Transmembrane protein 14C-like protein

Overview
NameTransmembrane protein 14C-like protein
Smed IDSMED30027955
Length (bp)703
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Transmembrane protein 14C-like protein (SMED30027955) t-SNE clustered cells

Violin plots show distribution of expression levels for Transmembrane protein 14C-like protein (SMED30027955) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Transmembrane protein 14C-like protein (SMED30027955) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Transmembrane protein 14C-like protein (SMED30027955) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027955

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30027955SMESG000007314.1 dd_Smed_v4_670_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30027955SMESG000007314.1 dd_Smed_v4_670_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30027955SMESG000007314.1 dd_Smed_v4_670_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30027955SMESG000007314.1 dd_Smed_v4_670_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30027955SMESG000007314.1 dd_Smed_v4_670_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30027955SMESG000007314.1 dd_Smed_v4_670_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Transmembrane protein 14C-like protein vs. Ensembl Human
Match: TMEM14C (transmembrane protein 14C [Source:HGNC Symbol;Acc:HGNC:20952])

HSP 1 Score: 78.5666 bits (192), Expect = 3.580e-18
Identity = 40/95 (42.11%), Postives = 61/95 (64.21%), Query Frame = 2
Query:   32 GLTYSGVIFTGGAIGYFKAGSTHSLVSGLIFGLAAFYGSHKMGQNPKNVHVLLITSAVLGMLMGQRFYKNPKVFPSGVLTTLSALVAARCGLRLL 316
            G  Y+ ++ +GG IGY KAGS  SL +GL+FG  A  G++++ Q+P+NV V L TS  L  +MG RFY + K  P+G++   S L+ A+ G+ + 
Sbjct:   14 GFGYAALVASGGIIGYVKAGSVPSLAAGLLFGSLAGLGAYQLSQDPRNVWVFLATSGTLAGIMGMRFYHSGKFMPAGLIAGASLLMVAKVGVSMF 108          
BLAST of Transmembrane protein 14C-like protein vs. Ensembl Human
Match: TMEM14C (transmembrane protein 14C [Source:HGNC Symbol;Acc:HGNC:20952])

HSP 1 Score: 78.5666 bits (192), Expect = 3.580e-18
Identity = 40/95 (42.11%), Postives = 61/95 (64.21%), Query Frame = 2
Query:   32 GLTYSGVIFTGGAIGYFKAGSTHSLVSGLIFGLAAFYGSHKMGQNPKNVHVLLITSAVLGMLMGQRFYKNPKVFPSGVLTTLSALVAARCGLRLL 316
            G  Y+ ++ +GG IGY KAGS  SL +GL+FG  A  G++++ Q+P+NV V L TS  L  +MG RFY + K  P+G++   S L+ A+ G+ + 
Sbjct:   14 GFGYAALVASGGIIGYVKAGSVPSLAAGLLFGSLAGLGAYQLSQDPRNVWVFLATSGTLAGIMGMRFYHSGKFMPAGLIAGASLLMVAKVGVSMF 108          
BLAST of Transmembrane protein 14C-like protein vs. Ensembl Human
Match: TMEM14C (transmembrane protein 14C [Source:HGNC Symbol;Acc:HGNC:20952])

HSP 1 Score: 78.5666 bits (192), Expect = 3.580e-18
Identity = 40/95 (42.11%), Postives = 61/95 (64.21%), Query Frame = 2
Query:   32 GLTYSGVIFTGGAIGYFKAGSTHSLVSGLIFGLAAFYGSHKMGQNPKNVHVLLITSAVLGMLMGQRFYKNPKVFPSGVLTTLSALVAARCGLRLL 316
            G  Y+ ++ +GG IGY KAGS  SL +GL+FG  A  G++++ Q+P+NV V L TS  L  +MG RFY + K  P+G++   S L+ A+ G+ + 
Sbjct:   14 GFGYAALVASGGIIGYVKAGSVPSLAAGLLFGSLAGLGAYQLSQDPRNVWVFLATSGTLAGIMGMRFYHSGKFMPAGLIAGASLLMVAKVGVSMF 108          
BLAST of Transmembrane protein 14C-like protein vs. Ensembl Human
Match: TMEM14C (transmembrane protein 14C [Source:HGNC Symbol;Acc:HGNC:20952])

HSP 1 Score: 78.5666 bits (192), Expect = 3.580e-18
Identity = 40/95 (42.11%), Postives = 61/95 (64.21%), Query Frame = 2
Query:   32 GLTYSGVIFTGGAIGYFKAGSTHSLVSGLIFGLAAFYGSHKMGQNPKNVHVLLITSAVLGMLMGQRFYKNPKVFPSGVLTTLSALVAARCGLRLL 316
            G  Y+ ++ +GG IGY KAGS  SL +GL+FG  A  G++++ Q+P+NV V L TS  L  +MG RFY + K  P+G++   S L+ A+ G+ + 
Sbjct:   14 GFGYAALVASGGIIGYVKAGSVPSLAAGLLFGSLAGLGAYQLSQDPRNVWVFLATSGTLAGIMGMRFYHSGKFMPAGLIAGASLLMVAKVGVSMF 108          
BLAST of Transmembrane protein 14C-like protein vs. Ensembl Human
Match: TMEM14B (transmembrane protein 14B [Source:HGNC Symbol;Acc:HGNC:21384])

HSP 1 Score: 65.0846 bits (157), Expect = 4.033e-13
Identity = 38/96 (39.58%), Postives = 58/96 (60.42%), Query Frame = 2
Query:   32 GLTYSGVIFTGGAIGYFKAGSTHSLVSGLIFGLAAFYGSHKMGQNPKNVH-VLLITSAVLGMLMGQRFYKNPKVFPSGVLTTLSALVAARCGLRLL 316
            G  Y+ ++ +GG +GY K GS  SL +GL+FG  A  G++++ Q+P+NV   L  TS     +MG R Y   K  P G++   S L+AA+ G+R+L
Sbjct:   15 GFGYTALVVSGGIVGYVKTGSVPSLAAGLLFGSLAGLGAYQLYQDPRNVWGFLAATSVTFVGVMGMRSYYYGKFMPVGLIAGASLLMAAKVGVRML 110          
BLAST of Transmembrane protein 14C-like protein vs. Ensembl Fly
Match: CG5532 (gene:FBgn0034902 transcript:FBtr0072091)

HSP 1 Score: 56.9954 bits (136), Expect = 2.272e-10
Identity = 34/87 (39.08%), Postives = 49/87 (56.32%), Query Frame = 2
Query:   20 MDIVGLTYSGVIFTGGAIGYFKAGSTHSLVSGLIFGLAAFYGSHKMGQNPKNVHVLLITSAVLGMLMGQRFYKNPKVFPSGVLTTLS 280
            +D  G  Y+  +  GG +GY KAGS  SL +GL FG    YG+H   Q+     + L TS  L  LMG R+ ++ K+ P+G++  LS
Sbjct:    3 VDWFGYVYAATVAAGGIMGYAKAGSIPSLGAGLAFGALLGYGAHLNSQDTPRPLLQLGTSLFLAGLMGARWNRSGKLMPAGMVCMLS 89          
BLAST of Transmembrane protein 14C-like protein vs. Ensembl Fly
Match: CG5532 (gene:FBgn0034902 transcript:FBtr0345535)

HSP 1 Score: 56.9954 bits (136), Expect = 2.272e-10
Identity = 34/87 (39.08%), Postives = 49/87 (56.32%), Query Frame = 2
Query:   20 MDIVGLTYSGVIFTGGAIGYFKAGSTHSLVSGLIFGLAAFYGSHKMGQNPKNVHVLLITSAVLGMLMGQRFYKNPKVFPSGVLTTLS 280
            +D  G  Y+  +  GG +GY KAGS  SL +GL FG    YG+H   Q+     + L TS  L  LMG R+ ++ K+ P+G++  LS
Sbjct:    3 VDWFGYVYAATVAAGGIMGYAKAGSIPSLGAGLAFGALLGYGAHLNSQDTPRPLLQLGTSLFLAGLMGARWNRSGKLMPAGMVCMLS 89          
BLAST of Transmembrane protein 14C-like protein vs. Ensembl Zebrafish
Match: tmem14cb (transmembrane protein 14Cb [Source:ZFIN;Acc:ZDB-GENE-040912-34])

HSP 1 Score: 83.5741 bits (205), Expect = 2.670e-20
Identity = 45/99 (45.45%), Postives = 66/99 (66.67%), Query Frame = 2
Query:   20 MDIVGLTYSGVIFTGGAIGYFKAGSTHSLVSGLIFGLAAFYGSHKMGQNPKNVHVLLITSAVLGMLMGQRFYKNPKVFPSGVLTTLSALVAARCGLRLL 316
            MD +G  Y+ +I  GG +GY KAGS  SLV+GL+FG+AAF G+++M +N K++ V L TS  L  LMG RF  + K+ P+G +   S L+  R G+++L
Sbjct:    1 MDWLGYGYAALITIGGIVGYAKAGSFISLVAGLMFGVAAFVGAYQMSKNDKDIWVSLGTSGSLTALMGVRFLSSWKIMPAGFMAGASLLMFLRIGVKVL 99          
BLAST of Transmembrane protein 14C-like protein vs. Ensembl Zebrafish
Match: tmem14ca (transmembrane protein 14Ca [Source:NCBI gene;Acc:751728])

HSP 1 Score: 82.0333 bits (201), Expect = 1.036e-19
Identity = 40/99 (40.40%), Postives = 63/99 (63.64%), Query Frame = 2
Query:   20 MDIVGLTYSGVIFTGGAIGYFKAGSTHSLVSGLIFGLAAFYGSHKMGQNPKNVHVLLITSAVLGMLMGQRFYKNPKVFPSGVLTTLSALVAARCGLRLL 316
            +D  G  Y+ ++ +GG IGY KAGS  SL +GL+FG  A +G+++  Q+P N+ V L  S  L  +MG+RFY + K+ P+G++   S L+ A+ G  +L
Sbjct:    3 VDWAGYGYAALVASGGVIGYVKAGSVPSLAAGLVFGGLAGFGAYQTSQDPGNIWVSLAASGTLAAIMGKRFYNSRKIIPAGLIAGASVLMLAKLGAGML 101          
BLAST of Transmembrane protein 14C-like protein vs. Ensembl Zebrafish
Match: zgc:163080 (zgc:163080 [Source:ZFIN;Acc:ZDB-GENE-070410-137])

HSP 1 Score: 72.0182 bits (175), Expect = 4.270e-16
Identity = 35/93 (37.63%), Postives = 60/93 (64.52%), Query Frame = 2
Query:   20 MDIVGLTYSGVIFTGGAIGYFKAGSTHSLVSGLIFGLAAFYGSHKMGQNPKNVHVLLITSAVLGMLMGQRFYKNPKVFPSGVLTTLSALVAAR 298
            +D +G  Y+  +  GG +GY + GS  SL++GL FG A+ YG+ ++  +P+N  + L+++ VL  +MG RF K+ K+ P+G++  LS L+  R
Sbjct:    3 VDWLGFAYAAALVFGGFVGYKRKGSVVSLIAGLFFGTASAYGALRITLDPQNYGISLLSAGVLAAVMGMRFRKSGKLMPAGIMAGLSLLMVIR 95          
BLAST of Transmembrane protein 14C-like protein vs. Ensembl Zebrafish
Match: zgc:163080 (zgc:163080 [Source:ZFIN;Acc:ZDB-GENE-070410-137])

HSP 1 Score: 72.0182 bits (175), Expect = 4.270e-16
Identity = 35/93 (37.63%), Postives = 60/93 (64.52%), Query Frame = 2
Query:   20 MDIVGLTYSGVIFTGGAIGYFKAGSTHSLVSGLIFGLAAFYGSHKMGQNPKNVHVLLITSAVLGMLMGQRFYKNPKVFPSGVLTTLSALVAAR 298
            +D +G  Y+  +  GG +GY + GS  SL++GL FG A+ YG+ ++  +P+N  + L+++ VL  +MG RF K+ K+ P+G++  LS L+  R
Sbjct:    3 VDWLGFAYAAALVFGGFVGYKRKGSVVSLIAGLFFGTASAYGALRITLDPQNYGISLLSAGVLAAVMGMRFRKSGKLMPAGIMAGLSLLMVIR 95          
BLAST of Transmembrane protein 14C-like protein vs. Ensembl Zebrafish
Match: zgc:163080 (zgc:163080 [Source:ZFIN;Acc:ZDB-GENE-070410-137])

HSP 1 Score: 72.0182 bits (175), Expect = 4.270e-16
Identity = 35/93 (37.63%), Postives = 60/93 (64.52%), Query Frame = 2
Query:   20 MDIVGLTYSGVIFTGGAIGYFKAGSTHSLVSGLIFGLAAFYGSHKMGQNPKNVHVLLITSAVLGMLMGQRFYKNPKVFPSGVLTTLSALVAAR 298
            +D +G  Y+  +  GG +GY + GS  SL++GL FG A+ YG+ ++  +P+N  + L+++ VL  +MG RF K+ K+ P+G++  LS L+  R
Sbjct:    3 VDWLGFAYAAALVFGGFVGYKRKGSVVSLIAGLFFGTASAYGALRITLDPQNYGISLLSAGVLAAVMGMRFRKSGKLMPAGIMAGLSLLMVIR 95          
BLAST of Transmembrane protein 14C-like protein vs. Ensembl Xenopus
Match: panx1 (pannexin 1 [Source:Xenbase;Acc:XB-GENE-993672])

HSP 1 Score: 76.6406 bits (187), Expect = 1.603e-17
Identity = 40/98 (40.82%), Postives = 61/98 (62.24%), Query Frame = 2
Query:   23 DIVGLTYSGVIFTGGAIGYFKAGSTHSLVSGLIFGLAAFYGSHKMGQNPKNVHVLLITSAVLGMLMGQRFYKNPKVFPSGVLTTLSALVAARCGLRLL 316
            D  G  Y+ ++ +GG +GY KAGS  SL +GL+FG  A  G+++M  + KNV + LI S  L  +MG RFY + K  P+G++   S L+  R G+++L
Sbjct:    4 DWFGFGYAALVASGGIMGYVKAGSVPSLAAGLLFGSLAGLGAYQMSNDSKNVLLSLIASGTLAGVMGFRFYNSGKFMPAGIIAGASLLMVGRIGMKML 101          
BLAST of Transmembrane protein 14C-like protein vs. Ensembl Xenopus
Match: TMEM14A (transmembrane protein 14A [Source:HGNC Symbol;Acc:HGNC:21076])

HSP 1 Score: 68.9366 bits (167), Expect = 1.154e-14
Identity = 31/87 (35.63%), Postives = 58/87 (66.67%), Query Frame = 2
Query:   20 MDIVGLTYSGVIFTGGAIGYFKAGSTHSLVSGLIFGLAAFYGSHKMGQNPKNVHVLLITSAVLGMLMGQRFYKNPKVFPSGVLTTLS 280
            +D +G  Y+ ++  GG +GY + GS  SL +GL FGL A YG++++  +P++V + LI +  L ++MG R+ ++ K+ P+G++  +S
Sbjct:    3 IDWIGFGYAALLAVGGYMGYSRKGSIVSLAAGLTFGLLAGYGAYRVSYDPRDVKISLIAAFTLAIVMGLRYNRSRKIMPAGLVAGIS 89          
BLAST of Transmembrane protein 14C-like protein vs. Ensembl Xenopus
Match: panx1 (pannexin 1 [Source:Xenbase;Acc:XB-GENE-993672])

HSP 1 Score: 67.781 bits (164), Expect = 5.496e-14
Identity = 35/84 (41.67%), Postives = 53/84 (63.10%), Query Frame = 2
Query:   20 MDIVGLTYSGVIFTGGAIGYFKAGSTHSLVSGLIFGLAAFYGSHKMGQNPKNVHVLLITSAVLGMLMGQRFYKNPKVFPSGVLT 271
            +D  G  Y+ ++ +GG +GY KAGS  SL +GL+FG  A  G+++M  + KNV + LI S  L  +MG RFY + K  P+G++ 
Sbjct:   18 VDWFGFGYAALVASGGIMGYVKAGSVPSLAAGLLFGSLAGLGAYQMSNDSKNVLLSLIASGTLAGVMGFRFYNSGKFMPAGIIA 101          
BLAST of Transmembrane protein 14C-like protein vs. Ensembl Mouse
Match: Tmem14c (transmembrane protein 14C [Source:MGI Symbol;Acc:MGI:1913404])

HSP 1 Score: 80.8777 bits (198), Expect = 3.563e-19
Identity = 43/95 (45.26%), Postives = 61/95 (64.21%), Query Frame = 2
Query:   32 GLTYSGVIFTGGAIGYFKAGSTHSLVSGLIFGLAAFYGSHKMGQNPKNVHVLLITSAVLGMLMGQRFYKNPKVFPSGVLTTLSALVAARCGLRLL 316
            G  Y+ ++ TGG IGY KAGS  SL +GL FG  A  G++++ Q+P+NV V L TS  L  +MG RFY + K  P+G++   S L+ A+ G+ LL
Sbjct:   15 GFGYAALVATGGIIGYAKAGSVPSLAAGLFFGGLAGLGAYQLSQDPRNVWVFLATSGTLAGIMGMRFYNSGKFMPAGLIAGASLLMVAKVGISLL 109          
BLAST of Transmembrane protein 14C-like protein vs. Ensembl Mouse
Match: Tmem14a (transmembrane protein 14A [Source:MGI Symbol;Acc:MGI:1922962])

HSP 1 Score: 66.2402 bits (160), Expect = 8.885e-14
Identity = 32/87 (36.78%), Postives = 55/87 (63.22%), Query Frame = 2
Query:   20 MDIVGLTYSGVIFTGGAIGYFKAGSTHSLVSGLIFGLAAFYGSHKMGQNPKNVHVLLITSAVLGMLMGQRFYKNPKVFPSGVLTTLS 280
            MD++G  Y+ ++  G  +GY + G   SL++GL  GL A YG++++  + ++V V L T+  L  +MG RF ++ KV P+G++  LS
Sbjct:    1 MDLIGFGYAALVTIGSVLGYKRRGGVPSLIAGLSVGLLAGYGAYRVSNDRRDVKVSLFTAFFLATIMGVRFKRSKKVMPAGLVAGLS 87          
BLAST of Transmembrane protein 14C-like protein vs. Ensembl Mouse
Match: Tmem14a (transmembrane protein 14A [Source:MGI Symbol;Acc:MGI:1922962])

HSP 1 Score: 63.929 bits (154), Expect = 1.501e-12
Identity = 31/86 (36.05%), Postives = 54/86 (62.79%), Query Frame = 2
Query:   20 MDIVGLTYSGVIFTGGAIGYFKAGSTHSLVSGLIFGLAAFYGSHKMGQNPKNVHVLLITSAVLGMLMGQRFYKNPKVFPSGVLTTL 277
            MD++G  Y+ ++  G  +GY + G   SL++GL  GL A YG++++  + ++V V L T+  L  +MG RF ++ KV P+G++  L
Sbjct:    1 MDLIGFGYAALVTIGSVLGYKRRGGVPSLIAGLSVGLLAGYGAYRVSNDRRDVKVSLFTAFFLATIMGVRFKRSKKVMPAGLVAGL 86          
BLAST of Transmembrane protein 14C-like protein vs. UniProt/SwissProt
Match: sp|Q0P436|TM14C_DANRE (Transmembrane protein 14C OS=Danio rerio OX=7955 GN=tmem14c PE=3 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 1.606e-18
Identity = 40/99 (40.40%), Postives = 63/99 (63.64%), Query Frame = 2
Query:   20 MDIVGLTYSGVIFTGGAIGYFKAGSTHSLVSGLIFGLAAFYGSHKMGQNPKNVHVLLITSAVLGMLMGQRFYKNPKVFPSGVLTTLSALVAARCGLRLL 316
            +D  G  Y+ ++ +GG IGY KAGS  SL +GL+FG  A +G+++  Q+P N+ V L  S  L  +MG+RFY + K+ P+G++   S L+ A+ G  +L
Sbjct:    3 VDWAGYGYAALVASGGVIGYVKAGSVPSLAAGLVFGGLAGFGAYQTSQDPGNIWVSLAASGTLAAIMGKRFYNSRKITPAGLIAGASVLMLAKLGAGML 101          
BLAST of Transmembrane protein 14C-like protein vs. UniProt/SwissProt
Match: sp|Q9CQN6|TM14C_MOUSE (Transmembrane protein 14C OS=Mus musculus OX=10090 GN=Tmem14c PE=1 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 2.492e-18
Identity = 43/95 (45.26%), Postives = 61/95 (64.21%), Query Frame = 2
Query:   32 GLTYSGVIFTGGAIGYFKAGSTHSLVSGLIFGLAAFYGSHKMGQNPKNVHVLLITSAVLGMLMGQRFYKNPKVFPSGVLTTLSALVAARCGLRLL 316
            G  Y+ ++ TGG IGY KAGS  SL +GL FG  A  G++++ Q+P+NV V L TS  L  +MG RFY + K  P+G++   S L+ A+ G+ LL
Sbjct:   15 GFGYAALVATGGIIGYAKAGSVPSLAAGLFFGGLAGLGAYQLSQDPRNVWVFLATSGTLAGIMGMRFYNSGKFMPAGLIAGASLLMVAKVGISLL 109          
BLAST of Transmembrane protein 14C-like protein vs. UniProt/SwissProt
Match: sp|Q5R751|TM14C_PONAB (Transmembrane protein 14C OS=Pongo abelii OX=9601 GN=TMEM14C PE=3 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 1.648e-17
Identity = 40/95 (42.11%), Postives = 61/95 (64.21%), Query Frame = 2
Query:   32 GLTYSGVIFTGGAIGYFKAGSTHSLVSGLIFGLAAFYGSHKMGQNPKNVHVLLITSAVLGMLMGQRFYKNPKVFPSGVLTTLSALVAARCGLRLL 316
            G  Y+ ++ +GG IGY KAGS  SL +GL+FG  A  G++++ Q+P+NV V L TS  L  +MG RFY + K  P+G++   S L+ A+ G+ + 
Sbjct:   14 GFGYAALVASGGIIGYAKAGSVPSLAAGLLFGSLASLGAYQLSQDPRNVWVFLATSGTLAGIMGMRFYHSGKFMPAGLIAGASLLMVAKVGVSMF 108          
BLAST of Transmembrane protein 14C-like protein vs. UniProt/SwissProt
Match: sp|Q9P0S9|TM14C_HUMAN (Transmembrane protein 14C OS=Homo sapiens OX=9606 GN=TMEM14C PE=1 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 1.719e-17
Identity = 40/95 (42.11%), Postives = 61/95 (64.21%), Query Frame = 2
Query:   32 GLTYSGVIFTGGAIGYFKAGSTHSLVSGLIFGLAAFYGSHKMGQNPKNVHVLLITSAVLGMLMGQRFYKNPKVFPSGVLTTLSALVAARCGLRLL 316
            G  Y+ ++ +GG IGY KAGS  SL +GL+FG  A  G++++ Q+P+NV V L TS  L  +MG RFY + K  P+G++   S L+ A+ G+ + 
Sbjct:   14 GFGYAALVASGGIIGYVKAGSVPSLAAGLLFGSLAGLGAYQLSQDPRNVWVFLATSGTLAGIMGMRFYHSGKFMPAGLIAGASLLMVAKVGVSMF 108          
BLAST of Transmembrane protein 14C-like protein vs. UniProt/SwissProt
Match: sp|Q924P2|TM14C_RAT (Transmembrane protein 14C OS=Rattus norvegicus OX=10116 GN=Tmem14c PE=3 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 4.453e-16
Identity = 41/100 (41.00%), Postives = 61/100 (61.00%), Query Frame = 2
Query:   32 GLTYSGVIFTGGAIGYFKAGSTHSLVSGLIFGLAAFYGSHKMGQNPKNVHVLLITSAVLGMLMGQRFYKNPKVFPSGVLTTLSALVAARCGLRLLGVNTI 331
            G  Y+ ++ TGG IGY KAGS  SL +GL FG  A  G++++ Q+P+NV V L TS  L  +MG RFY + K  P+G++   S L+ A    ++  + T+
Sbjct:   15 GFGYAALVATGGIIGYAKAGSVPSLAAGLFFGGLAGLGAYQLSQDPRNVWVFLATSGTLAGIMGMRFYNSGKFMPAGLIAGASLLMVAPGVAKIQEITTM 114          
BLAST of Transmembrane protein 14C-like protein vs. TrEMBL
Match: E3TFB5 (Transmembrane protein 14C OS=Ictalurus punctatus OX=7998 GN=TM14C PE=2 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 7.210e-20
Identity = 45/99 (45.45%), Postives = 67/99 (67.68%), Query Frame = 2
Query:   20 MDIVGLTYSGVIFTGGAIGYFKAGSTHSLVSGLIFGLAAFYGSHKMGQNPKNVHVLLITSAVLGMLMGQRFYKNPKVFPSGVLTTLSALVAARCGLRLL 316
            +D  G  Y+ ++ +GG +GY KAGS  SL +GL+FG  A +G+H++ QNP+N+ V L TS  L  LMG+RFY + K+ P+GV+   S L+ A+ G+ LL
Sbjct:    3 VDWAGYGYAALVTSGGVMGYVKAGSVPSLAAGLLFGGLAGFGAHQISQNPQNIWVSLATSGTLAALMGKRFYNSRKIIPAGVVAGASILMLAKLGIGLL 101          
BLAST of Transmembrane protein 14C-like protein vs. TrEMBL
Match: A0A1X0S3K3 (Putative transmembrane protein 14C OS=Rhizopus microsporus OX=58291 GN=BCV71DRAFT_290582 PE=4 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 8.178e-20
Identity = 45/97 (46.39%), Postives = 65/97 (67.01%), Query Frame = 2
Query:   23 DIVGLTYSGVIFTGGAIGYFKAGSTHSLVSGLIFGLAAFYGSHKMGQNPKNVHVLLITSAVLGMLMGQRFYKNPKVFPSGVLTTLSALVAARCGLRL 313
            DI+G  Y   +F GG +GY KAGST SL++G IFG  A  G++++ Q+P+NV + LI S +L ++MG RFYK  K  P+G++T LS L+  R   +L
Sbjct:    3 DIIGYAYGATVFAGGLVGYLKAGSTASLLAGAIFGALAALGAYQVSQDPRNVTLALIVSLLLFIVMGSRFYKGRKFMPAGLVTLLSILMVIRYASKL 99          
BLAST of Transmembrane protein 14C-like protein vs. TrEMBL
Match: A0A367JVK7 (Transmembrane protein 14C OS=Rhizopus azygosporus OX=86630 GN=TMEM14C_2 PE=4 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 8.178e-20
Identity = 45/97 (46.39%), Postives = 65/97 (67.01%), Query Frame = 2
Query:   23 DIVGLTYSGVIFTGGAIGYFKAGSTHSLVSGLIFGLAAFYGSHKMGQNPKNVHVLLITSAVLGMLMGQRFYKNPKVFPSGVLTTLSALVAARCGLRL 313
            DI+G  Y   +F GG +GY KAGST SL++G IFG  A  G++++ Q+P+NV + LI S +L ++MG RFYK  K  P+G++T LS L+  R   +L
Sbjct:    3 DIIGYAYGATVFAGGLVGYLKAGSTASLLAGAIFGALAALGAYQVSQDPRNVTLALIVSLLLFIVMGSRFYKGRKFMPAGLVTLLSILMVIRYASKL 99          
BLAST of Transmembrane protein 14C-like protein vs. TrEMBL
Match: A0A0C7CH91 (Uncharacterized protein OS=Rhizopus microsporus OX=58291 GN=RMATCC62417_16682 PE=4 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 1.012e-19
Identity = 44/92 (47.83%), Postives = 63/92 (68.48%), Query Frame = 2
Query:   23 DIVGLTYSGVIFTGGAIGYFKAGSTHSLVSGLIFGLAAFYGSHKMGQNPKNVHVLLITSAVLGMLMGQRFYKNPKVFPSGVLTTLSALVAAR 298
            DI+G  Y   +F GG +GY KAGST SL++G +FG  A  G++++ Q+PKNV + LI S +L ++MG RFYK  K  P+G++T LS L+  R
Sbjct:    3 DIIGYAYGATVFAGGLVGYLKAGSTASLLAGAVFGALAALGAYQVSQDPKNVTLALIVSLLLFIVMGSRFYKGRKFMPAGLVTLLSILMVIR 94          
BLAST of Transmembrane protein 14C-like protein vs. TrEMBL
Match: A0A4W4G6T2 (Uncharacterized protein OS=Electrophorus electricus OX=8005 GN=LOC113579575 PE=4 SV=1)

HSP 1 Score: 90.1225 bits (222), Expect = 1.442e-19
Identity = 43/99 (43.43%), Postives = 70/99 (70.71%), Query Frame = 2
Query:   20 MDIVGLTYSGVIFTGGAIGYFKAGSTHSLVSGLIFGLAAFYGSHKMGQNPKNVHVLLITSAVLGMLMGQRFYKNPKVFPSGVLTTLSALVAARCGLRLL 316
            +D VG  Y+ ++ +GG +GY KAGS  SL +GL+FG  A +G++++ Q+P+N+ V L+TS  LG +MG+RFY + K+ P+GV+   S L+ A+ G+ +L
Sbjct:    3 VDWVGYGYAALVASGGVMGYVKAGSVPSLAAGLLFGGLAGFGAYQVSQDPQNIWVSLVTSGTLGAIMGKRFYSSRKIMPAGVVAGASILMLAKLGIGVL 101          
BLAST of Transmembrane protein 14C-like protein vs. Ensembl Cavefish
Match: tmem14ca (transmembrane protein 14C [Source:NCBI gene;Acc:103026272])

HSP 1 Score: 83.9593 bits (206), Expect = 1.346e-20
Identity = 40/99 (40.40%), Postives = 65/99 (65.66%), Query Frame = 2
Query:   20 MDIVGLTYSGVIFTGGAIGYFKAGSTHSLVSGLIFGLAAFYGSHKMGQNPKNVHVLLITSAVLGMLMGQRFYKNPKVFPSGVLTTLSALVAARCGLRLL 316
            +D  G  Y+ ++ +GG +GY KAGS  SL +GL+FG  A +G++++ Q+PKN+ V L TS  L  +MG+RFY + K+ P+G++   S L+  + G+  L
Sbjct:    3 VDWAGYGYAALVASGGVMGYVKAGSVPSLAAGLLFGGLAGFGAYQISQDPKNIWVSLATSGTLAAIMGKRFYNSRKIMPAGIVAGASILMLTKIGIGFL 101          
BLAST of Transmembrane protein 14C-like protein vs. Ensembl Cavefish
Match: tmem14ca (transmembrane protein 14C [Source:NCBI gene;Acc:103026272])

HSP 1 Score: 83.9593 bits (206), Expect = 2.604e-20
Identity = 40/99 (40.40%), Postives = 65/99 (65.66%), Query Frame = 2
Query:   20 MDIVGLTYSGVIFTGGAIGYFKAGSTHSLVSGLIFGLAAFYGSHKMGQNPKNVHVLLITSAVLGMLMGQRFYKNPKVFPSGVLTTLSALVAARCGLRLL 316
            +D  G  Y+ ++ +GG +GY KAGS  SL +GL+FG  A +G++++ Q+PKN+ V L TS  L  +MG+RFY + K+ P+G++   S L+  + G+  L
Sbjct:   21 VDWAGYGYAALVASGGVMGYVKAGSVPSLAAGLLFGGLAGFGAYQISQDPKNIWVSLATSGTLAAIMGKRFYNSRKIMPAGIVAGASILMLTKIGIGFL 119          
BLAST of Transmembrane protein 14C-like protein vs. Ensembl Cavefish
Match: ENSAMXT00000057741.1 (transmembrane protein 14C-like [Source:NCBI gene;Acc:103036406])

HSP 1 Score: 78.5666 bits (192), Expect = 2.036e-18
Identity = 40/95 (42.11%), Postives = 59/95 (62.11%), Query Frame = 2
Query:   23 DIVGLTYSGVIFTGGAIGYFKAGSTHSLVSGLIFGLAAFYGSHKMGQNPKNVHVLLITSAVLGMLMGQRFYKNPKVFPSGVLTTLSALVAARCGL 307
            D +G  Y+ ++  GGAIGY   GS  SL++GL+FG+ A  GS ++ QNP+NV + L T   L ++MG RF  + KV P+G++T  S  +  R  L
Sbjct:    4 DWLGYGYAALVALGGAIGYINTGSMMSLIAGLVFGVLAAIGSRQISQNPRNVWLSLGTYGTLAVVMGVRFLNSWKVMPAGIMTGTSLFMFVRAAL 98          
BLAST of Transmembrane protein 14C-like protein vs. Ensembl Cavefish
Match: zgc:163080 (transmembrane protein 14A [Source:NCBI gene;Acc:103034536])

HSP 1 Score: 65.0846 bits (157), Expect = 1.871e-13
Identity = 38/92 (41.30%), Postives = 57/92 (61.96%), Query Frame = 2
Query:   23 DIVGLTYSGVIFTGGAIGYFKAGSTHSLVSGLIFGLAAFYGSHKMGQNPKNVHVLLITSAVLGMLMGQRFYKNPKVFPSGVLTTLSALVAAR 298
            D +G  Y+  I  GG +GY K GS  SL++GL FG  + YG+ K+  +P ++   L  SA L ++MG RF K+ K+ P+G++T LS L+  R
Sbjct:    4 DWLGFGYAAAIIFGGFLGYKKKGSLMSLIAGLFFGGISAYGAFKVSVDPGDIWTSLAASAALAVVMGMRFKKSGKIMPAGIMTGLSLLMVVR 95          
BLAST of Transmembrane protein 14C-like protein vs. Ensembl Sea Lamprey
Match: zgc:163080 (zgc:163080 [Source:ZFIN;Acc:ZDB-GENE-070410-137])

HSP 1 Score: 66.2402 bits (160), Expect = 1.807e-14
Identity = 42/99 (42.42%), Postives = 63/99 (63.64%), Query Frame = 2
Query:   20 MDIVGLTYSGVIFTGGAIGYFKAGSTHSLVSGLIFGLAAFYGSHKMGQNPKNVHVLLITSAVLGMLMGQRFYKNPKVFPSGVLTTLSALVAARCGLRLL 316
            +D  G  +  ++  GG +GY + GS  SL+SGLIFGL   +G+ ++  +P N+ + L+ S VLG++MG RF K+ KV P+G++  LS L   R  LRLL
Sbjct:   10 IDWYGFGFGSLVIAGGVLGYKRKGSFPSLISGLIFGLLLEFGAFQLSFDPNNILLSLVVSVVLGLVMGIRFQKSGKVMPAGLVALLSILNLGRLVLRLL 108          
BLAST of Transmembrane protein 14C-like protein vs. Ensembl Nematostella
Match: EDO47575 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMC0])

HSP 1 Score: 79.337 bits (194), Expect = 2.668e-19
Identity = 43/98 (43.88%), Postives = 63/98 (64.29%), Query Frame = 2
Query:   23 DIVGLTYSGVIFTGGAIGYFKAGSTHSLVSGLIFGLAAFYGSHKMGQNPKNVHVLLITSAVLGMLMGQRFYKNPKVFPSGVLTTLSALVAARCGLRLL 316
            D +   ++ ++  GG IGY KAGST SL  GL FG  A +G+ +  +NPKNV+VLL++S +L  +MG R  K  K  P+G++ ++SA  A R G RL+
Sbjct:    5 DYLSYGFAAIVALGGVIGYAKAGSTVSLAMGLGFGGIAAFGASQTSKNPKNVYVLLVSSMILAGVMGSRAIKAGKFMPAGLVASVSAAEALRMGYRLI 102          
BLAST of Transmembrane protein 14C-like protein vs. Ensembl Medaka
Match: tmem14ca (transmembrane protein 14C [Source:NCBI gene;Acc:101162485])

HSP 1 Score: 78.5666 bits (192), Expect = 5.044e-18
Identity = 42/99 (42.42%), Postives = 63/99 (63.64%), Query Frame = 2
Query:   20 MDIVGLTYSGVIFTGGAIGYFKAGSTHSLVSGLIFGLAAFYGSHKMGQNPKNVHVLLITSAVLGMLMGQRFYKNPKVFPSGVLTTLSALVAARCGLRLL 316
            +D VG  Y+ ++ +GG IGY KAGS  SL +GL+FG  A +G++++  +P NV V L TS  L  +MG+RFY + K  P+G++   S L+  +  L LL
Sbjct:   46 VDWVGYGYATLVASGGVIGYVKAGSVPSLAAGLLFGGLAGFGAYQISNDPNNVWVSLATSGALTAVMGKRFYGSRKFMPAGLMAGASLLMVGKLSLALL 144          
BLAST of Transmembrane protein 14C-like protein vs. Ensembl Medaka
Match: zgc:163080 (transmembrane protein 14A [Source:NCBI gene;Acc:101174126])

HSP 1 Score: 76.6406 bits (187), Expect = 8.664e-18
Identity = 34/87 (39.08%), Postives = 58/87 (66.67%), Query Frame = 2
Query:   20 MDIVGLTYSGVIFTGGAIGYFKAGSTHSLVSGLIFGLAAFYGSHKMGQNPKNVHVLLITSAVLGMLMGQRFYKNPKVFPSGVLTTLS 280
            MD +G +Y+  I  GG +GY + GS  S+++GL+FG  + YG++ +  NPK+  V L++S  L  +MG R+ K+ K+ P+G+++ LS
Sbjct:    1 MDWIGFSYAATIILGGYMGYKRKGSVMSMMAGLVFGAFSAYGAYNISNNPKDFQVSLLSSGALAAVMGMRYKKSGKLMPAGIMSGLS 87          
BLAST of Transmembrane protein 14C-like protein vs. Ensembl Medaka
Match: ENSORLT00000004616.2 (transmembrane protein 14C-like [Source:NCBI gene;Acc:101171110])

HSP 1 Score: 53.5286 bits (127), Expect = 4.321e-9
Identity = 37/90 (41.11%), Postives = 55/90 (61.11%), Query Frame = 2
Query:   20 MDIVGLTYSGVIFTGGAIGYFKAGSTHSLVSGLIFGLAAFYGSHKMGQNPKNVHVLLITSAVLGMLMGQRFYKNPKVFPSGVLTTLSALV 289
            +D  G  Y+ ++  GG +GY KAGS  SL +GL+FGL A  G+++  QNP+NV V    +  L ++MG RF  + K  P+G +T  S L+
Sbjct:    3 VDWTGFMYAALVSAGGVVGYLKAGSATSLAAGLLFGLLAALGAYRTSQNPRNVLVSFGAAGTLAVVMGLRFLSSGKFMPAGFMTLTSGLM 92          
BLAST of Transmembrane protein 14C-like protein vs. Planmine SMEST
Match: SMESG000007314.1 (SMESG000007314.1)

HSP 1 Score: 204.527 bits (519), Expect = 8.460e-68
Identity = 103/104 (99.04%), Postives = 103/104 (99.04%), Query Frame = 2
Query:   20 MDIVGLTYSGVIFTGGAIGYFKAGSTHSLVSGLIFGLAAFYGSHKMGQNPKNVHVLLITSAVLGMLMGQRFYKNPKVFPSGVLTTLSALVAARCGLRLLGVNTI 331
            MDIVGLTYSGVIFTGGAIGYFKAGSTHSLVSGLIFGLAA YGSHKMGQNPKNVHVLLITSAVLGMLMGQRFYKNPKVFPSGVLTTLSALVAARCGLRLLGVNTI
Sbjct:    1 MDIVGLTYSGVIFTGGAIGYFKAGSTHSLVSGLIFGLAALYGSHKMGQNPKNVHVLLITSAVLGMLMGQRFYKNPKVFPSGVLTTLSALVAARCGLRLLGVNTI 104          
The following BLAST results are available for this feature:
BLAST of Transmembrane protein 14C-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TMEM14C3.580e-1842.11transmembrane protein 14C [Source:HGNC Symbol;Acc:... [more]
TMEM14C3.580e-1842.11transmembrane protein 14C [Source:HGNC Symbol;Acc:... [more]
TMEM14C3.580e-1842.11transmembrane protein 14C [Source:HGNC Symbol;Acc:... [more]
TMEM14C3.580e-1842.11transmembrane protein 14C [Source:HGNC Symbol;Acc:... [more]
TMEM14B4.033e-1339.58transmembrane protein 14B [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of Transmembrane protein 14C-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transmembrane protein 14C-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CG55322.272e-1039.08gene:FBgn0034902 transcript:FBtr0072091[more]
CG55322.272e-1039.08gene:FBgn0034902 transcript:FBtr0345535[more]
back to top
BLAST of Transmembrane protein 14C-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tmem14cb2.670e-2045.45transmembrane protein 14Cb [Source:ZFIN;Acc:ZDB-GE... [more]
tmem14ca1.036e-1940.40transmembrane protein 14Ca [Source:NCBI gene;Acc:7... [more]
zgc:1630804.270e-1637.63zgc:163080 [Source:ZFIN;Acc:ZDB-GENE-070410-137][more]
zgc:1630804.270e-1637.63zgc:163080 [Source:ZFIN;Acc:ZDB-GENE-070410-137][more]
zgc:1630804.270e-1637.63zgc:163080 [Source:ZFIN;Acc:ZDB-GENE-070410-137][more]
back to top
BLAST of Transmembrane protein 14C-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
panx11.603e-1740.82pannexin 1 [Source:Xenbase;Acc:XB-GENE-993672][more]
TMEM14A1.154e-1435.63transmembrane protein 14A [Source:HGNC Symbol;Acc:... [more]
panx15.496e-1441.67pannexin 1 [Source:Xenbase;Acc:XB-GENE-993672][more]
back to top
BLAST of Transmembrane protein 14C-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Tmem14c3.563e-1945.26transmembrane protein 14C [Source:MGI Symbol;Acc:M... [more]
Tmem14a8.885e-1436.78transmembrane protein 14A [Source:MGI Symbol;Acc:M... [more]
Tmem14a1.501e-1236.05transmembrane protein 14A [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of Transmembrane protein 14C-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q0P436|TM14C_DANRE1.606e-1840.40Transmembrane protein 14C OS=Danio rerio OX=7955 G... [more]
sp|Q9CQN6|TM14C_MOUSE2.492e-1845.26Transmembrane protein 14C OS=Mus musculus OX=10090... [more]
sp|Q5R751|TM14C_PONAB1.648e-1742.11Transmembrane protein 14C OS=Pongo abelii OX=9601 ... [more]
sp|Q9P0S9|TM14C_HUMAN1.719e-1742.11Transmembrane protein 14C OS=Homo sapiens OX=9606 ... [more]
sp|Q924P2|TM14C_RAT4.453e-1641.00Transmembrane protein 14C OS=Rattus norvegicus OX=... [more]
back to top
BLAST of Transmembrane protein 14C-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
E3TFB57.210e-2045.45Transmembrane protein 14C OS=Ictalurus punctatus O... [more]
A0A1X0S3K38.178e-2046.39Putative transmembrane protein 14C OS=Rhizopus mic... [more]
A0A367JVK78.178e-2046.39Transmembrane protein 14C OS=Rhizopus azygosporus ... [more]
A0A0C7CH911.012e-1947.83Uncharacterized protein OS=Rhizopus microsporus OX... [more]
A0A4W4G6T21.442e-1943.43Uncharacterized protein OS=Electrophorus electricu... [more]
back to top
BLAST of Transmembrane protein 14C-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
tmem14ca1.346e-2040.40transmembrane protein 14C [Source:NCBI gene;Acc:10... [more]
tmem14ca2.604e-2040.40transmembrane protein 14C [Source:NCBI gene;Acc:10... [more]
ENSAMXT00000057741.12.036e-1842.11transmembrane protein 14C-like [Source:NCBI gene;A... [more]
zgc:1630801.871e-1341.30transmembrane protein 14A [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Transmembrane protein 14C-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
zgc:1630801.807e-1442.42zgc:163080 [Source:ZFIN;Acc:ZDB-GENE-070410-137][more]
back to top
BLAST of Transmembrane protein 14C-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transmembrane protein 14C-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO475752.668e-1943.88Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Transmembrane protein 14C-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
tmem14ca5.044e-1842.42transmembrane protein 14C [Source:NCBI gene;Acc:10... [more]
zgc:1630808.664e-1839.08transmembrane protein 14A [Source:NCBI gene;Acc:10... [more]
ENSORLT00000004616.24.321e-941.11transmembrane protein 14C-like [Source:NCBI gene;A... [more]
back to top
BLAST of Transmembrane protein 14C-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000007314.18.460e-6899.04SMESG000007314.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027955 ID=SMED30027955|Name=Transmembrane protein 14C-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=703bp
TTTTTAAAAAAGTGGGAAAATGGATATTGTTGGGTTAACATATTCTGGAG
TTATATTTACTGGAGGAGCAATAGGATATTTTAAAGCCGGTAGTACGCAT
TCCCTTGTGTCAGGTTTGATTTTTGGACTGGCTGCTTTTTATGGTTCCCA
TAAAATGGGTCAAAATCCTAAAAATGTTCATGTTTTATTGATAACATCAG
CAGTACTTGGGATGCTTATGGGGCAACGATTTTATAAAAATCCTAAAGTG
TTTCCATCCGGAGTGCTAACAACATTAAGTGCACTGGTAGCAGCGAGATG
TGGATTACGTCTACTAGGAGTGAACACAATATAAACTACATTTTTTAACC
AATTTTCGTAAATTTTTTAGTAAAAAAGGACTTTTATAGTTTTTTATTTA
AATTAATATTGGGAATTTCATTTTAAACGTTTTCTGGTTGGATAAACATT
TCGATTTTTTGAATATTTCGTTATCTAATATAATCAAAAACCTAAATTGG
CTTATTTTATTCATATTGAAGGATTTAATATTATTTCATATATTGGCCTA
CTCCATTTAGTTATAAATTAGTGCCGCACGCAAAATCAAATCTTCATTAG
AGCTGCTTAATGCGATATGTGTCACCCTTTATGTTAAGAATGCTGTAAAT
GTTACGGAAATGTAGTGTAATGTGTATAAAATGCAATGGTTTATTAAATT
CGG
back to top

protein sequence of SMED30027955-orf-1

>SMED30027955-orf-1 ID=SMED30027955-orf-1|Name=SMED30027955-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=105bp
MDIVGLTYSGVIFTGGAIGYFKAGSTHSLVSGLIFGLAAFYGSHKMGQNP
KNVHVLLITSAVLGMLMGQRFYKNPKVFPSGVLTTLSALVAARCGLRLLG
VNTI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000099neuron
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR005349TMEM14
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR005349TMEM14 familyPFAMPF03647Tmemb_14coord: 4..92
e-value: 2.4E-23
score: 82.7
IPR005349TMEM14 familyPANTHERPTHR12668TRANSMEMBRANE PROTEIN 14, 15coord: 1..100
NoneNo IPR availableGENE3DG3DSA:1.20.58.1140coord: 1..102
e-value: 1.2E-30
score: 107.6
NoneNo IPR availablePANTHERPTHR12668:SF42TRANSMEMBRANE PROTEIN 14C-RELATEDcoord: 1..100
NoneNo IPR availableTMHMMTMhelixcoord: 82..101
NoneNo IPR availableTMHMMTMhelixcoord: 53..72
NoneNo IPR availableTMHMMTMhelixcoord: 10..41