEIGITRLEYNIEVKPRDNEKKFRCIVSYNNVMDFESASSELMALQVANPPKQLHMKIISSMDNLIANQNFEMQCHTDSSFPEAKIEWWWHHSCKSSHTLGIRSTSKDVRSLCQSEILNEPQNINYQKSTQSTFTSINVKLTPEFDLSFIECMIIPHEKWITINKVLSKLIKIRVRYPPQFLNVHKLPNDVQTFVVEKGNNFSIAIKSIAHPSINGYTWLVNKQPMEKKIHIDTSVDKFSIVNAQPEMMANYSLLVENNLGKAAFDFFLNITYGPTLLGASQETIKVNPQMEHNHKAMIMCSAQANPSREQLTVEWIREISKILDQEELLDILKGQQKFISSDPIRCTNTHQWNKGKVNVNCISFGDVEIVTTMQIMPIDYRFIGSYRCIIKNSDKRPPAIKTIKLVYPTRPNPVKNFRKSEFAAQIFGKSELFCYFIGFPVPTVKWMTFYKNESLDNPVKYFTSVAQTEPGYFKAVLAISDTNESDLGKYICVAGNQYGESSHVVILNKPRSPTQPINFTVINVTETSVSVGWILRFNGGSKQQIKLYWRLRDTVVNGDYQNANIFEDEEKDVQFFTIYNLYRNREYEISIISVNEYSPSAGIPKPIIIKTMNYVDPDPDSIHIQNDSKRGFNKQLEKRIEPVESNNFLIIILLATVGVLLLTIKIGLIVYFVRKRKLKHRKSREKLSSPPTHQRMDTVGFISNDDSIEMRPPSLVRSGIESNLYAQSISDHMSQNGSDTGLKLNYYKTHSDDQFSSPFLGPELDLVASVRGRNNYDINALSPNFHPGYIQFAESSSMTSAQDPYIKGYYTQRPYYNSQTPSHGVIRKSSHSSNDTVTLPQYPISS YQKRMDKVCFPQSAVSISTNSGDSNCSQSPPRKYIGYSPMVNQSGAPSTVEEYLSSGNSASESHRFGINGSDEYFTSPMSSFRLNQGLDSMSNKDFYSQLCSTNQQNQESA
Sbjct:    1 MICVFVLSNTFINRIEFVLCQDPFNVDDLDAAESISLSQSSTCTEKDDIHRIQCFRELPSPKYDVLEGKDVLMGCRVAHQQGKLQWAFKGKMLGFDRNIPTYPRMRMTGNAVIGDHSLFIENVKVSDSGNYECQLSPAASQPPRRRMTKLTVLKVPSTPIIYQNGQSNKQNISVSIKKDEFDSNINLTCVSLNGNPVPTFEWSVNRSPLKHGFKFRGNKVSIETINDTANSLSMKSSQIMNGDIVTCGVENNATRKMFNLTERIIKTQMRVFKRILPGKIVIKEVSDIEKTVYVTEGHQLQLSCVCNNPGDPPIDLKWNINEDDLMIAQDKILSVKSEHFSQNTFRMSNISRKWHRKELYCSGSQDNYAIPSSATVLILVNYPPSKIEMEAISVKTNVSLHNPSTVYCKEGQKVKLSCTSDNFFTDNVRILWFIKSSEESDWKPITTSFEKTVFTSDGRLKYITSSLEVPPSFVDKDISSHILSRLLSQVVCIVKSTEFNIEIRRQLKIELFEEPSVPVLTLNNLSKPQILTNGESAKLKCTVTGGHPTPQLRLLDERDREMKSSNLHEIGITRLEYNIEVKPRDNEKKFRCIVSYNNVMDFESASSELMALQVANPPKQLHMKIISSMDNLIANQNFEMQCHTDSSFPEAKIEWWWHHSCKSSHTLGIRSTSKDVRSLCQSEILNEPQNINYQKSTQSTFTSINVKLTPEFDLSFIECMIIPHEKWITINKVLSKLIKIRVRYPPQFLNVHKLPNDVQTFVVEKGNNFSIAIKSIAHPSINGYTWLVNKQPMEKKIHIDTSVDKFSIVNAQPEMMANYSLLVENNLGKAAFDFFLNITYGPTLLGASQETIKVNPQMEHNHKAMIMCSAQANPSREQLTVEWIREISKILDQEELLDILKGQQKFISSDPIRCTNTHQWNKGKVNVNCISFGDVEIVTTMQIMPIDYRFIGSYRCIIKNSDKRPPAIKTIKLVYPTRPNPVKNFRKSEFAAQIFGKSELFCYFIGFPVPTVKWMTFYKNESLDNPVKYFTSVAQTEPGYFKAVLAISDTNESDLGKYICVAGNQYGESSHVVILNKPRSPTQPINFTVINVTETSVSVGWILRFNGGSKQQIKLYWRLRDTVVNGDYQNANIFEDEEKDVQFFTIYNLYRNREYEISIISVNEYSPSAGIPKPIIIKTMNYVDPDPDSIHIQNDSKRGFNKQLEKRIEPVESNNFLIIILLATVGVLLLTIKIGLIVYFVRKRKLKHRKSREKLSSPPTHQRMDTVGFISNDDSIEMRPPSLVRSGIESNLYAQSISDHMSQNGSDTGLKLNYYKTHSDDQFSSPFLGPELDLVASVRGRNNYDINALSPNFHPGYIQFAESSSMTSAQDPYIKGYYTQRPYYNSQTPSHGVIRKSSHSSNDTVTLPQYPISSGYQKRMDKVCFPQSAVSISTNSGDSNCSQSPPRKYIGYSPMVNQSGAPSTVEEYLSSGNSASESHRFGINGSDEYFTSPMSSFRLNQGLDSMSNKDFYSQLCSTNQQNQESA 1526          
BLAST of NPHS1-1 vs. Planmine SMEST
Match: SMESG000021277.1 (SMESG000021277.1)

HSP 1 Score: 426.402 bits (1095), Expect = 1.667e-123
Identity = 350/1269 (27.58%), Postives = 605/1269 (47.68%), Query Frame = 2
Query:  188 ESISLSQSSTCTEKDDIHRIQCFRELPSPKYDVLEGKDVLMGCRVAHQQGKLQWAFKGKMLGFDRNIPTYPRMRMTGNAVIGDHSLFIENVKVSDSGNYECQLSPA-ASQPPRRRMTKLTVLKVPSTPIIYQNGQSNKQN---ISVSIKK-DEFDSNINLTCVSLNGNPVPTFEWSVNRSPLKHGFKFRGNKVSIETINDTANS-LSMKSSQIMNGDIVTCGVENNATRKMFNLTERIIKTQMRVFKRILPGKIVIKEVSDIEKTVYVTEGHQLQLSCVCNNPGDPPIDLKWN--------INEDDLMIAQDKILSVKSEHFSQNTFRMSNISRKWHRKELYCSGSQDNYAIPSSATVLILVNYPPSKIEMEAISIKTNVSLHNPST--------VYCKEGQKVKLSCTSDNFFTDNVRILWFIKSSEESDWKPITTSFEKTVFTSDGRLKYITSSLEVPPSFVDKDISSHILSRLLSQVVCIVKSTEFNIEIRRQ--------LKIELFEEPSVPVLTLNNLSKPQILTNGESAKLKCTVTGGHPTPQLRLLDERDR---EMKSSNLHEIGIT-----RLEYNIEVKPRDNEKKFRCIVSYNNVMDFESASSELMALQVANPPKQLHMKIISSMDNLIANQNFEM-QCHTDSSFPEAKIEWWWHHSCKSSHTLGIRSTSKDVRSLCQSEILNEPQNINYQKSTQSTF--TSINVKLTPEFDLSFIECMIIPHEKW-ITINKVLSKLIKIRVRYPPQFLNVHKLPNDVQ-TFVVEKGNNFSIAIKSIAHPSINGYTWLVNKQPMEKKIHIDTSVDKFSIVNAQPEMMANYSLLVENNLGKAAFDFFLNITYGPTLLGASQETIKVNPQMEHNHKAMIMCSAQANPSREQLTVEWIREISKILDQEELLDIL-KGQQKFISSD-PIRCTNTHQWNKGKVNVNCISFGDVEIVTTMQIMPIDYRFIGSYRCIIKNSDKRPPAIKTIKLVYPTRPNPVKNFRKSEFAAQIFGKS-ELFCYFIGFPVPTVKWMTFYKNESLDNPVKYFTSVAQTEPGYFKAVLAISDTNESDLGKYICVAGNQYGESSHVVILNKPRSPTQPINFTVINVTETSVSVGWILRFNGGSKQQIKLYWRLRDTVVNGDYQNANIFEDEEKDVQFFTIYNLYRNREYEISIISVNEYSPSAGIPKPIIIKTMNYVDPDPDSIHIQNDSKRGFNKQLEKRIEPVESNNFLIIILLATVGV-LLLTIKIGLIVYFVRKRKLK-HRKSRE 3850
            E++   QS  C E++  + +QCF+ELP   Y+ L G+ +++ C VA+Q+GK QW  + +MLGF+RNIP  PR  MTG+   GD SL IENV +SD+G YECQ++     +   RR+T LTVL  PS P+IY+N      +   I++S K  D  +  +NL C S  G P PTFEW  N   LK        ++ ++ I+   +S L++  +Q+MNGD +TC V N AT +    ++  +KT + +    LPG     +++DI+  + ++EG  L LSC     G+PP  +KW+        ++++   +++D I +        +   +  I R +H   + C  + D      +  V I V Y P  I +++   K       PS         VY +  QK+   CT+  ++   V + W+    E  D           +F      K +   +    + VDK +    +S+    V    KS     E++ Q        + +E  + PS+P+L ++     + +T+     + C   GG+PTP L L     +   E   S+ + I +T     R   N++V        +RC ++ +    F++  S    LQV  PP +L + I  +  N + +  F +  C TD S P  +I  W  + C++ +        K ++  C  +++     +   K   S    ++I + LT + + + +EC I     + I+I K L     + V++PP F        D+Q  +VV +G   +I +   ++PS+  Y WL    P+     +    +  +I+ +  +MM NY+L+  N +G  +F F LN+T+G  L+G   E I V P  +   +A ++C AQ+NP+  Q  V W     ++LD+     +L K +Q+ ISS   I+C   +     K   +CIS  ++EI++T+ I  +    +G Y+C++ N+ +   A K + L  P     V + R+ +F+    G+S +LFC+  G+P P V W     N +L +  K+     +   G + ++L ++   + D   Y C A N  G ++  + L+    P  P N  V+N+T   ++V W   FNGG +Q+  + W+   +  + D  +  + E+   +   + I +L  + +YEI I S ++   S     PI++KT      +  SI+  +  K   +K        ++SNN +I I   +V V ++L I I  + +++RKR+ K H+ S +
Sbjct:   52 EAVLFHQSELCQEEELKNNLQCFKELPEENYEALIGETIIIKCIVANQKGKAQWRIEDRMLGFNRNIPFKPRFSMTGDEEAGDQSLRIENVTISDAGEYECQVTRGNYGKKELRRLTHLTVLVPPSQPLIYENNNRQPSSTILITISAKMYDNHNKKLNLKCESKEGQPDPTFEWYHNSQMLKE------QELLVKIIDYKTHSFLTISFTQLMNGDSITCAVFNKATLRNSQTSQTKLKTSVSIAINTLPGA---PKITDIKNKIIISEGKSLSLSCQSQPAGEPPGSIKWDWADGNKKQLDQNRYALSKDWINTFVDSGILLSRITIPKIDRSYHGLFILCKLNHD-LLDDQTDQVQIWVEYGPDNITIDSSVGKPKRITKYPSNDIGMDIPIVYAQPNQKLLFQCTTSAYY-GKVHLSWY----ESED-----------IFNHKDNWKLL-DQVTTNENMVDKGLRKVQISQ-FETVHSAEKSVLMKCELKFQDSYKRSSLVMVETIKMPSIPILKMDK----EYITDKSEVTISCQTYGGNPTPSLTLYKGHQKIKTEFGKSDPNRITLTHKFIARKSMNLDV--------YRCGIT-SPFRLFDNLKSNETKLQVFYPPTKLSLTI--APGNSMRSGTFNVFHCRTDESNPAPEIT-WTKYDCENKNFNYQIDREKLLK--CAYKVIQSTYTVTIGKWNGSFVLQSTIKIPLTEDDNKNILECSINSMAGFKISIRKALV----LTVKHPPIF------KKDIQYDYVVTEGQPITIYLNPASNPSVQSYQWLSEGSPIPYSRALRVQDNSLTIIRSDVDMMRNYTLIARNEIGTGSFTFRLNVTFGARLIGPDSEDISVKPDEK---EAKLICKAQSNPTGSQTRVIW-----QMLDKTYNWRLLYKERQEVISSSGSIQCNGDYWTYLAKYRASCISVSNIEIMSTLHIWNLVPSDMGRYQCLVNNTIES-AAGKVLNLNVPVGATIVIS-RRRQFSGGELGQSAKLFCWVFGYPKPKVIWYRDISNLTLISGKKFQYDSERLGSGLYNSILTVNFIEKQDYMNYFCQASNDIGSATARIRLSSSTKPDIPFNIRVVNITNKMIAVEWEQGFNGGFEQEFIVSWK-SVSRFSSDIHSVQLVENMLDEKLIYVIKDLLSSTQYEIRICSKSKIFQSCQFSSPILVKTKKTSSSEESSIYSTSSFKTTKDK--------LKSNNIIITITSVSVFVFVILVINILFVAFYLRKRRNKSHQNSNQ 1245          
BLAST of NPHS1-1 vs. Planmine SMEST
Match: SMESG000028689.1 (SMESG000028689.1)

HSP 1 Score: 392.119 bits (1006), Expect = 1.327e-111
Identity = 368/1455 (25.29%), Postives = 658/1455 (45.22%), Query Frame = 2
Query:  170 DDLDAAESISLSQSSTCTEKDDIHRIQCFRELPSPKYDVLEGKDVLMGCRVAHQQGKLQWAFKGKMLGFDRNIPTYPRMRMTGNAVIGDHSLFIENVKVSDSGNYECQLSPAASQPP-RRRMTKLTVLKVPSTP-IIYQNGQSNKQNISV-SIKKDEFDSNINLTCVSLNGNPVPTFEWSVNRSPLKHGFKFRGNKVSIETINDTANSLSMKSSQIMNGDIVTCGVENNATRKMFNLTERIIKTQMRVFKRILPGKIVIKEVSDIEKTVYVTEGHQLQLSCVCNNPGDPPIDLKWNI----------NEDDLMIAQDKILSVKSEHFSQN----TFRMSNISRKWHRKELYCSGSQDNYAIPSSATVLILVNYPPS---KIEMEAISIKT-NVSLHNPSTVYCKEGQKVKLSCTSDNFFTDNVRILWFIK----------SSEESDWKPITTSFEKTVFTSDGRLKYITSSLEVPPSFVDKDISSHILSRLLSQVVCIVKSTEFNIEIRRQLKIELFEEPSVPVLTLNNLSKPQILTNGESAKLKCTVTGGHPTPQLRLLDERDREMKSSNLHEIGITRLEYNIEVKPRDNEKKFRCIVSYNNV-MDFESASSELMALQVANPPKQLHMKIISSMDNLIANQNFEMQCHTDSSFPEAKIEWWWHHSCKSSHTLGIRSTSKDVRSLCQSEILNEPQNINYQKSTQSTFTSINVKLTPEFD--LSFIECMIIPHEKWITINKVLSKLIKIRVRYPPQFLNVHKLPNDVQTFVVEKGNNFSIAIKSIAHPSINGYTWLVNKQPMEKK-IH-IDTSVDKFSIVNAQPEMMANYSLLVENNLGKAAFDFFLNITYGPTLLG---ASQETIKVNPQMEHNHKAMIMCSAQANPSREQLTVEWIREISKILDQEELLDILKGQQKFISSDPIRCTNTHQWNKG-------KVNVNCISFGDVEIVTTMQIMPIDYRFIGSYRCIIKNSDKRPPAIKTIKLVYPTRPNPVKNFRKSEFAAQIFGKSELFCYFIGFPVPTVKWMTFYKNESLDNPVKYFTSVAQTEPGYFKAVLAISDTNESDLGKYICVAGNQYGESSHVVILNKPRSPTQPINFTVINVTETSVSVGWILRFNGGSKQQIKLYWRLRDTVVNGDYQNANIFEDEEKDVQFFTIYNLYRNREYEISIISVNEYSPSAGIPKPIIIKTMNYVDPDPDSIHIQNDSKRGFNKQLEKRIEP--VESNNFLIIILLATVGVLLLTIKIGLIVYFVRKRKLKHRKSR--EKLSSPPTHQRMDTVGFISNDDSIEMRPPSLVRSGIESNLYAQSISDHMSQNGSDTGLKLNYYKTHS------DDQ--FSSPFLGPELDLVASVRGRNNYDINALSPNFHPGYIQFAESSSMTSAQDPYIKGYYTQRPYYNSQTP---SHGVIRKSSHSSNDTVTLPQYPISSSYQKRM 4351
            DD + +    + QS  CT ++ ++RIQCF+E+P P Y+V +G    + C V +Q GK+QW     +LG+DRNIP  P  R+ G+ V G+H L I NV V D+G YECQ+ P   + P  RR TKL VL  P  P I Y+  Q N   + + SIK+   D     TCVS NG P   F+W +N + ++       N   +E +N + + LS+K+S+  +GD++ C V N AT    +   R + T++ +     PG+  I +++  + T YV + + + ++C  +  G P   L W            N  +    +D       +  S+N    T  +  ++ K H  +L+C  +    +  S+A  L +++ P      +   ++S +T      N + +Y + G++  ++CT+D ++ +   I W             S  E  WK      E   F  +  +K I  + +   SF+D    S I S                  ++ ++K+ +   P  P +   N+ KP  L +  + ++ C+  GG+P P+L+   +  + ++SS + +    +    I + P  N+ K +      ++ +     +S+ + L V  PP  + +K +S  + +   +  ++QC    S P A + W  +   +    LG R     V++ C  E+L+   +         +      ++ P +   L +++C +  +  +   ++VL K I+I V + PQF  +         F +E+G + ++ ++ IA+P I  YTW  N   + +K +H I TS  K  I NA+P  + NY+L+V N+ G++    +LNITY P ++G     +E I+ N ++E        CS Q+NP+   ++ +W    +K++  +   DI       + +  I C N  +W KG       K    C+     E+ + + I  +D   +G YRC++ N   R   +KTI+L     P  +   + S+ A  +  +  LFCY    P P + W     N S+    KY  ++ +   G++ A L I +   +D G Y+C A N  G  S  + ++   +P  P+   V+N +++ + + WI  F+GGS Q  ++ W+ +       Y+  ++  D+ K    F I  L  +  Y ISI S N    ++   K I+  TM+             D+++  N+     I+P  ++ N  L I+  +  G ++L + I +I++ +R+R+ + R ++   + ++P +         +S DDS++    + +RS +   LY + +        S   L  N ++ HS      DDQ  FSS   G +      +R +  +    + PN   G        S+  A DP     Y       S TP    HG+  +      DT++    PI    Q+++
Sbjct:   33 DDSEMSSGAKIKQSIECTNEEIVNRIQCFQEIPKPVYEVAQGSAATLRCIVRNQYGKVQWRAVPVLLGYDRNIPGRPTYRVVGSVVKGEHFLEISNVTVKDAGIYECQVQPVGQEHPLLRRKTKLVVLVRPDQPQIFYKGFQPNGDQVIINSIKQ---DVRTEFTCVSDNGQPKVKFQWFLNNNLIQDN----ENSALLEELNYSRSRLSLKTSKFKDGDVIKCRVSNRATEVHQDPERRSLSTEVFIVIHTPPGQPQIVDMNPHKTTPYVVDDN-IIMTCESSPSGKPAGSLLWRWKYPKVRELYNNRFENYTTKDISPQYYQQTISKNKMVSTLTIPALTSKEHGAQLFCVATNPVISYQSTAVKLYILHIPNKVVISVSDGSLSSRTIGKDGLNENVIYGEAGEEKTITCTTDPYYNE-ATIKWVFSPNPAINNDFISPVEKIWK------EDESFRRNSTIK-IKINKQFDQSFLDCQAWSGIKS------------------VQSRVKLHITYSPEKPTIQGYNVGKPVKLNH--NFEMTCSTIGGNPYPELQWFRD-SKPIQSSFIAQQVGNQKTLKIIITPSINDNKVKYFCQAKSISLKSSPLNSDEVTLIVLFPPMTIGLKSLSGAE-VENGKLLKLQCTAGESNPPAVVRWKLNRCGQMMSELGRRP----VQTTCNEELLSASSSNTINGKFGGSLIQSYFEIYPSWKDHLDYVDCEVF-NPDYGEEHQVLRKRIQINVTFSPQFEGIINY-----NFYIEEGQSQTLNLEPIANPPIKDYTWFRNSTKLSRKNVHSISTSKAKLIIRNAKPVDIDNYTLVVVNDRGESQITIYLNITYQPIIIGDKFERKEIIRQNAELE--------CSVQSNPANPHMSYKW----TKLVPGKGYNDI--SSSDLVPAFTIGC-NQAEW-KGTPEKSNFKYFSKCMVKSQFEMTSLLIIYDVDRNDVGLYRCVVNNG-IRGDVVKTIELTKEFTPQILSLPKFSKAAGNLGEEVSLFCYIRSHPSPKMTWFFGRYNTSVSANSKYRINITRFRTGFYVAQLKIVNLQRTDHGSYVCKAENGKGSDSRKIEVSGTSTPDVPLEIQVVNKSQSQIEISWIQGFDGGSIQTFQVRWKEKSPT--SLYRYEDVASDDTKITLSFIITGLKSDTAYLISINSRNSKHGTSQFSKTIMTNTMSA------------DNEKENNQPTYPIIQPNKLQDNTILFIVAASVFGFVILVVNILVIIFVLRRRRQRSRTAKLEARYNNPKSLLAASNGLILSRDDSLKDSNFNYLRSDM-VELYPRGLD-------SSQILHHNPHQIHSLRRSIPDDQKTFSSFETGSDDAREDLLRRQKEFGCCGIDPNSQKG--------SIIVAYDPITNSSYYAPANATSPTPIYLQHGMYDQ------DTMSTLLSPIHEGGQRQL 1386          
The following BLAST results are available for this feature:
BLAST of NPHS1-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NPHS18.028e-1922.06NPHS1 adhesion molecule, nephrin [Source:HGNC Symb... [more]
NPHS19.673e-1922.06NPHS1 adhesion molecule, nephrin [Source:HGNC Symb... [more]
KIRREL18.286e-1327.86kirre like nephrin family adhesion molecule 1 [Sou... [more]
KIRREL25.603e-1232.08kirre like nephrin family adhesion molecule 2 [Sou... [more]
KIRREL35.906e-1225.50kirre like nephrin family adhesion molecule 3 [Sou... [more]
back to top
BLAST of NPHS1-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
syg-21.198e-3121.39Synaptogenesis protein syg-2 [Source:UniProtKB/Sw... [more]
syg-28.752e-3121.49Synaptogenesis protein syg-2 [Source:UniProtKB/Sw... [more]
syg-29.643e-2421.32Synaptogenesis protein syg-2 [Source:UniProtKB/Sw... [more]
syg-25.715e-2321.45Synaptogenesis protein syg-2 [Source:UniProtKB/Sw... [more]
syg-25.297e-2122.58Synaptogenesis protein syg-2 [Source:UniProtKB/Sw... [more]
back to top
BLAST of NPHS1-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hbs1.997e-6623.18gene:FBgn0029082 transcript:FBtr0087414[more]
hbs1.997e-6623.18gene:FBgn0029082 transcript:FBtr0345419[more]
hbs2.122e-6623.18gene:FBgn0029082 transcript:FBtr0087413[more]
sns2.953e-4922.88gene:FBgn0024189 transcript:FBtr0088635[more]
sns4.709e-4822.79gene:FBgn0024189 transcript:FBtr0339277[more]
back to top
BLAST of NPHS1-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kirrel3a3.859e-1527.18kirre like nephrin family adhesion molecule 3a [So... [more]
kirrel3a3.859e-1527.18kirre like nephrin family adhesion molecule 3a [So... [more]
kirrel3a3.946e-1527.18kirre like nephrin family adhesion molecule 3a [So... [more]
kirrel1b9.647e-1426.10kirre like nephrin family adhesion molecule 1b [So... [more]
kirrel1b1.004e-1326.10kirre like nephrin family adhesion molecule 1b [So... [more]
back to top
BLAST of NPHS1-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NPHS11.570e-2721.24NPHS1 nephrin [Source:NCBI gene;Acc:100494620][more]
eif4e1.258e-1630.88eukaryotic translation initiation factor 4E [Sourc... [more]
eif4e1.643e-1631.37eukaryotic translation initiation factor 4E [Sourc... [more]
eif4e1.739e-1631.37eukaryotic translation initiation factor 4E [Sourc... [more]
eif4e1.915e-1630.88eukaryotic translation initiation factor 4E [Sourc... [more]
back to top
BLAST of NPHS1-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Kirrel4.455e-1327.00kirre like nephrin family adhesion molecule 1 [Sou... [more]
Kirrel7.182e-1327.86kirre like nephrin family adhesion molecule 1 [Sou... [more]
Kirrel7.182e-1327.86kirre like nephrin family adhesion molecule 1 [Sou... [more]
Kirrel32.214e-1227.84kirre like nephrin family adhesion molecule 3 [Sou... [more]
Nphs12.733e-1223.08nephrosis 1, nephrin [Source:MGI Symbol;Acc:MGI:18... [more]
back to top
BLAST of NPHS1-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9U3P2|SYG2_CAEEL3.260e-2621.51Synaptogenesis protein syg-2 OS=Caenorhabditis ele... [more]
sp|O60500|NPHN_HUMAN6.902e-1423.57Nephrin OS=Homo sapiens OX=9606 GN=NPHS1 PE=1 SV=1[more]
sp|B1Q236|SYG1_CAEEL7.216e-1335.00Synaptogenesis protein syg-1 OS=Caenorhabditis ele... [more]
sp|Q08180|ICCR_DROME2.264e-1224.45Irregular chiasm C-roughest protein OS=Drosophila ... [more]
sp|Q96J84|KIRR1_HUMAN3.979e-1227.86Kin of IRRE-like protein 1 OS=Homo sapiens OX=9606... [more]
back to top
BLAST of NPHS1-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YFQ10.000e+0100.00NPHS1-1 OS=Schmidtea mediterranea OX=79327 GN=NPHS... [more]
A0A0H3YFQ65.410e-10624.90NPHS1-6 OS=Schmidtea mediterranea OX=79327 GN=NPHS... [more]
A0A4E0RLR11.131e-10124.34Nephrin OS=Fasciola hepatica OX=6192 GN=D915_00078... [more]
A0A4S2LBK44.235e-9724.55Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A4S2LB204.308e-9724.55Uncharacterized protein OS=Opisthorchis felineus O... [more]
back to top
BLAST of NPHS1-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kirrel3a3.436e-1327.69kirre like nephrin family adhesion molecule 3a [So... [more]
KIRREL37.274e-1328.35kirre like nephrin family adhesion molecule 3 [Sou... [more]
KIRREL37.449e-1328.35kirre like nephrin family adhesion molecule 3 [Sou... [more]
kirrel3l1.631e-1229.71kirre like nephrin family adhesion molecule 3, lik... [more]
kirrel3l1.741e-1229.71kirre like nephrin family adhesion molecule 3, lik... [more]
back to top
BLAST of NPHS1-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000002463.17.173e-727.10pep scaffold:Pmarinus_7.0:GL476400:5068:120393:-1 ... [more]
back to top
BLAST of NPHS1-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of NPHS1-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO452249.967e-629.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of NPHS1-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nphs12.814e-2621.83NPHS1 adhesion molecule, nephrin [Source:NCBI gene... [more]
nphs11.029e-2321.89NPHS1 adhesion molecule, nephrin [Source:NCBI gene... [more]
KIRREL35.169e-1429.74kirre like nephrin family adhesion molecule 3 [Sou... [more]
KIRREL33.571e-1328.35kirre like nephrin family adhesion molecule 3 [Sou... [more]
KIRREL33.845e-1328.35kirre like nephrin family adhesion molecule 3 [Sou... [more]
back to top
BLAST of NPHS1-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000003359.10.000e+099.88SMESG000003359.1[more]
SMESG000003359.10.000e+099.87SMESG000003359.1[more]
SMESG000003359.10.000e+099.87SMESG000003359.1[more]
SMESG000021277.11.667e-12327.58SMESG000021277.1[more]
SMESG000028689.11.327e-11125.29SMESG000028689.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30027960
GenBankAKN21717.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027960 ID=SMED30027960|Name=NPHS1-1|organism=Schmidtea mediterranea sexual|type=transcript|length=5087bp
CGATCTTTTTCATGTTTAACGAAAATAAAAATCAAATTTCTCAAACTGGA
ACACAAGCAATCAAACAAAAAATGAAATGTTGAACTTTTGGATGATATGC
GTTTTTGTTTTATCAAATACTTTTATAAATCGCATTGAATTCGTTTTGTG
TCAAGATCCATTTAATGTCGATGATCTAGATGCTGCTGAGTCAATTTCTC
TTTCCCAATCCAGCACCTGCACAGAAAAAGACGACATTCATCGAATTCAG
TGTTTCCGGGAGTTGCCTTCACCAAAATATGACGTATTGGAAGGAAAAGA
TGTTTTGATGGGTTGCCGCGTGGCTCATCAACAAGGCAAGTTACAATGGG
CTTTTAAAGGAAAAATGCTAGGATTTGATAGAAACATTCCGACCTACCCG
AGAATGCGTATGACTGGAAACGCAGTTATTGGGGATCATAGTTTATTTAT
TGAAAATGTAAAAGTATCTGATTCAGGAAACTATGAATGTCAACTCTCTC
CAGCTGCATCCCAACCTCCAAGACGTAGAATGACGAAACTTACAGTGCTC
AAAGTACCATCAACTCCAATTATCTATCAAAATGGCCAGTCAAATAAACA
GAATATATCTGTCTCTATAAAGAAAGACGAATTTGATTCGAATATTAACT
TGACTTGCGTATCTTTGAATGGCAATCCGGTCCCGACATTTGAGTGGAGC
GTCAACAGAAGTCCTTTAAAACATGGGTTCAAATTTCGAGGAAATAAAGT
GTCTATTGAAACAATAAATGATACTGCAAACTCTTTGTCAATGAAATCGT
CCCAGATAATGAATGGGGACATTGTGACTTGTGGAGTGGAAAATAATGCT
ACAAGGAAAATGTTTAATCTGACAGAGAGAATTATCAAAACTCAAATGCG
AGTATTTAAGAGAATTCTTCCCGGGAAAATTGTCATAAAAGAGGTTTCCG
ATATAGAGAAAACAGTATATGTTACGGAAGGCCACCAATTGCAATTGTCT
TGCGTTTGCAACAACCCTGGCGACCCACCGATCGATTTGAAGTGGAACAT
TAACGAAGATGACCTGATGATAGCACAAGACAAGATTTTATCTGTTAAAT
CCGAGCACTTTAGTCAGAATACTTTTCGGATGTCTAATATTTCCAGAAAA
TGGCATCGAAAAGAACTTTATTGTTCAGGGTCCCAGGACAACTATGCAAT
TCCCAGTTCAGCAACGGTTTTGATTCTCGTAAATTATCCGCCAAGCAAAA
TTGAGATGGAAGCAATTTCTATAAAAACGAACGTCTCGTTGCACAATCCT
AGCACCGTGTATTGTAAAGAAGGGCAAAAGGTAAAACTCTCTTGTACTTC
CGACAACTTTTTTACAGATAATGTGCGAATTTTGTGGTTTATCAAAAGTT
CAGAGGAATCTGATTGGAAACCAATTACCACCTCGTTTGAGAAAACGGTT
TTTACTTCCGATGGTCGGTTGAAATATATCACAAGCTCATTAGAGGTCCC
TCCATCATTTGTTGACAAAGATATTTCCAGTCATATTTTATCCAGACTCC
TTTCGCAAGTCGTTTGTATCGTTAAATCGACTGAATTCAACATTGAGATT
CGTCGGCAGTTGAAAATCGAATTATTTGAGGAGCCTTCAGTTCCGGTTTT
GACATTAAACAATCTTTCGAAACCACAAATTCTAACCAACGGAGAAAGTG
CCAAATTGAAATGCACAGTTACTGGGGGGCACCCAACTCCACAATTACGT
CTACTTGATGAAAGAGACAGAGAGATGAAATCTTCGAACTTGCACGAAAT
TGGAATCACAAGATTGGAATACAATATAGAAGTAAAGCCAAGAGACAATG
AAAAAAAGTTCAGGTGTATTGTCTCCTACAATAATGTCATGGATTTCGAG
TCAGCGTCCAGTGAGTTGATGGCCTTGCAAGTAGCAAATCCTCCGAAGCA
ACTCCATATGAAGATCATCTCTTCTATGGATAACCTAATCGCCAACCAAA
ACTTTGAAATGCAATGTCATACAGATTCTTCGTTTCCGGAAGCAAAAATT
GAATGGTGGTGGCATCATTCATGCAAATCTTCACATACGCTTGGAATAAG
GTCAACCTCGAAAGATGTTAGATCCTTATGTCAATCAGAAATATTGAATG
AGCCACAGAATATCAATTATCAGAAGTCTACTCAGTCGACATTCACGTCA
ATCAACGTCAAATTAACCCCTGAATTCGATTTGTCTTTCATAGAATGCAT
GATCATACCTCATGAGAAGTGGATCACAATTAACAAAGTATTGTCGAAAT
TAATAAAGATTCGTGTCAGATATCCTCCTCAATTCCTCAATGTTCATAAA
CTACCGAATGACGTTCAAACTTTTGTCGTTGAAAAAGGAAATAATTTTTC
AATAGCGATTAAATCTATTGCGCATCCATCAATCAACGGCTACACTTGGT
TAGTCAACAAGCAACCTATGGAGAAAAAGATTCATATTGATACAAGTGTT
GATAAATTTTCCATCGTGAACGCTCAACCAGAAATGATGGCAAATTACAG
TCTTTTAGTTGAAAATAATCTAGGGAAAGCAGCATTTGACTTTTTTCTCA
ATATAACATATGGTCCGACACTGCTGGGAGCATCTCAGGAAACTATCAAA
GTTAATCCGCAAATGGAACACAATCATAAGGCTATGATAATGTGTTCCGC
GCAAGCAAATCCTAGTCGGGAACAGTTGACAGTGGAATGGATTCGAGAAA
TATCTAAAATATTGGATCAAGAAGAATTATTAGACATATTAAAGGGTCAG
CAAAAGTTTATAAGCAGTGATCCAATTCGGTGCACAAATACCCATCAATG
GAATAAGGGAAAAGTGAATGTAAATTGTATAAGCTTCGGTGATGTTGAGA
TTGTCACGACCATGCAGATCATGCCCATTGATTACAGATTTATCGGATCC
TATAGGTGCATCATAAAGAATAGTGACAAGAGACCGCCAGCAATTAAAAC
AATTAAACTTGTTTATCCAACCCGACCGAATCCAGTGAAAAATTTCAGAA
AATCAGAGTTTGCTGCTCAGATTTTCGGGAAATCTGAATTGTTTTGCTAT
TTTATTGGTTTCCCAGTGCCAACAGTAAAATGGATGACATTTTATAAAAA
TGAGAGTTTAGATAATCCGGTGAAATATTTTACTTCTGTTGCGCAAACTG
AGCCAGGATATTTTAAAGCGGTTTTAGCCATTAGCGACACGAACGAGTCA
GATTTGGGAAAATATATTTGTGTAGCCGGTAATCAATATGGTGAATCGTC
TCATGTTGTTATTTTAAACAAACCTCGCAGTCCTACTCAACCTATCAACT
TCACTGTGATAAATGTCACTGAAACCAGTGTCAGTGTTGGTTGGATTCTT
AGATTCAACGGCGGATCCAAACAGCAAATTAAGTTGTATTGGAGACTTCG
AGATACCGTGGTAAATGGAGATTATCAGAATGCAAATATTTTTGAGGATG
AAGAGAAGGATGTTCAATTTTTCACAATTTATAATCTCTATCGAAATCGG
GAATATGAAATTTCGATTATTTCTGTCAATGAATATTCTCCCAGCGCCGG
AATTCCGAAACCAATCATAATCAAAACTATGAATTATGTGGATCCGGATC
CAGATTCAATTCACATTCAAAATGATAGCAAAAGAGGTTTCAACAAGCAA
TTGGAAAAAAGAATTGAGCCTGTGGAATCTAATAATTTTTTAATCATTAT
TCTTCTAGCCACTGTTGGAGTGTTACTTCTGACCATCAAAATTGGCTTGA
TTGTGTATTTTGTTAGAAAGAGAAAATTAAAGCATCGAAAATCCAGAGAA
AAACTATCTAGTCCTCCTACTCATCAAAGAATGGATACCGTGGGTTTTAT
TAGCAACGACGACAGCATAGAAATGAGACCCCCATCACTAGTCAGAAGTG
GAATCGAATCGAATCTCTATGCTCAATCTATATCGGATCATATGTCACAA
AACGGATCCGACACCGGGCTAAAACTCAATTATTACAAAACTCATTCTGA
TGATCAATTTTCATCACCCTTTCTTGGTCCGGAACTCGATTTGGTAGCAT
CAGTAAGAGGTAGAAACAATTATGATATCAACGCTTTATCTCCAAACTTT
CATCCTGGTTACATTCAATTTGCCGAATCATCATCAATGACCAGTGCTCA
AGATCCTTATATTAAAGGGTACTACACCCAGCGTCCGTACTACAATTCCC
AAACACCATCACATGGGGTTATTAGAAAATCGAGTCACTCTTCAAACGAC
ACTGTTACTTTACCTCAGTATCCTATTTCGTCTAGTTATCAAAAACGAAT
GGATAAAGTCTGTTTTCCTCAAAGTGCTGTATCTATTTCAACAAATAGTG
GAGATTCAAATTGTAGTCAATCTCCTCCACGAAAATACATTGGATATTCT
CCAATGGTTAATCAATCTGGTGCTCCTAGTACAGTGGAAGAGTATTTGAG
TAGTGGCAATTCTGCCTCGGAGAGCCACAGATTTGGAATTAATGGAAGTG
ATGAATATTTTACTTCTCCAATGTCATCCTTTCGTCTCAATCAAGGCTTA
GATTCAATGAGTAACAAAGACTTTTATTCTCAACTGTGTTCCACCAATCA
ACAGAATCAAGAATCCGCTCAGGAATTTGCTATCCAAAGAATTATGTATG
GTAATGATGTTTCTGCAATCACTCCTTATCGGGCCTATAACGATCATCAA
CGTTTGTCAACAAGTTCGGATAATGAACATTTGTTGAAACCTCCTCTTGA
CTTTTCGGGAATCGAATCCAACAATAGCAACAACATACAATCTCCCATGG
CAGACGCACATAAACTCAGTTATGTAGATCTAATTGCACATTCTTCACCC
TCTGTGATAAGATTTACCGGCCCAATTTCTGAAAATTTATGAAATGTTAA
AAACCAATCTTCGATACTATATTATTTTTATTAGTATTAATATTAATATA
TATGATTAATATTGTTGAGAGTAATAATGCTACTCAGACTGTAGTTGCCC
CTCATAGAAAGATTCGAACTTTGTGTAAATACATTGG
back to top

protein sequence of SMED30027960-orf-1

>SMED30027960-orf-1 ID=SMED30027960-orf-1|Name=SMED30027960-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1622bp
MLNFWMICVFVLSNTFINRIEFVLCQDPFNVDDLDAAESISLSQSSTCTE
KDDIHRIQCFRELPSPKYDVLEGKDVLMGCRVAHQQGKLQWAFKGKMLGF
DRNIPTYPRMRMTGNAVIGDHSLFIENVKVSDSGNYECQLSPAASQPPRR
RMTKLTVLKVPSTPIIYQNGQSNKQNISVSIKKDEFDSNINLTCVSLNGN
PVPTFEWSVNRSPLKHGFKFRGNKVSIETINDTANSLSMKSSQIMNGDIV
TCGVENNATRKMFNLTERIIKTQMRVFKRILPGKIVIKEVSDIEKTVYVT
EGHQLQLSCVCNNPGDPPIDLKWNINEDDLMIAQDKILSVKSEHFSQNTF
RMSNISRKWHRKELYCSGSQDNYAIPSSATVLILVNYPPSKIEMEAISIK
TNVSLHNPSTVYCKEGQKVKLSCTSDNFFTDNVRILWFIKSSEESDWKPI
TTSFEKTVFTSDGRLKYITSSLEVPPSFVDKDISSHILSRLLSQVVCIVK
STEFNIEIRRQLKIELFEEPSVPVLTLNNLSKPQILTNGESAKLKCTVTG
GHPTPQLRLLDERDREMKSSNLHEIGITRLEYNIEVKPRDNEKKFRCIVS
YNNVMDFESASSELMALQVANPPKQLHMKIISSMDNLIANQNFEMQCHTD
SSFPEAKIEWWWHHSCKSSHTLGIRSTSKDVRSLCQSEILNEPQNINYQK
STQSTFTSINVKLTPEFDLSFIECMIIPHEKWITINKVLSKLIKIRVRYP
PQFLNVHKLPNDVQTFVVEKGNNFSIAIKSIAHPSINGYTWLVNKQPMEK
KIHIDTSVDKFSIVNAQPEMMANYSLLVENNLGKAAFDFFLNITYGPTLL
GASQETIKVNPQMEHNHKAMIMCSAQANPSREQLTVEWIREISKILDQEE
LLDILKGQQKFISSDPIRCTNTHQWNKGKVNVNCISFGDVEIVTTMQIMP
IDYRFIGSYRCIIKNSDKRPPAIKTIKLVYPTRPNPVKNFRKSEFAAQIF
GKSELFCYFIGFPVPTVKWMTFYKNESLDNPVKYFTSVAQTEPGYFKAVL
AISDTNESDLGKYICVAGNQYGESSHVVILNKPRSPTQPINFTVINVTET
SVSVGWILRFNGGSKQQIKLYWRLRDTVVNGDYQNANIFEDEEKDVQFFT
IYNLYRNREYEISIISVNEYSPSAGIPKPIIIKTMNYVDPDPDSIHIQND
SKRGFNKQLEKRIEPVESNNFLIIILLATVGVLLLTIKIGLIVYFVRKRK
LKHRKSREKLSSPPTHQRMDTVGFISNDDSIEMRPPSLVRSGIESNLYAQ
SISDHMSQNGSDTGLKLNYYKTHSDDQFSSPFLGPELDLVASVRGRNNYD
INALSPNFHPGYIQFAESSSMTSAQDPYIKGYYTQRPYYNSQTPSHGVIR
KSSHSSNDTVTLPQYPISSSYQKRMDKVCFPQSAVSISTNSGDSNCSQSP
PRKYIGYSPMVNQSGAPSTVEEYLSSGNSASESHRFGINGSDEYFTSPMS
SFRLNQGLDSMSNKDFYSQLCSTNQQNQESAQEFAIQRIMYGNDVSAITP
YRAYNDHQRLSTSSDNEHLLKPPLDFSGIESNNSNNIQSPMADAHKLSYV
DLIAHSSPSVIRFTGPISENL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0000418head
PLANA:0002028dorsal-ventral muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR036116FN3_sf
IPR036179Ig-like_dom_sf
IPR003599Ig_sub
IPR003598Ig_sub2
IPR003961FN3_dom
IPR013098Ig_I-set
IPR013783Ig-like_fold
IPR013151Immunoglobulin
IPR007110Ig-like_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003961Fibronectin type IIISMARTSM00060FN3_2coord: 1086..1173
e-value: 3.7E-6
score: 36.5
IPR003961Fibronectin type IIIPROSITEPS50853FN3coord: 1088..1191
score: 10.06
IPR003961Fibronectin type IIICDDcd00063FN3coord: 1086..1174
e-value: 2.40235E-5
score: 42.4835
IPR003598Immunoglobulin subtype 2SMARTSM00408igc2_5coord: 71..145
e-value: 0.069
score: 18.2
coord: 999..1072
e-value: 0.057
score: 19.1
coord: 185..259
e-value: 2.2
score: 3.8
IPR003599Immunoglobulin subtypeSMARTSM00409IG_3ccoord: 294..386
e-value: 16.0
score: 9.7
coord: 65..158
e-value: 1.6E-6
score: 37.7
coord: 992..1080
e-value: 30.0
score: 7.3
coord: 408..617
e-value: 11.0
score: 11.1
coord: 763..844
e-value: 44.0
score: 5.9
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 526..625
e-value: 1.2E-6
score: 30.8
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 1001..1085
e-value: 3.1E-10
score: 42.0
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 57..162
e-value: 2.4E-19
score: 71.3
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 289..393
e-value: 6.9E-8
score: 34.7
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 398..512
e-value: 5.5E-8
score: 34.7
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 629..751
e-value: 2.0E-5
score: 26.6
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 1086..1185
e-value: 1.8E-6
score: 30.0
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 163..269
e-value: 3.6E-8
score: 35.5
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 752..849
e-value: 1.2E-5
score: 27.3
IPR013151ImmunoglobulinPFAMPF00047igcoord: 64..150
e-value: 1.2E-6
score: 28.6
IPR013098Immunoglobulin I-setPFAMPF07679I-setcoord: 1003..1080
e-value: 7.9E-7
score: 29.1
NoneNo IPR availablePANTHERPTHR11640:SF102coord: 107..1258
NoneNo IPR availablePANTHERPTHR11640NEPHRINcoord: 107..1258
NoneNo IPR availableCDDcd00096Igcoord: 1004..1078
e-value: 1.546E-8
score: 50.7036
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..25
score: 0.515
NoneNo IPR availableTMHMMTMhelixcoord: 1223..1245
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 389..507
score: 6.869
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 58..153
score: 9.264
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 282..382
score: 8.121
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 971..1081
score: 7.994
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 161..266
score: 7.449
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 520..613
score: 7.214
IPR036116Fibronectin type III superfamilySUPERFAMILYSSF49265Fibronectin type IIIcoord: 1070..1188
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 185..260
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 1003..1081
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 64..166
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 402..478
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 531..605
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 742..845