Major facilitator superfamily domain containing protein

Overview
NameMajor facilitator superfamily domain containing protein
Smed IDSMED30027945
Length (bp)2375
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Major facilitator superfamily domain containing protein (SMED30027945) t-SNE clustered cells

Violin plots show distribution of expression levels for Major facilitator superfamily domain containing protein (SMED30027945) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Major facilitator superfamily domain containing protein (SMED30027945) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Major facilitator superfamily domain containing protein (SMED30027945) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of Major facilitator superfamily domain containing protein vs. Ensembl Human
Match: MFSD6 (major facilitator superfamily domain containing 6 [Source:HGNC Symbol;Acc:HGNC:24711])

HSP 1 Score: 332.798 bits (852), Expect = 1.821e-101
Identity = 228/625 (36.48%), Postives = 345/625 (55.20%), Query Frame = 2
Query:  224 PTSKRDVLDMLLTHVNRTLLVFKLXXXXXXXXXGSLFPLISVYFKQLGLSATQCGILVGCRPFVEFISAPFWGVIAERWXXXXXXXXXXXXXXXXFTVGIGFTRPIPEGCLLKGKFPNETIIKEPGDYGNQPQLLVSD----------PKILYPKLMGQSPIRLVDQ-----------------------NILMELNAESGNFVIPVYSP------------------------IVYTTENIYQTFVILLVLLILGEFMSSPSLALADTAVLNYLKEDRENYGRQRLYGSVGWGLAMFCIGISLDQA---IKFHNHPCGWPGEREKNYVICFTIFSVFMCFSLITATQMTFTYDDQSENMYFKVVKDKVSQTILGGKTKNRQHLINEPDDSEINRRKDDEILEQQLSIKLDKTNYQSKSEDPYEDNYQINNFDLNVWVGALKTFKSIRLISLLFLAWFMGFGVGIVFTFLFWHLQDIKGSPTLFGIASVINHISEILAYFFSGKLIASIGHTKVLYLGLLGNVVRFLYVSWIQNSWWILPFEMIQGLTHAAVWSACYSYMAQTTPKEYRNASQRILQGIHHGLGKXXXXXXXXXXXXXXXTPVLFRAYGIMCCFVLIGFLTINYF 1918
            P  + D ++     +N  LL+ K++YFF+++A+GSL+PL+ VY+KQLG+S +Q G+LVG R F+EF SAPFWGV+A+R+KKGK+++L SL+C +LF +GIGF +P    C+     P       P +  +Q  +L ++          PK+   + + ++ + + D                        N +M+L   S     PV SP                        +VY  + +   F+++LV++I+GEF S+ S+ + DT  L YL + R+ YG QR++GS+GWGLAM  +GI +D     +      C  P  R  NY I F +F V M  +LI ATQ  F Y+                            H  N  DDS   + K+ EI +      +++ N    SE+          F  N W   +K   S++  S+LF+AWFMGFG G VFTFL+WHL+D+ G+ TLFG+ SV++H+SE+ AYFFS KLI  IGH +VLY+GL  N  R++Y+S+++N+W +LP E++QG+THAA+W+AC SY++   P E R ++Q ILQG+H GLG+GCG++ GG+++  FG    FR  G+ C  +L+ F  I + 
Sbjct:   50 PEEEIDWIEKHCVKINNDLLISKVFYFFFYSAYGSLYPLLPVYYKQLGMSPSQSGLLVGIRYFIEFCSAPFWGVVADRFKKGKIVLLFSLLCWVLFNLGIGFVKPATLRCV-----PKIRPTTHPTNASHQLTILPTNSSFTSFLTISPKMREKRNLLETRLNVSDTVTLPTAPNMNSEPTLQPQTGEITNRMMDLTLNSST-ATPV-SPGSVTKETTTVIVTTTKSLPSDQVMLVYDQQEVEAIFLVILVVVIIGEFFSASSVTIVDTVTLQYLGKHRDRYGLQRMWGSLGWGLAMLSVGIGIDYTHIEVLIDGKGCKPPEYR--NYQIVFIVFGVLMTMALIVATQFRFRYN----------------------------HFKN--DDS---KGKEVEIPQ------VERNNSTESSEETPTTTSHSQAF--NFW-DLIKLLCSVQYGSVLFVAWFMGFGYGFVFTFLYWHLEDLNGTTTLFGVCSVLSHVSELTAYFFSHKLIELIGHIRVLYIGLACNTARYIYISYLENAWTVLPMEVLQGVTHAAIWAACISYLSAAVPPELRTSAQGILQGLHLGLGRGCGAMIGGVLVNYFGAAATFRGIGMACLVILLLFALIQWL 623          
BLAST of Major facilitator superfamily domain containing protein vs. Ensembl Human
Match: MFSD6 (major facilitator superfamily domain containing 6 [Source:HGNC Symbol;Acc:HGNC:24711])

HSP 1 Score: 332.798 bits (852), Expect = 1.821e-101
Identity = 228/625 (36.48%), Postives = 345/625 (55.20%), Query Frame = 2
Query:  224 PTSKRDVLDMLLTHVNRTLLVFKLXXXXXXXXXGSLFPLISVYFKQLGLSATQCGILVGCRPFVEFISAPFWGVIAERWXXXXXXXXXXXXXXXXFTVGIGFTRPIPEGCLLKGKFPNETIIKEPGDYGNQPQLLVSD----------PKILYPKLMGQSPIRLVDQ-----------------------NILMELNAESGNFVIPVYSP------------------------IVYTTENIYQTFVILLVLLILGEFMSSPSLALADTAVLNYLKEDRENYGRQRLYGSVGWGLAMFCIGISLDQA---IKFHNHPCGWPGEREKNYVICFTIFSVFMCFSLITATQMTFTYDDQSENMYFKVVKDKVSQTILGGKTKNRQHLINEPDDSEINRRKDDEILEQQLSIKLDKTNYQSKSEDPYEDNYQINNFDLNVWVGALKTFKSIRLISLLFLAWFMGFGVGIVFTFLFWHLQDIKGSPTLFGIASVINHISEILAYFFSGKLIASIGHTKVLYLGLLGNVVRFLYVSWIQNSWWILPFEMIQGLTHAAVWSACYSYMAQTTPKEYRNASQRILQGIHHGLGKXXXXXXXXXXXXXXXTPVLFRAYGIMCCFVLIGFLTINYF 1918
            P  + D ++     +N  LL+ K++YFF+++A+GSL+PL+ VY+KQLG+S +Q G+LVG R F+EF SAPFWGV+A+R+KKGK+++L SL+C +LF +GIGF +P    C+     P       P +  +Q  +L ++          PK+   + + ++ + + D                        N +M+L   S     PV SP                        +VY  + +   F+++LV++I+GEF S+ S+ + DT  L YL + R+ YG QR++GS+GWGLAM  +GI +D     +      C  P  R  NY I F +F V M  +LI ATQ  F Y+                            H  N  DDS   + K+ EI +      +++ N    SE+          F  N W   +K   S++  S+LF+AWFMGFG G VFTFL+WHL+D+ G+ TLFG+ SV++H+SE+ AYFFS KLI  IGH +VLY+GL  N  R++Y+S+++N+W +LP E++QG+THAA+W+AC SY++   P E R ++Q ILQG+H GLG+GCG++ GG+++  FG    FR  G+ C  +L+ F  I + 
Sbjct:   50 PEEEIDWIEKHCVKINNDLLISKVFYFFFYSAYGSLYPLLPVYYKQLGMSPSQSGLLVGIRYFIEFCSAPFWGVVADRFKKGKIVLLFSLLCWVLFNLGIGFVKPATLRCV-----PKIRPTTHPTNASHQLTILPTNSSFTSFLTISPKMREKRNLLETRLNVSDTVTLPTAPNMNSEPTLQPQTGEITNRMMDLTLNSST-ATPV-SPGSVTKETTTVIVTTTKSLPSDQVMLVYDQQEVEAIFLVILVVVIIGEFFSASSVTIVDTVTLQYLGKHRDRYGLQRMWGSLGWGLAMLSVGIGIDYTHIEVLIDGKGCKPPEYR--NYQIVFIVFGVLMTMALIVATQFRFRYN----------------------------HFKN--DDS---KGKEVEIPQ------VERNNSTESSEETPTTTSHSQAF--NFW-DLIKLLCSVQYGSVLFVAWFMGFGYGFVFTFLYWHLEDLNGTTTLFGVCSVLSHVSELTAYFFSHKLIELIGHIRVLYIGLACNTARYIYISYLENAWTVLPMEVLQGVTHAAIWAACISYLSAAVPPELRTSAQGILQGLHLGLGRGCGAMIGGVLVNYFGAAATFRGIGMACLVILLLFALIQWL 623          
BLAST of Major facilitator superfamily domain containing protein vs. Ensembl Human
Match: MFSD6 (major facilitator superfamily domain containing 6 [Source:HGNC Symbol;Acc:HGNC:24711])

HSP 1 Score: 166.392 bits (420), Expect = 9.074e-46
Identity = 79/158 (50.00%), Postives = 118/158 (74.68%), Query Frame = 2
Query: 1445 TFLFWHLQDIKGSPTLFGIASVINHISEILAYFFSGKLIASIGHTKVLYLGLLGNVVRFLYVSWIQNSWWILPFEMIQGLTHAAVWSACYSYMAQTTPKEYRNASQRILQGIHHGLGKXXXXXXXXXXXXXXXTPVLFRAYGIMCCFVLIGFLTINYF 1918
            TFL+WHL+D+ G+ TLFG+ SV++H+SE+ AYFFS KLI  IGH +VLY+GL  N  R++Y+S+++N+W +LP E++QG+THAA+W+AC SY++   P E R ++Q ILQG+H GLG+GCG++ GG+++  FG    FR  G+ C  +L+ F  I + 
Sbjct:    2 TFLYWHLEDLNGTTTLFGVCSVLSHVSELTAYFFSHKLIELIGHIRVLYIGLACNTARYIYISYLENAWTVLPMEVLQGVTHAAIWAACISYLSAAVPPELRTSAQGILQGLHLGLGRGCGAMIGGVLVNYFGAAATFRGIGMACLVILLLFALIQWL 159          
BLAST of Major facilitator superfamily domain containing protein vs. Ensembl Human
Match: MFSD6 (major facilitator superfamily domain containing 6 [Source:HGNC Symbol;Acc:HGNC:24711])

HSP 1 Score: 85.5001 bits (210), Expect = 1.046e-18
Identity = 55/105 (52.38%), Postives = 83/105 (79.05%), Query Frame = 2
Query:  224 PTSKRDVLDMLLTHVNRTLLVFKLXXXXXXXXXGSLFPLISVYFKQLGLSATQCGILVGCRPFVEFISAPFWGVIAERWXXXXXXXXXXXXXXXXFTVGIGFTRP 538
            P  + D ++     +N  LL+ K++YFF+++A+GSL+PL+ VY+KQLG+S +Q G+LVG R F+EF SAPFWGV+A+R+KKGK+++L SL+C +LF +GIGF +P
Sbjct:   50 PEEEIDWIEKHCVKINNDLLISKVFYFFFYSAYGSLYPLLPVYYKQLGMSPSQSGLLVGIRYFIEFCSAPFWGVVADRFKKGKIVLLFSLLCWVLFNLGIGFVKP 154          
BLAST of Major facilitator superfamily domain containing protein vs. Ensembl Human
Match: MFSD6 (major facilitator superfamily domain containing 6 [Source:HGNC Symbol;Acc:HGNC:24711])

HSP 1 Score: 71.633 bits (174), Expect = 8.862e-14
Identity = 38/85 (44.71%), Postives = 58/85 (68.24%), Query Frame = 2
Query: 1664 FEMIQGLTHAAVWSACYSYMAQTTPKEYRNASQRILQGIHHGLGKXXXXXXXXXXXXXXXTPVLFRAYGIMCCFVLIGFLTINYF 1918
             E++QG+THAA+W+AC SY++   P E R ++Q ILQG+H GLG+GCG++ GG+++  FG    FR  G+ C  +L+ F  I + 
Sbjct:    1 MEVLQGVTHAAIWAACISYLSAAVPPELRTSAQGILQGLHLGLGRGCGAMIGGVLVNYFGAAATFRGIGMACLVILLLFALIQWL 85          
BLAST of Major facilitator superfamily domain containing protein vs. Ensembl Celegans
Match: mfsd-6 (Major Facilitator Superfamily Domain containing homolog [Source:UniProtKB/TrEMBL;Acc:Q95Y88])

HSP 1 Score: 271.166 bits (692), Expect = 1.746e-80
Identity = 222/678 (32.74%), Postives = 334/678 (49.26%), Query Frame = 2
Query:  215 MENPTSKRDVLDMLLTHVNRTLLVFKLXXXXXXXXXGSLFPLISVYFKQLGLSATQCGILVGCRPFVEFISAPFWGVIAERWXXXXXXXXXXXXXXXXFTVGIGFTRPIPEGCLLKGKFPNETI---------IKEPGDYGNQPQLLVS-DPKILYPKLMGQSPI--RLVD--------------------QNILMELNAES-GNFVIPVYSPIVYTTENIYQTFVILLVLLILGEFMSSPSLALADTAVLNYLKEDRENYGRQRLYGSVGWGLAMFCIGISLDQAIKFHNHPCGWPGEREKNYVICFTIFSVFMCFSLITATQMTFTYDDQSENMYFKVVKDKVSQTILGGKTKNRQHLINEPDDSEINRRKDDEILEQQLSIKLDKTNYQSKSEDPYEDNYQINNFDLNVWVGALKTFKSIRLISLLFLAWFMGFGVGIVFTFLFWHLQDIKGSPTLFGIASVINHISEILAYFFSGKLIASIGHTKVLYLGLLGNVVRFLYVSWIQNSWWILPFEMIQGLTHAAVWSACYSYMAQTTPKEYRNASQRILQGIHHGLGKXXXXXXXXXXXXXXXTPVLFRAYGIMCCFVLIGFLTINYFLAEISPTDPIKSVPNQSNFENSAPHEYYSGYDQPADSTTYVEEETFMSPHGIPFMPNNEYRNTENYNAIKGNSNQAA 2149
            MEN   +R V ++      R   + +L+Y  +FA+FGSLFPL++VYFKQLG++A Q G L+G RP VEF+S PFW   A R++K KLL+L SL   +LFT+GIG  +P+   C++     N+T          I   G  G   + LV    +    +   QSP+  +++D                    ++ +   N ++ G  V P +S  VY    + Q F++LL+L+ L EF S+P+L LAD A L+ ++++   +G+ RL  SVGWG AMF +GI+LD +  F NHPC      EKNY +CF +  +FM  ++  A++  F +DD            +V   ++  +     H++ E   + I + +     E  L +                               A+K   S+ ++        MG G G+VF+FL+WHLQDI GSP LFGI SV+NH SEI+ YF+  KLI   GH +V+YL L  N  RF+ +S + N W +LP +++QG   A VWS   SY++   P   +  +Q  LQ  +HG+GKG GSI GG +I   GT   F  YG++C     G   +N    ++   + IK      NFE                     E+   M+P G+P   + +  +  N   +  N+N  A
Sbjct:    1 MENHVGERTV-NIFGKVFPRDAFICRLFYLSFFASFGSLFPLLAVYFKQLGMTAAQAGFLIGSRPIVEFLSGPFWSQFASRFRKQKLLLLFSLGSLVLFTLGIGLVQPVTPYCIVYVPEGNKTCQTMLAPAGKIIRGGALGMLKETLVGGSTRPARQRRQTQSPLVEKIIDLSSFDSEEDTVAGIAPEYITRDRVCNYNEDNYGILVSPPHSTRVYRQPAVEQAFMLLLILICLCEFFSAPALPLADAATLHSVRDNPAEFGKIRLMASVGWGFAMFIMGIALDYSDTFRNHPCPAENTTEKNYTLCFVMCVIFMLAAMGLASK--FKFDDDVP------APGEVHGLVMDTREAEVSHVVAEKARARITQSEGGGGSENSLLL-------------------------------AMKALASMHILLFFVSVVVMGGGAGLVFSFLYWHLQDIGGSPVLFGILSVVNHASEIITYFYVFKLINKYGHVRVMYLCLAVNFFRFMALSILDNPWMVLPLQILQGACLATVWSCASSYISLVAPPHAKQHAQYALQVGYHGIGKGLGSIIGGSVISIIGTRTTFVIYGLICLATCAGSFGLN----KLFKYEGIKY--GAGNFEE--------------------EDMDIMAPQGVPMARDGKITDAFNATTVV-NANYGA 611          
BLAST of Major facilitator superfamily domain containing protein vs. Ensembl Fly
Match: jef (gene:FBgn0033958 transcript:FBtr0309056)

HSP 1 Score: 419.083 bits (1076), Expect = 5.867e-135
Identity = 278/653 (42.57%), Postives = 395/653 (60.49%), Query Frame = 2
Query:  239 DVLDMLL-THVNRTLLVFKLXXXXXXXXXGSLFPLISVYFKQLGLSATQCGILVGCRPFVEFISAPFWGVIAERWXXXXXXXXXXXXXXXXFTVGIGFTRPIPEGCLLKGKFPN--ETIIKEPGDY-------------GNQPQLLVS----------DPKILYPKL-MGQSPIRLVDQNILMELNAE-SGNFVIPVYSPIVYTTENIYQTFVILLVLLILGEFMSSPSLALADTAVLNYLKEDRENYGRQRLYGSVGWGLAMFCIGISLDQAIKFHNHPCGWPGEREKNYVICFTIFSVFMCFSLITATQMTFTYDDQSENMYFKVVKDKVSQTILGGKTKNRQ--HLINEPDDSEINRRKDDEILEQQLSIKLDKTNYQSKSEDPYEDN-YQINNFDLNVWVGALKTFKSIRLISLLFLAWFMGFGVGIVFTFLFWHLQDIKGSPTLFGIASVINHISEILAYFFSGKLIASIGHTKVLYLGLLGNVVRFLYVSWIQNSWWILPFEMIQGLTHAAVWSACYSYMAQTTPKEYRNASQRILQGIHHGLGKXXXXXXXXXXXXXXXTPVLFRAYGIMCCFVLIGFLTINY------FLAEISPTDPIKSVPNQSNFENS--APHEYYSGYDQPADSTTYVEEETFMSPHGIPF 2080
            D+L+M       R L+  K +YFF++AAFGSLFPL+ VYFKQ+G++  QCGILVG RPFVEF+SAPFWG  A+R ++GK L+L SL C +LFT+ + F RP    C+ +    +   T  +   D              G  P                  +L P++  G SP+ +   N +   + +   ++V P++S +VY T +I + F +LL+++++GEF S+P++ LAD+AV+  L ED + YG QR++GS+GWG++MF +GI+LD +  F NHPCG  G +EKNY ICF+IFSV M  ++I+A+++TF YD   E +  +     V       +    Q    +N P  +  +           +S  L  T +Q +     E   +     +L  W+  L  FK ++  S LF+AWFMGFG+G++FTFLFWHLQD  G+PTLFG+ASVINH+SEI AYFFS +LI  IGH KVL LGL+GNV+RFLY+S++ N W +LPFE++QG+THAAVW+A  SY+A  TPK  R ++Q +LQGIHHGLG+GCG+I GGM +  +GT   FR YGI C FVL  F+ +N+      F++EI    P+   P+Q   E S  APH   S     A S + + E   M+P+G P+
Sbjct:   99 DILEMFFGASTERELIPVKSFYFFFYAAFGSLFPLMGVYFKQMGMNPGQCGILVGMRPFVEFLSAPFWGSYADRCRQGKRLLLGSLACWVLFTIPLSFIRPEAINCIERRNATDFVLTYTRTKRDLSAMYEQEHLDMGTGTMPADEALEEAEAAHSRHKRSLLLPRIDAGISPVHI---NFVSNYDDKYHRDYVTPIFSSMVYRTPDIQKAFFLLLLVILIGEFFSAPAITLADSAVITLLGEDADKYGHQRMFGSLGWGISMFLVGIALDHSTSFSNHPCG-AGNKEKNYNICFSIFSVLMTCAIISASKITFKYDPIDEQLAAQQQAQFVDPNKRAEEESMNQLAAQLNLPSLAVGSGSAASGACAGGVSSFL-ATGHQPQPHIGAESKVFAQTAKELPEWMTVLTHFKDLKTASFLFVAWFMGFGIGLIFTFLFWHLQDYGGTPTLFGVASVINHVSEIFAYFFSFRLITQIGHVKVLCLGLIGNVLRFLYISYLTNPWMVLPFELMQGITHAAVWAASCSYIAHNTPKHLRASAQGVLQGIHHGLGRGCGAIIGGMFVTYYGTTTTFRWYGIACLFVLGFFIFVNFYRKEQGFISEI----PVTEDPHQVAEETSHLAPHGVPSNPIPRALSNSRLNE---MNPNGGPY 739          
BLAST of Major facilitator superfamily domain containing protein vs. Ensembl Fly
Match: jef (gene:FBgn0033958 transcript:FBtr0087476)

HSP 1 Score: 419.083 bits (1076), Expect = 5.867e-135
Identity = 278/653 (42.57%), Postives = 395/653 (60.49%), Query Frame = 2
Query:  239 DVLDMLL-THVNRTLLVFKLXXXXXXXXXGSLFPLISVYFKQLGLSATQCGILVGCRPFVEFISAPFWGVIAERWXXXXXXXXXXXXXXXXFTVGIGFTRPIPEGCLLKGKFPN--ETIIKEPGDY-------------GNQPQLLVS----------DPKILYPKL-MGQSPIRLVDQNILMELNAE-SGNFVIPVYSPIVYTTENIYQTFVILLVLLILGEFMSSPSLALADTAVLNYLKEDRENYGRQRLYGSVGWGLAMFCIGISLDQAIKFHNHPCGWPGEREKNYVICFTIFSVFMCFSLITATQMTFTYDDQSENMYFKVVKDKVSQTILGGKTKNRQ--HLINEPDDSEINRRKDDEILEQQLSIKLDKTNYQSKSEDPYEDN-YQINNFDLNVWVGALKTFKSIRLISLLFLAWFMGFGVGIVFTFLFWHLQDIKGSPTLFGIASVINHISEILAYFFSGKLIASIGHTKVLYLGLLGNVVRFLYVSWIQNSWWILPFEMIQGLTHAAVWSACYSYMAQTTPKEYRNASQRILQGIHHGLGKXXXXXXXXXXXXXXXTPVLFRAYGIMCCFVLIGFLTINY------FLAEISPTDPIKSVPNQSNFENS--APHEYYSGYDQPADSTTYVEEETFMSPHGIPF 2080
            D+L+M       R L+  K +YFF++AAFGSLFPL+ VYFKQ+G++  QCGILVG RPFVEF+SAPFWG  A+R ++GK L+L SL C +LFT+ + F RP    C+ +    +   T  +   D              G  P                  +L P++  G SP+ +   N +   + +   ++V P++S +VY T +I + F +LL+++++GEF S+P++ LAD+AV+  L ED + YG QR++GS+GWG++MF +GI+LD +  F NHPCG  G +EKNY ICF+IFSV M  ++I+A+++TF YD   E +  +     V       +    Q    +N P  +  +           +S  L  T +Q +     E   +     +L  W+  L  FK ++  S LF+AWFMGFG+G++FTFLFWHLQD  G+PTLFG+ASVINH+SEI AYFFS +LI  IGH KVL LGL+GNV+RFLY+S++ N W +LPFE++QG+THAAVW+A  SY+A  TPK  R ++Q +LQGIHHGLG+GCG+I GGM +  +GT   FR YGI C FVL  F+ +N+      F++EI    P+   P+Q   E S  APH   S     A S + + E   M+P+G P+
Sbjct:   99 DILEMFFGASTERELIPVKSFYFFFYAAFGSLFPLMGVYFKQMGMNPGQCGILVGMRPFVEFLSAPFWGSYADRCRQGKRLLLGSLACWVLFTIPLSFIRPEAINCIERRNATDFVLTYTRTKRDLSAMYEQEHLDMGTGTMPADEALEEAEAAHSRHKRSLLLPRIDAGISPVHI---NFVSNYDDKYHRDYVTPIFSSMVYRTPDIQKAFFLLLLVILIGEFFSAPAITLADSAVITLLGEDADKYGHQRMFGSLGWGISMFLVGIALDHSTSFSNHPCG-AGNKEKNYNICFSIFSVLMTCAIISASKITFKYDPIDEQLAAQQQAQFVDPNKRAEEESMNQLAAQLNLPSLAVGSGSAASGACAGGVSSFL-ATGHQPQPHIGAESKVFAQTAKELPEWMTVLTHFKDLKTASFLFVAWFMGFGIGLIFTFLFWHLQDYGGTPTLFGVASVINHVSEIFAYFFSFRLITQIGHVKVLCLGLIGNVLRFLYISYLTNPWMVLPFELMQGITHAAVWAASCSYIAHNTPKHLRASAQGVLQGIHHGLGRGCGAIIGGMFVTYYGTTTTFRWYGIACLFVLGFFIFVNFYRKEQGFISEI----PVTEDPHQVAEETSHLAPHGVPSNPIPRALSNSRLNE---MNPNGGPY 739          
BLAST of Major facilitator superfamily domain containing protein vs. Ensembl Fly
Match: Sugb (gene:FBgn0036191 transcript:FBtr0273362)

HSP 1 Score: 72.4034 bits (176), Expect = 8.534e-13
Identity = 55/201 (27.36%), Postives = 91/201 (45.27%), Query Frame = 2
Query: 1367 KTFKSIRLISLLFLAWFMGFGVGIVFTFLFWHLQDIKGS--------PTLFGIASVINHISEILAYFF-SGKLIASIGHTKVLYLGLLGNVVRFLYVSWIQNSWWILPFEMIQGLTHAAVWSACYSYMAQTTPKEYRNASQRILQGIHHGLGKXXXXXXXXXXXXXXXTPVLFRAYGIMCCFVLIGFLTINYFLAEISPTD 1942
            + F S+R +        +G G  +++ FLF +L+++  +         TL G+   I      L +FF SG ++  IGH   + + L G  VRF+  S +QN W+ILP E++ G+T    ++   SY +   P       Q ++  I  G+G   GS+  G +  S      F  +GI    V +  + I  +L   S  D
Sbjct:  362 QMFLSVRCVIFFLWCVAIGLGTALIWNFLFIYLEELDKAFEGCDSSIKTLEGLVMGIQCFGGELPFFFLSGWILKKIGHVNAMSVVLFGFGVRFILYSMLQNPWYILPIELMNGVTFGLFYATMASYASIVAPPGTDATMQSLVGAIFEGVGVSMGSLIAGQLFESVTARTTFEIFGIGAFIVFVIHVCIQLYLQRNSNID 562          
BLAST of Major facilitator superfamily domain containing protein vs. Ensembl Fly
Match: Sugb (gene:FBgn0036191 transcript:FBtr0344966)

HSP 1 Score: 72.0182 bits (175), Expect = 1.110e-12
Identity = 55/201 (27.36%), Postives = 91/201 (45.27%), Query Frame = 2
Query: 1367 KTFKSIRLISLLFLAWFMGFGVGIVFTFLFWHLQDIKGS--------PTLFGIASVINHISEILAYFF-SGKLIASIGHTKVLYLGLLGNVVRFLYVSWIQNSWWILPFEMIQGLTHAAVWSACYSYMAQTTPKEYRNASQRILQGIHHGLGKXXXXXXXXXXXXXXXTPVLFRAYGIMCCFVLIGFLTINYFLAEISPTD 1942
            + F S+R +        +G G  +++ FLF +L+++  +         TL G+   I      L +FF SG ++  IGH   + + L G  VRF+  S +QN W+ILP E++ G+T    ++   SY +   P       Q ++  I  G+G   GS+  G +  S      F  +GI    V +  + I  +L   S  D
Sbjct:  362 QMFLSVRCVIFFLWCVAIGLGTALIWNFLFIYLEELDKAFEGCDSSIKTLEGLVMGIQCFGGELPFFFLSGWILKKIGHVNAMSVVLFGFGVRFILYSMLQNPWYILPIELMNGVTFGLFYATMASYASIVAPPGTDATMQSLVGAIFEGVGVSMGSLIAGQLFESVTARTTFEIFGIGAFIVFVIHVCIQLYLQRNSNID 562          
BLAST of Major facilitator superfamily domain containing protein vs. Ensembl Fly
Match: Sugb (gene:FBgn0036191 transcript:FBtr0300100)

HSP 1 Score: 72.0182 bits (175), Expect = 1.165e-12
Identity = 55/201 (27.36%), Postives = 91/201 (45.27%), Query Frame = 2
Query: 1367 KTFKSIRLISLLFLAWFMGFGVGIVFTFLFWHLQDIKGS--------PTLFGIASVINHISEILAYFF-SGKLIASIGHTKVLYLGLLGNVVRFLYVSWIQNSWWILPFEMIQGLTHAAVWSACYSYMAQTTPKEYRNASQRILQGIHHGLGKXXXXXXXXXXXXXXXTPVLFRAYGIMCCFVLIGFLTINYFLAEISPTD 1942
            + F S+R +        +G G  +++ FLF +L+++  +         TL G+   I      L +FF SG ++  IGH   + + L G  VRF+  S +QN W+ILP E++ G+T    ++   SY +   P       Q ++  I  G+G   GS+  G +  S      F  +GI    V +  + I  +L   S  D
Sbjct:  362 QMFLSVRCVIFFLWCVAIGLGTALIWNFLFIYLEELDKAFEGCDSSIKTLEGLVMGIQCFGGELPFFFLSGWILKKIGHVNAMSVVLFGFGVRFILYSMLQNPWYILPIELMNGVTFGLFYATMASYASIVAPPGTDATMQSLVGAIFEGVGVSMGSLIAGQLFESVTARTTFEIFGIGAFIVFVIHVCIQLYLQRNSNID 562          
BLAST of Major facilitator superfamily domain containing protein vs. Ensembl Zebrafish
Match: mfsd6b (major facilitator superfamily domain containing 6b [Source:NCBI gene;Acc:447825])

HSP 1 Score: 262.307 bits (669), Expect = 5.241e-76
Identity = 199/550 (36.18%), Postives = 296/550 (53.82%), Query Frame = 2
Query:  425 SAPFWGVIAERWXXXXXXXXXXXXXXXXFTVGIGFTRPIPEGCLLKG---KFP-NETIIKEPGDYGNQPQLLVSD----PKILYPKLMGQSP----IRLVDQN------------ILMELNAES---GNFVIPVYSP----------------IVYTTENIYQTFVILLVLLILGEFMSSPSLALADTAVLNYLKEDRENYGRQRLYGSVGWGLAMFCIGISLDQA---IKFHNHPCGWPGEREKNYVICFTIFSVFMCFSLITATQMTFTYDD---QSENMYFKVVKDKVSQTILGGKTKNRQHLINEPDDSEINRRKDDEILEQQLSIKLDKTNYQSKSEDPYEDNYQINNFDLNVWVGALKTFKSIRLISLLFLAWFMGFGVGIVFTFLFWHLQDIKGSPTLFGIASVINHISEILAYFFSGKLIASIGHTKVLYLGLLGNVVRFLYVSWIQNSWWILPFEMIQGLTHAAVWSACYSYMAQTTPKEYRNASQRILQGIHHGLGKXXXXXXXXXXXXXXXTPVLFRAYGIMCCFVLIGFLTINYFLAE 1927
            SAPFWG +A+R+KKGK ++L S++C ++F  GIGF +P    C+      + P N T     G++  Q + L  D    P +  P L    P    IR  + N            I M  N  +       +P+ S                 I++  E +   F+++L+++I+GEF S+P++ + DT  L YL ++R+ YG QR++GS+GWG+AM  +GI +D     I      C  P    KNY I F +F V M  +LI ATQ  F +D+   QS+    K    ++ Q I           ++ P+ S      DD  +         +TN Q     P++D ++I                 +R  ++LF+AWFMGFG G VFTFLFWHL+D+KG+ TLFGI SV++HISE+ AYF S KLI  +GH +VLY+GL  N  R+LY+S+++N+W +LP E++QGLTHA+VW+AC SY++   P   R ++Q ILQG+H GLG+GCG++ GG+ +  FG    FR  G+     L+ F  I + L +
Sbjct:   60 SAPFWGFVADRFKKGKAVLLFSVLCWVVFNCGIGFVKPAAMSCVSVDPTVQSPVNFTNYTHAGNHTRQRRYLTEDAYANPPLSQPILAAYRPHSRYIRSANTNTTSAPFRNSTVDISMASNLTTMSPSATKVPLKSTSTMETQAITAKVKQYIIIFNKEQVDTIFLLILLVIIIGEFFSAPAVTIVDTVTLQYLGQNRDRYGLQRMWGSLGWGIAMLSVGIWIDNTHITIFIQGLGCVLPDY--KNYQIAFIVFGVLMTSALIVATQ--FHFDNRAYQSDEEEDKKEDVEIPQVI---------QEVSSPESSS-----DDAPV-------CPETNPQ---HFPFKDLFRI--------------ICGVRYGTVLFVAWFMGFGYGFVFTFLFWHLEDLKGTTTLFGICSVLSHISELAAYFISHKLIELVGHIRVLYIGLACNTARYLYISYLENAWIVLPMEVLQGLTHASVWAACISYLSAAVPPALRTSAQGILQGLHLGLGRGCGAMLGGVFVNFFGAAETFRGLGMASLVTLLIFSLIQWLLGQ 567          
BLAST of Major facilitator superfamily domain containing protein vs. Ensembl Zebrafish
Match: mfsd6a (major facilitator superfamily domain containing 6a [Source:NCBI gene;Acc:100034426])

HSP 1 Score: 249.21 bits (635), Expect = 6.519e-71
Identity = 145/373 (38.87%), Postives = 210/373 (56.30%), Query Frame = 2
Query:  818 GEFMSSPSLALADTAVLNYLKEDRENYGRQRLYGSVGWGLAMFCIGISLDQA---IKFHNHPCGWPGEREKNYVICFTIFSVFMCFSLITATQMTFTYDDQSENMYFKVVKDKVSQTILGGKTKNRQHLINEPDDSEINRRKDDEILEQQLSIKLDKTNYQSKSEDPYEDNYQINNFDLNVWVGALKTFKSIRLISLLFLAWFMGFGVGIVFTFLFWHLQDIKGSPTLFGIASVINHISEILAYFFSGKLIASIGHTKVLYLGLLGNVVRFLYVSWIQNSWWILPFEMIQGLTHAAVWSACYSYMAQTTPKEYRNASQRILQGIHHGLGKXXXXXXXXXXXXXXXTPVLFRAYGIMCCFVLIGFLTINYFLAE 1927
            GEF S+P++ + DT  L+YL   R+ YG QR++GS+GWGLAM CIGI +D     +   N  C    +  KNY I F +F V M  +LI ATQ  F       N               G +  N+Q  + +P  S   R  D   + Q                       + + +DL      ++    ++  ++LF+AWFMGFG G VFTFL+WHLQD+ G+ TLFGI SV++H+SE+ AYF S K I  +GH +VLY+GL  N  R+LY+S+++N+W +LP E++QG+THA+VW+AC SY++   P   R ++Q ILQG+H GLG+GCG++ GG+ +  FG    FR  G+    +L+ F  I Y   +
Sbjct:  309 GEFFSAPAITIVDTVTLHYLGPHRDRYGLQRMWGSLGWGLAMLCIGIWIDHTSTNLIIGNMECIM--KNYKNYHIAFIVFGVLMVIALIVATQFKFDVQHHDTNE--------------GQEVGNQQENV-QPRGSPGTRSTDTPTIVQA---------------------EEFHFWDL------MRLLCGVQYSTVLFVAWFMGFGYGFVFTFLYWHLQDLTGTTTLFGICSVLSHVSELAAYFTSHKFIELVGHIRVLYIGLACNTARYLYISYLENAWTVLPMEVLQGITHASVWAACISYLSAAVPPPLRTSAQGILQGLHLGLGRGCGAMVGGIFVNYFGVAETFRGIGMASLVILLIFSLIMYITGQ 637          

HSP 2 Score: 84.7297 bits (208), Expect = 2.013e-16
Identity = 54/111 (48.65%), Postives = 81/111 (72.97%), Query Frame = 2
Query:  221 NPTSKRDVLDMLLTHVNRTLLVFKLXXXXXXXXXGSLFPLISVYFKQLGLSATQCGILVGCRPFVEFISAPFWGVIAERWXXXXXXXXXXXXXXXXFTVGIGFTRPIPEGC 553
            +P  +    + L   VNR LLV K++Y F++AA+GSL PL+++Y+KQLG++ TQ G+LVG R F+EF SAPFWG++A+R++KGK ++L S++C +LF  GIG  +P    C
Sbjct:   51 SPQHELSCCERLFLRVNRHLLVSKVFYLFFYAAYGSLHPLLALYYKQLGMNPTQSGLLVGIRYFIEFCSAPFWGIVADRYRKGKAVLLFSMLCWILFNAGIGIVKPPIMAC 161          
BLAST of Major facilitator superfamily domain containing protein vs. Ensembl Xenopus
Match: MFSD6 (major facilitator superfamily domain containing 6 [Source:NCBI gene;Acc:100170426])

HSP 1 Score: 330.102 bits (845), Expect = 7.432e-101
Identity = 229/607 (37.73%), Postives = 342/607 (56.34%), Query Frame = 2
Query:  215 MENPTSKRDVLDMLLTHVNRTLLVFKLXXXXXXXXXGSLFPLISVYFKQLGLSATQCGILVGCRPFVEFISAPFWGVIAERWXXXXXXXXXXXXXXXXFTVGIGFTRPIPEGCL---LKGKFPNET-------------IIKEPGDYGNQPQLLVSDPKILYPKLMGQSPIRLVDQN----------------------ILMELNAESGNFVIPVYSPIVYTTENIYQTFVILLVLLILGEFMSSPSLALADTAVLNYLKEDRENYGRQRLYGSVGWGLAMFCIGISLDQA-IKFHNHPCGWPGEREKNYVICFTIFSVFMCFSLITATQMTFTYDDQSENMYFKVVKDKVSQTILGGKTKNRQHLINEPDDSEINRRKDDEILEQQLSIKLDKTNYQSKSEDPYEDNYQINNF-DLNVWVGALKTFKSIRLISLLFLAWFMGFGVGIVFTFLFWHLQDIKGSPTLFGIASVINHISEILAYFFSGKLIASIGHTKVLYLGLLGNVVRFLYVSWIQNSWWILPFEMIQGLTHAAVWSACYSYMAQTTPKEYRNASQRILQGIHHGLGKXXXXXXXXXXXXXXXTPVLFRAYGIMCCFVLIGFLTINY 1915
            M       D L+     +N  LL+ K++YFF+++A+GSL+PL+ VY+KQLG++ATQ G+LVG R F+EF SAPFWGVIA+R+KKGK+++L S++C +LF +GIGF +P    C+   L+  +P  +             II       N+ + L  D  +    L  Q   + ++ +                       L E+   + +  I     + Y  E++   F++LL+++I+GEF S+P++ + DT  L YL + R+ YG QR++GS+GWGLAM  +GI +D   I       G      KNY I F +F V M  +LI +TQ  F Y                             HL  E D     RR+D E    + S + + +  Q++ E    D  Q   F DL      +K   +++  S+LF+AWFMGFG G VFTFLFWHLQD+ G+ TLFGI SV++H+SE+ AYFFS K+I  +GH +VLY+GL  N  R+LY+S+++N+W +LP E++QG+THAA+W+AC SY++   P E R ++Q ILQG+H GLG+GCG++ GG+++  FG    FR  G+ C  +L+ F  I +
Sbjct:   51 MSTADQDMDWLERHCIKINNDLLISKVFYFFFYSAYGSLYPLLPVYYKQLGMNATQSGLLVGIRYFIEFCSAPFWGVIADRFKKGKMVLLFSVLCWVLFNLGIGFVKPAALSCMTSNLEPVYPTNSSLVTIDIPSTIAGIISNSTKNKNKRETL-EDSSLKGNYLQLQQSTQDINNDSAINITTQSTTSTILITTTTVVALTEVKTPTADQFI-----LEYNKEDVETIFLLLLLVVIIGEFFSAPAVTIVDTVTLQYLGKHRDRYGLQRMWGSLGWGLAMLSVGIGIDNTHIDVIIEGIGCLDPDYKNYRIAFIVFGVLMTVALIVSTQFHFHY----------------------------HHLKQEED-----RREDLESSTIESSSQTESSVNQNEREQ--RDTNQAFRFRDL------IKIICTVQYGSVLFVAWFMGFGYGYVFTFLFWHLQDLNGTTTLFGICSVLSHVSELTAYFFSHKVIELVGHIRVLYIGLACNTARYLYISYMENAWTVLPMEVLQGVTHAAIWAACISYLSAAVPPELRTSAQGILQGLHLGLGRGCGAMIGGVLVNFFGAAETFRGIGMACLVILLLFALIQW 610          
BLAST of Major facilitator superfamily domain containing protein vs. Ensembl Xenopus
Match: MFSD6 (major facilitator superfamily domain containing 6 [Source:NCBI gene;Acc:100170426])

HSP 1 Score: 329.717 bits (844), Expect = 2.007e-100
Identity = 229/607 (37.73%), Postives = 342/607 (56.34%), Query Frame = 2
Query:  215 MENPTSKRDVLDMLLTHVNRTLLVFKLXXXXXXXXXGSLFPLISVYFKQLGLSATQCGILVGCRPFVEFISAPFWGVIAERWXXXXXXXXXXXXXXXXFTVGIGFTRPIPEGCL---LKGKFPNET-------------IIKEPGDYGNQPQLLVSDPKILYPKLMGQSPIRLVDQN----------------------ILMELNAESGNFVIPVYSPIVYTTENIYQTFVILLVLLILGEFMSSPSLALADTAVLNYLKEDRENYGRQRLYGSVGWGLAMFCIGISLDQA-IKFHNHPCGWPGEREKNYVICFTIFSVFMCFSLITATQMTFTYDDQSENMYFKVVKDKVSQTILGGKTKNRQHLINEPDDSEINRRKDDEILEQQLSIKLDKTNYQSKSEDPYEDNYQINNF-DLNVWVGALKTFKSIRLISLLFLAWFMGFGVGIVFTFLFWHLQDIKGSPTLFGIASVINHISEILAYFFSGKLIASIGHTKVLYLGLLGNVVRFLYVSWIQNSWWILPFEMIQGLTHAAVWSACYSYMAQTTPKEYRNASQRILQGIHHGLGKXXXXXXXXXXXXXXXTPVLFRAYGIMCCFVLIGFLTINY 1915
            M       D L+     +N  LL+ K++YFF+++A+GSL+PL+ VY+KQLG++ATQ G+LVG R F+EF SAPFWGVIA+R+KKGK+++L S++C +LF +GIGF +P    C+   L+  +P  +             II       N+ + L  D  +    L  Q   + ++ +                       L E+   + +  I     + Y  E++   F++LL+++I+GEF S+P++ + DT  L YL + R+ YG QR++GS+GWGLAM  +GI +D   I       G      KNY I F +F V M  +LI +TQ  F Y                             HL  E D     RR+D E    + S + + +  Q++ E    D  Q   F DL      +K   +++  S+LF+AWFMGFG G VFTFLFWHLQD+ G+ TLFGI SV++H+SE+ AYFFS K+I  +GH +VLY+GL  N  R+LY+S+++N+W +LP E++QG+THAA+W+AC SY++   P E R ++Q ILQG+H GLG+GCG++ GG+++  FG    FR  G+ C  +L+ F  I +
Sbjct:   51 MSTADQDMDWLERHCIKINNDLLISKVFYFFFYSAYGSLYPLLPVYYKQLGMNATQSGLLVGIRYFIEFCSAPFWGVIADRFKKGKMVLLFSVLCWVLFNLGIGFVKPAALSCMTSNLEPVYPTNSSLVTIDIPSTIAGIISNSTKNKNKRETL-EDSSLKGNYLQLQQSTQDINNDSAINITTQSTTSTILITTTTVVALTEVKTPTADQFI-----LEYNKEDVETIFLLLLLVVIIGEFFSAPAVTIVDTVTLQYLGKHRDRYGLQRMWGSLGWGLAMLSVGIGIDNTHIDVIIEGIGCLDPDYKNYRIAFIVFGVLMTVALIVSTQFHFHY----------------------------HHLKQEED-----RREDLESSTIESSSQTESSVNQNEREQ--RDTNQAFRFRDL------IKIICTVQYGSVLFVAWFMGFGYGYVFTFLFWHLQDLNGTTTLFGICSVLSHVSELTAYFFSHKVIELVGHIRVLYIGLACNTARYLYISYMENAWTVLPMEVLQGVTHAAIWAACISYLSAAVPPELRTSAQGILQGLHLGLGRGCGAMIGGVLVNFFGAAETFRGIGMACLVILLLFALIQW 610          
BLAST of Major facilitator superfamily domain containing protein vs. Ensembl Xenopus
Match: MFSD6L (major facilitator superfamily domain containing 6-like [Source:NCBI gene;Acc:100379844])

HSP 1 Score: 57.3806 bits (137), Expect = 8.838e-8
Identity = 40/154 (25.97%), Postives = 73/154 (47.40%), Query Frame = 2
Query: 1448 FLFWHLQDIKGSPTLFGIASVINHISEILAYFFSGKLIASIGHTKVLYLGLLGNVVRFLYVSWIQNSWWILPFEMIQGLTHAAVWSACYSYMAQTTPKEYRNASQRILQGIHHGLGKXXXXXXXXXXXXXXXTPVLFRAYGIMCCFVLIGFLTI 1909
            FLFW +QD        G++     ++E+  YFF  K++  +    ++ LGLL   V+ LY S++   W +L  +++   +   +W A  S +          + Q  L+ + +G G   GS   G +I  F   VL++A    CC +L+ ++ +
Sbjct:  410 FLFWQMQDAGSGELYMGLSVAAGLLAELTLYFFRNKILKVLTFKWMVVLGLLSLGVQVLYYSFLWAPWSVLAVQLLNAFSSGVIWWAINSQVVDVASPGTERSLQLALRWLAYGSGASTGSFASGFVITRFSLAVLYQA----CCVLLLLWIAV 559          
BLAST of Major facilitator superfamily domain containing protein vs. Ensembl Mouse
Match: Mfsd6 (major facilitator superfamily domain containing 6 [Source:MGI Symbol;Acc:MGI:1922925])

HSP 1 Score: 329.717 bits (844), Expect = 9.259e-101
Identity = 229/620 (36.94%), Postives = 341/620 (55.00%), Query Frame = 2
Query:  224 PTSKRDVLDMLLTHVNRTLLVFKLXXXXXXXXXGSLFPLISVYFKQLGLSATQCGILVGCRPFVEFISAPFWGVIAERWXXXXXXXXXXXXXXXXFTVGIGFTRPIPEGCLLK-GKFPNETIIKEP-----------GDYGNQPQLL-------------VSDPKILYPKL-MGQSPIRLVDQNILME------LNAE------SGNFVIPVYSPIVYTT--------------ENIYQTFVILLVLLILGEFMSSPSLALADTAVLNYLKEDRENYGRQRLYGSVGWGLAMFCIGISLDQA---IKFHNHPCGWPGEREKNYVICFTIFSVFMCFSLITATQMTFTYDDQSENMYFKVVKDKVSQTILGGKTKNRQHLINEPDDSEINRRKDDEILEQQLSIKLDKTNYQSKSEDPYEDNYQINNFDLNVWVGALKTFKSIRLISLLFLAWFMGFGVGIVFTFLFWHLQDIKGSPTLFGIASVINHISEILAYFFSGKLIASIGHTKVLYLGLLGNVVRFLYVSWIQNSWWILPFEMIQGLTHAAVWSACYSYMAQTTPKEYRNASQRILQGIHHGLGKXXXXXXXXXXXXXXXTPVLFRAYGIMCCFVLIGFLTINYF 1918
            P  + D ++     VN  LL+ K++YFF+++A+GSL+PL+ VY+KQLG+S +Q G+LVG R F+EF SAPFWGV+A+R++KGK+++L SL+C +LF +GIGF +P    CL K     + T +  P             +   P+LL             +SD  ++   L +   P R      +        LN        +GN        +V TT              + +   F+I+LV++I+GEF S+ S+ + DT  L YL + R+ YG QR++GS+GWGLAM  +GI +D     +      C  P  R  NY I F +F V M  +LI ATQ  F Y+  + +                GK K          + EI + + D   E         T+ Q+            N +DL      +K   S++  S+LF+AWFMGFG G VFTFL+WHL+D+ G+ TLFG+ SV++H+SE+ AYFFS KLI  IGH +VLY+GL  N  R++Y+S+++N+W +LP E++QG+THAA+W+AC SY++   P E R ++Q ILQG+H GLG+GCG++ GG+++  FG    FR  G+ C  +L+ F  I + 
Sbjct:   51 PEEEIDWIEKHCVKVNNDLLISKVFYFFFYSAYGSLYPLLPVYYKQLGMSPSQSGLLVGIRYFIEFCSAPFWGVVADRFRKGKIVLLFSLLCWVLFNLGIGFVKPATLRCLPKIPPTAHPTNVSHPVTVLPMNSSTVAFFSTPPKLLQKRDVQLSETEPNISDIDLVSTALTLTSEPTRRPQTEAITHPVTGLILNTSTVTLPPTGNVTRETTIAVVTTTKSLPSDQVTLVYDQQEVEAIFLIILVVVIIGEFFSASSVTIVDTVTLQYLGKHRDRYGLQRMWGSLGWGLAMLSVGIGIDYTHIDVLIDGKGCKPPEYR--NYQIVFIVFGVLMTMALIVATQFRFRYNHFNNS---------------DGKGK----------EVEIPQVERDNSTESSEETPTAATHSQA-----------FNFWDL------IKLLCSVQYGSVLFVAWFMGFGYGFVFTFLYWHLEDLNGTTTLFGVCSVLSHVSELTAYFFSHKLIELIGHIRVLYIGLACNTARYIYISYLENAWTVLPMEVLQGVTHAAIWAACISYLSAAVPPELRTSAQGILQGLHLGLGRGCGAMIGGVLVNYFGAAATFRGIGMACLVILLLFALIQWL 626          
BLAST of Major facilitator superfamily domain containing protein vs. Ensembl Mouse
Match: Mfsd6 (major facilitator superfamily domain containing 6 [Source:MGI Symbol;Acc:MGI:1922925])

HSP 1 Score: 329.717 bits (844), Expect = 1.436e-100
Identity = 229/620 (36.94%), Postives = 341/620 (55.00%), Query Frame = 2
Query:  224 PTSKRDVLDMLLTHVNRTLLVFKLXXXXXXXXXGSLFPLISVYFKQLGLSATQCGILVGCRPFVEFISAPFWGVIAERWXXXXXXXXXXXXXXXXFTVGIGFTRPIPEGCLLK-GKFPNETIIKEP-----------GDYGNQPQLL-------------VSDPKILYPKL-MGQSPIRLVDQNILME------LNAE------SGNFVIPVYSPIVYTT--------------ENIYQTFVILLVLLILGEFMSSPSLALADTAVLNYLKEDRENYGRQRLYGSVGWGLAMFCIGISLDQA---IKFHNHPCGWPGEREKNYVICFTIFSVFMCFSLITATQMTFTYDDQSENMYFKVVKDKVSQTILGGKTKNRQHLINEPDDSEINRRKDDEILEQQLSIKLDKTNYQSKSEDPYEDNYQINNFDLNVWVGALKTFKSIRLISLLFLAWFMGFGVGIVFTFLFWHLQDIKGSPTLFGIASVINHISEILAYFFSGKLIASIGHTKVLYLGLLGNVVRFLYVSWIQNSWWILPFEMIQGLTHAAVWSACYSYMAQTTPKEYRNASQRILQGIHHGLGKXXXXXXXXXXXXXXXTPVLFRAYGIMCCFVLIGFLTINYF 1918
            P  + D ++     VN  LL+ K++YFF+++A+GSL+PL+ VY+KQLG+S +Q G+LVG R F+EF SAPFWGV+A+R++KGK+++L SL+C +LF +GIGF +P    CL K     + T +  P             +   P+LL             +SD  ++   L +   P R      +        LN        +GN        +V TT              + +   F+I+LV++I+GEF S+ S+ + DT  L YL + R+ YG QR++GS+GWGLAM  +GI +D     +      C  P  R  NY I F +F V M  +LI ATQ  F Y+  + +                GK K          + EI + + D   E         T+ Q+            N +DL      +K   S++  S+LF+AWFMGFG G VFTFL+WHL+D+ G+ TLFG+ SV++H+SE+ AYFFS KLI  IGH +VLY+GL  N  R++Y+S+++N+W +LP E++QG+THAA+W+AC SY++   P E R ++Q ILQG+H GLG+GCG++ GG+++  FG    FR  G+ C  +L+ F  I + 
Sbjct:   51 PEEEIDWIEKHCVKVNNDLLISKVFYFFFYSAYGSLYPLLPVYYKQLGMSPSQSGLLVGIRYFIEFCSAPFWGVVADRFRKGKIVLLFSLLCWVLFNLGIGFVKPATLRCLPKIPPTAHPTNVSHPVTVLPMNSSTVAFFSTPPKLLQKRDVQLSETEPNISDIDLVSTALTLTSEPTRRPQTEAITHPVTGLILNTSTVTLPPTGNVTRETTIAVVTTTKSLPSDQVTLVYDQQEVEAIFLIILVVVIIGEFFSASSVTIVDTVTLQYLGKHRDRYGLQRMWGSLGWGLAMLSVGIGIDYTHIDVLIDGKGCKPPEYR--NYQIVFIVFGVLMTMALIVATQFRFRYNHFNNS---------------DGKGK----------EVEIPQVERDNSTESSEETPTAATHSQA-----------FNFWDL------IKLLCSVQYGSVLFVAWFMGFGYGFVFTFLYWHLEDLNGTTTLFGVCSVLSHVSELTAYFFSHKLIELIGHIRVLYIGLACNTARYIYISYLENAWTVLPMEVLQGVTHAAIWAACISYLSAAVPPELRTSAQGILQGLHLGLGRGCGAMIGGVLVNYFGAAATFRGIGMACLVILLLFALIQWL 626          
BLAST of Major facilitator superfamily domain containing protein vs. Ensembl Mouse
Match: Mfsd6 (major facilitator superfamily domain containing 6 [Source:MGI Symbol;Acc:MGI:1922925])

HSP 1 Score: 274.633 bits (701), Expect = 3.064e-82
Identity = 156/391 (39.90%), Postives = 230/391 (58.82%), Query Frame = 2
Query:  755 IVYTTENIYQTFVILLVLLILGEFMSSPSLALADTAVLNYLKEDRENYGRQRLYGSVGWGLAMFCIGISLDQA---IKFHNHPCGWPGEREKNYVICFTIFSVFMCFSLITATQMTFTYDDQSENMYFKVVKDKVSQTILGGKTKNRQHLINEPDDSEINRRKDDEILEQQLSIKLDKTNYQSKSEDPYEDNYQINNFDLNVWVGALKTFKSIRLISLLFLAWFMGFGVGIVFTFLFWHLQDIKGSPTLFGIASVINHISEILAYFFSGKLIASIGHTKVLYLGLLGNVVRFLYVSWIQNSWWILPFEMIQGLTHAAVWSACYSYMAQTTPKEYRNASQRILQGIHHGLGKXXXXXXXXXXXXXXXTPVLFRAYGIMCCFVLIGFLTINYF 1918
            +VY  + +   F+I+LV++I+GEF S+ S+ + DT  L YL + R+ YG QR++GS+GWGLAM  +GI +D     +      C  P  R  NY I F +F V M  +LI ATQ  F Y+  + +                GK K          + EI + + D   E         T+ Q+            N +DL      +K   S++  S+LF+AWFMGFG G VFTFL+WHL+D+ G+ TLFG+ SV++H+SE+ AYFFS KLI  IGH +VLY+GL  N  R++Y+S+++N+W +LP E++QG+THAA+W+AC SY++   P E R ++Q ILQG+H GLG+GCG++ GG+++  FG    FR  G+ C  +L+ F  I + 
Sbjct:  111 LVYDQQEVEAIFLIILVVVIIGEFFSASSVTIVDTVTLQYLGKHRDRYGLQRMWGSLGWGLAMLSVGIGIDYTHIDVLIDGKGCKPPEYR--NYQIVFIVFGVLMTMALIVATQFRFRYNHFNNS---------------DGKGK----------EVEIPQVERDNSTESSEETPTAATHSQA-----------FNFWDL------IKLLCSVQYGSVLFVAWFMGFGYGFVFTFLYWHLEDLNGTTTLFGVCSVLSHVSELTAYFFSHKLIELIGHIRVLYIGLACNTARYIYISYLENAWTVLPMEVLQGVTHAAIWAACISYLSAAVPPELRTSAQGILQGLHLGLGRGCGAMIGGVLVNYFGAAATFRGIGMACLVILLLFALIQWL 457          
BLAST of Major facilitator superfamily domain containing protein vs. Ensembl Mouse
Match: Mfsd6l (major facilitator superfamily domain containing 6-like [Source:MGI Symbol;Acc:MGI:2384904])

HSP 1 Score: 51.2174 bits (121), Expect = 4.601e-6
Identity = 34/108 (31.48%), Postives = 59/108 (54.63%), Query Frame = 2
Query: 1385 RLISLLFLAWFMGFGVGIVFTFLFWHLQDIKGSPTLFGIASVINHISEILAYFFSGKLIASIGHTKVLYLGLLGNVVRFLYVSWIQNSWWILPFEMIQGLTHAAVWSA 1708
            RLI L F  +++G     V  FLFWH++D   S  + G +  ++ + EIL + F   L+  +    VL LGL    ++ LY ++I + W +LP +++  ++  A+W A
Sbjct:  364 RLILLAFTVFWIGATASTVQDFLFWHMKDHGSSELVMGFSVALSLLGEILFHPFRTSLLRKLSRVGVLGLGLGCLALQVLYYAFIWSWWSVLPVQILSTISSGALWWA 471          
BLAST of Major facilitator superfamily domain containing protein vs. UniProt/SwissProt
Match: sp|A1DWM3|MFSD6_PIG (Major facilitator superfamily domain-containing protein 6 OS=Sus scrofa OX=9823 GN=MFSD6 PE=2 SV=1)

HSP 1 Score: 333.569 bits (854), Expect = 4.009e-101
Identity = 225/626 (35.94%), Postives = 345/626 (55.11%), Query Frame = 2
Query:  224 PTSKRDVLDMLLTHVNRTLLVFKLXXXXXXXXXGSLFPLISVYFKQLGLSATQCGILVGCRPFVEFISAPFWGVIAERWXXXXXXXXXXXXXXXXFTVGIGFTRPIPEGCLLK---------------------GKFPNETIIKEPGDYGNQP-----QLLVSDPKILYPKLMGQSPIRL--------VDQNILMELNAESGNFVIPVYSP------------------------IVYTTENIYQTFVILLVLLILGEFMSSPSLALADTAVLNYLKEDRENYGRQRLYGSVGWGLAMFCIGISLDQA---IKFHNHPCGWPGEREKNYVICFTIFSVFMCFSLITATQMTFTYDDQSENMYFKVVKDKVSQTILGGKTKNRQHLINEPDDSEINRRKDDEILEQQLSIKLDKTNYQSKSEDPYEDNYQINNFDLNVWVGALKTFKSIRLISLLFLAWFMGFGVGIVFTFLFWHLQDIKGSPTLFGIASVINHISEILAYFFSGKLIASIGHTKVLYLGLLGNVVRFLYVSWIQNSWWILPFEMIQGLTHAAVWSACYSYMAQTTPKEYRNASQRILQGIHHGLGKXXXXXXXXXXXXXXXTPVLFRAYGIMCCFVLIGFLTINYF 1918
            P  + D ++     +N  LL+ K++YFF+++A+GSL+PL+ VY+KQLG+S +Q G+LVG R F+EF SAPFWGV+A+R+KKGK+++L SL+C +LF +GIGF +P    C+ K                        P+ T      +  N P     ++LVS+P +    +   +P +          D+     ++  S     P   P                        +VY  + +   F+++LV++I+GEF S+ S+ + DT  L YL + R+ YG QR++GS+GWGLAM  +GI +D     +      C  P  R  NY I F +F V M  +LI ATQ  F Y+      +FK            G+ K ++  I      ++ R    E  E+  +     T   S++          N +DL      ++   S++  S+LF+AWFMGFG G VFTFL+WHL+D+ G+ TLFG+ SV++H+SE+ AYFFS KLI  IGH +VLY+GL  N  R++Y+S+++N+W +LP E++QG+THAA+W+AC SY++   P E R ++Q ILQG+H GLG+GCG++ GG+++  FG    FR  G+ C  +L+ F  I + 
Sbjct:   51 PEEETDWIEKHCVKINNDLLISKVFYFFFYSAYGSLYPLLPVYYKQLGMSPSQSGLLVGIRYFIEFCSAPFWGVVADRFKKGKVVLLFSLLCWVLFNLGIGFVKPATLRCVPKIPPTARPTNSSHPFTILPANSSIVPSITTSTRTREKRNLPPYDGLEMLVSEPNVTETVIFSTAPNKTSAPTLQPQTDEITDRVMDLTSHPSTAPSTPPGNTTRETTTSLVTTTKSLPSDQVTLVYDQQEVEAIFLVILVVVIIGEFFSASSVTIVDTVTLQYLGKHRDRYGLQRMWGSLGWGLAMLSVGIGIDYTHIDVLIDGKGCKPPEYR--NYQIVFIVFGVLMTMALIVATQFRFRYN------HFK-----------NGENKGKEVEI-----PQVERNSSTECSEETPT-----TTSHSQA---------FNFWDL------IRLLCSVQYGSVLFVAWFMGFGYGFVFTFLYWHLEDLNGTTTLFGVCSVLSHVSELTAYFFSHKLIELIGHIRVLYIGLACNTARYIYISYLENAWTVLPMEVLQGVTHAAIWAACISYLSAAVPPELRTSAQGILQGLHLGLGRGCGAMIGGVLVNYFGAAATFRGIGMACLVILLLFALIQWL 632          
BLAST of Major facilitator superfamily domain containing protein vs. UniProt/SwissProt
Match: sp|Q6ZSS7|MFSD6_HUMAN (Major facilitator superfamily domain-containing protein 6 OS=Homo sapiens OX=9606 GN=MFSD6 PE=1 SV=2)

HSP 1 Score: 332.798 bits (852), Expect = 8.746e-101
Identity = 228/625 (36.48%), Postives = 345/625 (55.20%), Query Frame = 2
Query:  224 PTSKRDVLDMLLTHVNRTLLVFKLXXXXXXXXXGSLFPLISVYFKQLGLSATQCGILVGCRPFVEFISAPFWGVIAERWXXXXXXXXXXXXXXXXFTVGIGFTRPIPEGCLLKGKFPNETIIKEPGDYGNQPQLLVSD----------PKILYPKLMGQSPIRLVDQ-----------------------NILMELNAESGNFVIPVYSP------------------------IVYTTENIYQTFVILLVLLILGEFMSSPSLALADTAVLNYLKEDRENYGRQRLYGSVGWGLAMFCIGISLDQA---IKFHNHPCGWPGEREKNYVICFTIFSVFMCFSLITATQMTFTYDDQSENMYFKVVKDKVSQTILGGKTKNRQHLINEPDDSEINRRKDDEILEQQLSIKLDKTNYQSKSEDPYEDNYQINNFDLNVWVGALKTFKSIRLISLLFLAWFMGFGVGIVFTFLFWHLQDIKGSPTLFGIASVINHISEILAYFFSGKLIASIGHTKVLYLGLLGNVVRFLYVSWIQNSWWILPFEMIQGLTHAAVWSACYSYMAQTTPKEYRNASQRILQGIHHGLGKXXXXXXXXXXXXXXXTPVLFRAYGIMCCFVLIGFLTINYF 1918
            P  + D ++     +N  LL+ K++YFF+++A+GSL+PL+ VY+KQLG+S +Q G+LVG R F+EF SAPFWGV+A+R+KKGK+++L SL+C +LF +GIGF +P    C+     P       P +  +Q  +L ++          PK+   + + ++ + + D                        N +M+L   S     PV SP                        +VY  + +   F+++LV++I+GEF S+ S+ + DT  L YL + R+ YG QR++GS+GWGLAM  +GI +D     +      C  P  R  NY I F +F V M  +LI ATQ  F Y+                            H  N  DDS   + K+ EI +      +++ N    SE+          F  N W   +K   S++  S+LF+AWFMGFG G VFTFL+WHL+D+ G+ TLFG+ SV++H+SE+ AYFFS KLI  IGH +VLY+GL  N  R++Y+S+++N+W +LP E++QG+THAA+W+AC SY++   P E R ++Q ILQG+H GLG+GCG++ GG+++  FG    FR  G+ C  +L+ F  I + 
Sbjct:   50 PEEEIDWIEKHCVKINNDLLISKVFYFFFYSAYGSLYPLLPVYYKQLGMSPSQSGLLVGIRYFIEFCSAPFWGVVADRFKKGKIVLLFSLLCWVLFNLGIGFVKPATLRCV-----PKIRPTTHPTNASHQLTILPTNSSFTSFLTISPKMREKRNLLETRLNVSDTVTLPTAPNMNSEPTLQPQTGEITNRMMDLTLNSST-ATPV-SPGSVTKETTTVIVTTTKSLPSDQVMLVYDQQEVEAIFLVILVVVIIGEFFSASSVTIVDTVTLQYLGKHRDRYGLQRMWGSLGWGLAMLSVGIGIDYTHIEVLIDGKGCKPPEYR--NYQIVFIVFGVLMTMALIVATQFRFRYN----------------------------HFKN--DDS---KGKEVEIPQ------VERNNSTESSEETPTTTSHSQAF--NFW-DLIKLLCSVQYGSVLFVAWFMGFGYGFVFTFLYWHLEDLNGTTTLFGVCSVLSHVSELTAYFFSHKLIELIGHIRVLYIGLACNTARYIYISYLENAWTVLPMEVLQGVTHAAIWAACISYLSAAVPPELRTSAQGILQGLHLGLGRGCGAMIGGVLVNYFGAAATFRGIGMACLVILLLFALIQWL 623          
BLAST of Major facilitator superfamily domain containing protein vs. UniProt/SwissProt
Match: sp|Q8CBH5|MFSD6_MOUSE (Major facilitator superfamily domain-containing protein 6 OS=Mus musculus OX=10090 GN=Mfsd6 PE=1 SV=1)

HSP 1 Score: 329.717 bits (844), Expect = 6.476e-100
Identity = 229/620 (36.94%), Postives = 341/620 (55.00%), Query Frame = 2
Query:  224 PTSKRDVLDMLLTHVNRTLLVFKLXXXXXXXXXGSLFPLISVYFKQLGLSATQCGILVGCRPFVEFISAPFWGVIAERWXXXXXXXXXXXXXXXXFTVGIGFTRPIPEGCLLK-GKFPNETIIKEP-----------GDYGNQPQLL-------------VSDPKILYPKL-MGQSPIRLVDQNILME------LNAE------SGNFVIPVYSPIVYTT--------------ENIYQTFVILLVLLILGEFMSSPSLALADTAVLNYLKEDRENYGRQRLYGSVGWGLAMFCIGISLDQA---IKFHNHPCGWPGEREKNYVICFTIFSVFMCFSLITATQMTFTYDDQSENMYFKVVKDKVSQTILGGKTKNRQHLINEPDDSEINRRKDDEILEQQLSIKLDKTNYQSKSEDPYEDNYQINNFDLNVWVGALKTFKSIRLISLLFLAWFMGFGVGIVFTFLFWHLQDIKGSPTLFGIASVINHISEILAYFFSGKLIASIGHTKVLYLGLLGNVVRFLYVSWIQNSWWILPFEMIQGLTHAAVWSACYSYMAQTTPKEYRNASQRILQGIHHGLGKXXXXXXXXXXXXXXXTPVLFRAYGIMCCFVLIGFLTINYF 1918
            P  + D ++     VN  LL+ K++YFF+++A+GSL+PL+ VY+KQLG+S +Q G+LVG R F+EF SAPFWGV+A+R++KGK+++L SL+C +LF +GIGF +P    CL K     + T +  P             +   P+LL             +SD  ++   L +   P R      +        LN        +GN        +V TT              + +   F+I+LV++I+GEF S+ S+ + DT  L YL + R+ YG QR++GS+GWGLAM  +GI +D     +      C  P  R  NY I F +F V M  +LI ATQ  F Y+  + +                GK K          + EI + + D   E         T+ Q+            N +DL      +K   S++  S+LF+AWFMGFG G VFTFL+WHL+D+ G+ TLFG+ SV++H+SE+ AYFFS KLI  IGH +VLY+GL  N  R++Y+S+++N+W +LP E++QG+THAA+W+AC SY++   P E R ++Q ILQG+H GLG+GCG++ GG+++  FG    FR  G+ C  +L+ F  I + 
Sbjct:   51 PEEEIDWIEKHCVKVNNDLLISKVFYFFFYSAYGSLYPLLPVYYKQLGMSPSQSGLLVGIRYFIEFCSAPFWGVVADRFRKGKIVLLFSLLCWVLFNLGIGFVKPATLRCLPKIPPTAHPTNVSHPVTVLPMNSSTVAFFSTPPKLLQKRDVQLSETEPNISDIDLVSTALTLTSEPTRRPQTEAITHPVTGLILNTSTVTLPPTGNVTRETTIAVVTTTKSLPSDQVTLVYDQQEVEAIFLIILVVVIIGEFFSASSVTIVDTVTLQYLGKHRDRYGLQRMWGSLGWGLAMLSVGIGIDYTHIDVLIDGKGCKPPEYR--NYQIVFIVFGVLMTMALIVATQFRFRYNHFNNS---------------DGKGK----------EVEIPQVERDNSTESSEETPTAATHSQA-----------FNFWDL------IKLLCSVQYGSVLFVAWFMGFGYGFVFTFLYWHLEDLNGTTTLFGVCSVLSHVSELTAYFFSHKLIELIGHIRVLYIGLACNTARYIYISYLENAWTVLPMEVLQGVTHAAIWAACISYLSAAVPPELRTSAQGILQGLHLGLGRGCGAMIGGVLVNYFGAAATFRGIGMACLVILLLFALIQWL 626          
BLAST of Major facilitator superfamily domain containing protein vs. UniProt/SwissProt
Match: sp|B0UYT5|MFD6B_DANRE (Major facilitator superfamily domain-containing protein 6-B OS=Danio rerio OX=7955 GN=mfsd6b PE=3 SV=1)

HSP 1 Score: 262.307 bits (669), Expect = 3.956e-75
Identity = 199/550 (36.18%), Postives = 296/550 (53.82%), Query Frame = 2
Query:  425 SAPFWGVIAERWXXXXXXXXXXXXXXXXFTVGIGFTRPIPEGCLLKG---KFP-NETIIKEPGDYGNQPQLLVSD----PKILYPKLMGQSP----IRLVDQN------------ILMELNAES---GNFVIPVYSP----------------IVYTTENIYQTFVILLVLLILGEFMSSPSLALADTAVLNYLKEDRENYGRQRLYGSVGWGLAMFCIGISLDQA---IKFHNHPCGWPGEREKNYVICFTIFSVFMCFSLITATQMTFTYDD---QSENMYFKVVKDKVSQTILGGKTKNRQHLINEPDDSEINRRKDDEILEQQLSIKLDKTNYQSKSEDPYEDNYQINNFDLNVWVGALKTFKSIRLISLLFLAWFMGFGVGIVFTFLFWHLQDIKGSPTLFGIASVINHISEILAYFFSGKLIASIGHTKVLYLGLLGNVVRFLYVSWIQNSWWILPFEMIQGLTHAAVWSACYSYMAQTTPKEYRNASQRILQGIHHGLGKXXXXXXXXXXXXXXXTPVLFRAYGIMCCFVLIGFLTINYFLAE 1927
            SAPFWG +A+R+KKGK ++L S++C ++F  GIGF +P    C+      + P N T     G++  Q + L  D    P +  P L    P    IR  + N            I M  N  +       +P+ S                 I++  E +   F+++L+++I+GEF S+P++ + DT  L YL ++R+ YG QR++GS+GWG+AM  +GI +D     I      C  P    KNY I F +F V M  +LI ATQ  F +D+   QS+    K    ++ Q I           ++ P+ S      DD  +         +TN Q     P++D ++I                 +R  ++LF+AWFMGFG G VFTFLFWHL+D+KG+ TLFGI SV++HISE+ AYF S KLI  +GH +VLY+GL  N  R+LY+S+++N+W +LP E++QGLTHA+VW+AC SY++   P   R ++Q ILQG+H GLG+GCG++ GG+ +  FG    FR  G+     L+ F  I + L +
Sbjct:   60 SAPFWGFVADRFKKGKAVLLFSVLCWVVFNCGIGFVKPAAMSCVSVDPTVQSPVNFTNYTHAGNHTRQRRYLTEDAYANPPLSQPILAAYRPHSRYIRSANTNTTSAPFRNSTVDISMASNLTTMSPSATKVPLKSTSTMETQAITAKVKQYIIIFNKEQVDTIFLLILLVIIIGEFFSAPAVTIVDTVTLQYLGQNRDRYGLQRMWGSLGWGIAMLSVGIWIDNTHITIFIQGLGCVLPDY--KNYQIAFIVFGVLMTSALIVATQ--FHFDNRAYQSDEEEDKKEDVEIPQVI---------QEVSSPESSS-----DDAPV-------CPETNPQ---HFPFKDLFRI--------------ICGVRYGTVLFVAWFMGFGYGFVFTFLFWHLEDLKGTTTLFGICSVLSHISELAAYFISHKLIELVGHIRVLYIGLACNTARYLYISYLENAWIVLPMEVLQGLTHASVWAACISYLSAAVPPALRTSAQGILQGLHLGLGRGCGAMLGGVFVNFFGAAETFRGLGMASLVTLLIFSLIQWLLGQ 567          
BLAST of Major facilitator superfamily domain containing protein vs. UniProt/SwissProt
Match: sp|Q1LUQ4|MFD6A_DANRE (Major facilitator superfamily domain-containing protein 6-A OS=Danio rerio OX=7955 GN=mfsd6a PE=3 SV=1)

HSP 1 Score: 249.21 bits (635), Expect = 4.921e-70
Identity = 145/373 (38.87%), Postives = 210/373 (56.30%), Query Frame = 2
Query:  818 GEFMSSPSLALADTAVLNYLKEDRENYGRQRLYGSVGWGLAMFCIGISLDQA---IKFHNHPCGWPGEREKNYVICFTIFSVFMCFSLITATQMTFTYDDQSENMYFKVVKDKVSQTILGGKTKNRQHLINEPDDSEINRRKDDEILEQQLSIKLDKTNYQSKSEDPYEDNYQINNFDLNVWVGALKTFKSIRLISLLFLAWFMGFGVGIVFTFLFWHLQDIKGSPTLFGIASVINHISEILAYFFSGKLIASIGHTKVLYLGLLGNVVRFLYVSWIQNSWWILPFEMIQGLTHAAVWSACYSYMAQTTPKEYRNASQRILQGIHHGLGKXXXXXXXXXXXXXXXTPVLFRAYGIMCCFVLIGFLTINYFLAE 1927
            GEF S+P++ + DT  L+YL   R+ YG QR++GS+GWGLAM CIGI +D     +   N  C    +  KNY I F +F V M  +LI ATQ  F       N               G +  N+Q  + +P  S   R  D   + Q                       + + +DL      ++    ++  ++LF+AWFMGFG G VFTFL+WHLQD+ G+ TLFGI SV++H+SE+ AYF S K I  +GH +VLY+GL  N  R+LY+S+++N+W +LP E++QG+THA+VW+AC SY++   P   R ++Q ILQG+H GLG+GCG++ GG+ +  FG    FR  G+    +L+ F  I Y   +
Sbjct:  309 GEFFSAPAITIVDTVTLHYLGPHRDRYGLQRMWGSLGWGLAMLCIGIWIDHTSTNLIIGNMECIM--KNYKNYHIAFIVFGVLMVIALIVATQFKFDVQHHDTNE--------------GQEVGNQQENV-QPRGSPGTRSTDTPTIVQA---------------------EEFHFWDL------MRLLCGVQYSTVLFVAWFMGFGYGFVFTFLYWHLQDLTGTTTLFGICSVLSHVSELAAYFTSHKFIELVGHIRVLYIGLACNTARYLYISYLENAWTVLPMEVLQGITHASVWAACISYLSAAVPPPLRTSAQGILQGLHLGLGRGCGAMVGGIFVNYFGVAETFRGIGMASLVILLIFSLIMYITGQ 637          

HSP 2 Score: 84.7297 bits (208), Expect = 1.520e-15
Identity = 54/111 (48.65%), Postives = 81/111 (72.97%), Query Frame = 2
Query:  221 NPTSKRDVLDMLLTHVNRTLLVFKLXXXXXXXXXGSLFPLISVYFKQLGLSATQCGILVGCRPFVEFISAPFWGVIAERWXXXXXXXXXXXXXXXXFTVGIGFTRPIPEGC 553
            +P  +    + L   VNR LLV K++Y F++AA+GSL PL+++Y+KQLG++ TQ G+LVG R F+EF SAPFWG++A+R++KGK ++L S++C +LF  GIG  +P    C
Sbjct:   51 SPQHELSCCERLFLRVNRHLLVSKVFYLFFYAAYGSLHPLLALYYKQLGMNPTQSGLLVGIRYFIEFCSAPFWGIVADRYRKGKAVLLFSMLCWILFNAGIGIVKPPIMAC 161          
BLAST of Major facilitator superfamily domain containing protein vs. TrEMBL
Match: A0A0V0J5I9 (MFS_1_like domain-containing protein OS=Schistocephalus solidus OX=70667 GN=TR85038 PE=4 SV=1)

HSP 1 Score: 528.48 bits (1360), Expect = 4.703e-174
Identity = 316/716 (44.13%), Postives = 437/716 (61.03%), Query Frame = 2
Query:  233 KRDVLDMLLTHVNRTLLVFKLXXXXXXXXXGSLFPLISVYFKQLGLSATQCGILVGCRPFVEFISAPFWGVIAERWXXXXXXXXXXXXXXXXFTVGIGFTRPIPEGCL--LKGKFPNET---------IIKEPGDYGNQPQLLVSDPK------ILYPKLMGQSPIRLVDQNI-------LMELNAES---------------------GNFVIPVYSPIVYTTENIYQTFVILLVLLILGEFMSSPSLALADTAVLNYLKEDREN-YGRQRLYGSVGWGLAMFCIGISLDQAIKFHNHPCGWPGEREKNYVICFTIFSVFMCFSLITATQMTFTYDDQSENMYFKVVKDKVSQTILGGKTKNRQHLINEPDDSEINR--------------------RKDDEILEQQLSIKLDKTNYQSK------SEDPY-EDNYQINNFDLNVWVGALKTFKSIRLISLLFLAWFMGFGVGIVFTFLFWHLQDIKGSPTLFGIASVINHISEILAYFFSGKLIASIGHTKVLYLGLLGNVVRFLYVSWIQNSWWILPFEMIQGLTHAAVWSACYSYMAQTTPKEYRNASQRILQGIHHGLGKXXXXXXXXXXXXXXXTPVLFRAYGIMCCFVLIGFLTINYFLAEI--SPTDPIKSVPNQSNFENSAPHEYYSGYDQPADSTTYVEEETFMSPHGIPFMPNNEYRNTENYNAI-KGNSNQAAF 2152
            KR+ L+ L + VNR+LL+FK +YF ++AAFGSLFPL+S+YFKQLG +ATQCG L G R  VE+I APFW  IAERWKKGK  ++ SL C + FT+G+GF RP PEGCL  L  KF  E+          I EP  Y   P   V   +      + +   +GQSP+ L  + +       ++ L+                        G+ ++P+YS +VYT   I Q F I ++L+  G F SSP++ LAD+AV+ +L+    N YGRQR++GSVGWGLAMF +GI+LDQA  F +HPC  PG RE+NY++CF +F+VFM  +L+ ATQ  F YD   E+MYFKV+KDKV++T+L    K+R  L+NE D  E  R                      +++ILEQQL I+LD+ +          + DP+ ED        +  W+  LK F + RL + LF+ WFMG G GIVFTFLFWHLQ++ GSPTL+GIAS+IN++SEI+AY+FS   I   GH KVLY GLL NV+RFLY+SWI N WW+LPFE + GLTHA +W+AC SY+AQ    +YR ++Q +LQGI+HGLGKG G++ GG II +FG+  LFRAYG    F+L+GFL +NYF+ E+    T P +          S P +  +      ++T++++E T+++P G PF+P +   +    N + +G  +   F
Sbjct:   25 KREFLEWLHSPVNRSLLLFKFFYFLFYAAFGSLFPLLSIYFKQLGFNATQCGALGGLRSLVEWIGAPFWSGIAERWKKGKFFLMASLFCWICFTLGLGFVRPKPEGCLVRLNSKFTEESANDSAYRNLFIFEP--YRQVPSESVESVEMQRYLALAWRNQIGQSPLHLNSEKLSDKADIAMLTLDKAGLNSRVTSFLNNPYHDPQHYPVGSLLMPLYSTVVYTQSKINQVFTISMILMAFGAFFSSPAICLADSAVMLFLEGQGTNLYGRQRMFGSVGWGLAMFFVGIALDQAQSFPDHPCLRPGHRERNYMVCFAVFTVFMSCALLVATQFQFPYDGAKESMYFKVMKDKVTKTLLRRTAKSRGKLVNEDDGGEDWRGDGQGYMYLDAEQSGTTAATTTNEDILEQQLGIRLDRADIHHSQMAGLPASDPFVEDLAATAQTKITQWLTVLKYFTNPRLATFLFVTWFMGLGSGIVFTFLFWHLQELGGSPTLYGIASIINYLSEIVAYYFSYPAIKRFGHIKVLYFGLLINVLRFLYISWIGNPWWVLPFEFVHGLTHAGIWAACCSYVAQCFEPQYRISTQGVLQGINHGLGKGVGALIGGPIISAFGSANLFRAYGAASAFILLGFLAMNYFVPEVINQETKPDQDAAANGMGNTSTPGQ-PTKTTSGGETTSFLDETTYLAPSGTPFIPASRTMSASRMNELARGTGDGGQF 737          
BLAST of Major facilitator superfamily domain containing protein vs. TrEMBL
Match: A0A0R3UN89 (Uncharacterized protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS9254 PE=4 SV=1)

HSP 1 Score: 521.161 bits (1341), Expect = 5.118e-171
Identity = 318/723 (43.98%), Postives = 446/723 (61.69%), Query Frame = 2
Query:  215 MENPTS-----KRDVLDMLLTHVNRTLLVFKLXXXXXXXXXGSLFPLISVYFKQLGLSATQCGILVGCRPFVEFISAPFWGVIAERWXXXXXXXXXXXXXXXXFTVGIGFTRPIPEGCLLK-----------GKFPNETIIKEPGDYGNQPQLLVSDPK---ILYPKL-MGQSPIRL--------------------VDQNILM------ELNAE-----SGNFVIPVYSPIVYTTENIYQTFVILLVLLILGEFMSSPSLALADTAVLNYLKEDREN-YGRQRLYGSVGWGLAMFCIGISLDQAIKFHNHPCGWPGEREKNYVICFTIFSVFMCFSLITATQMTFTYDDQSENMYFKVVKDKVSQTILGGKT-KNRQHLINE--PDDS---------EINRR---KDDEILEQQLSIKLDKTNYQSK-------SEDPY-EDNYQINNFDLNVWVGALKTFKSIRLISLLFLAWFMGFGVGIVFTFLFWHLQDIKGSPTLFGIASVINHISEILAYFFSGKLIASIGHTKVLYLGLLGNVVRFLYVSWIQNSWWILPFEMIQGLTHAAVWSACYSYMAQTTPKEYRNASQRILQGIHHGLGKXXXXXXXXXXXXXXXTPVLFRAYGIMCCFVLIGFLTINYFLAEISPTDPIKSV--PNQSNFENSAPHEYYSGYDQPADSTTYVEEETFMSPHGIPFMPNNEYRNTENYNAIKGNSNQAAF 2152
            ME P+      KR++L+   + +NR+LL+FKL+YF ++AAFGSLFPL+S+YFKQLGL+ATQCG L G R  VE++ APFW  IAERWKKGKL ++ISL   ++FT+G+GF RP PEGCL+             K   +  I EP       ++   + K    +Y K  +GQSP++L                    +D++ L       E  AE      G+ V+P++S +VY    I Q F++ ++L+ +G F SSP++ LAD+AV+ YL+E+  N YGRQR++GSVGWGLAMF +GI+LDQ+  F +HPC  PG REKNY++ F +F+VFM  + I A+Q +F YD  SE+MYFKVVKDKV++T+  G+  KNR  L+NE  PDD+          +N      +++ILEQQL IKLD+ +           + DP+ ED        +  ++  LK F   RL   LF+ WFMG G GIVF FLFWHLQ++ GSPTL+GIAS+IN++SEI+ Y+FS   I   GH ++LYLGLL NV+RFLYVSWI N WW+LPFE + G+T+A +W+A  SY+AQ+   +YR ++Q +LQG++HG GKG G+I GG I  ++GT  LFRAYG     +LIGFL INY + E + +D  K+    ++++   + P        +        +E  FMSP G PF+P +  R      A K ++N +AF
Sbjct:   15 METPSGGIRAVKRELLEWFHSPINRSLLIFKLFYFLFYAAFGSLFPLLSIYFKQLGLNATQCGSLGGVRSLVEWVGAPFWSGIAERWKKGKLFLMISLFSWIVFTLGLGFVRPQPEGCLVSVAGSRSHLKNASKHALDIRIMEPYREVTSDRIEAIEMKPYLAVYGKTRIGQSPLQLDLKKLFHNSSSSDGDLDSMSIDRSGLHARLTNNEAFAEPSHYPEGSLVMPLFSTVVYRQSKINQIFILAMILICIGAFFSSPAICLADSAVMTYLEENGLNVYGRQRMFGSVGWGLAMFFVGIALDQSQSFPDHPCLRPGRREKNYMVSFAVFTVFMSCAAIAASQFSFAYDGASESMYFKVVKDKVAKTLRRGRMGKNRGKLVNEDDPDDAYTKLSSGEPTVNAEASASNEDILEQQLGIKLDRGSLHRTDTLSTLPASDPFVEDLAATAQMKVTQYLAVLKQFTQPRLAIFLFVTWFMGIGAGIVFNFLFWHLQELGGSPTLYGIASIINYLSEIVTYYFSKPAIERFGHIRILYLGLLVNVLRFLYVSWIGNPWWVLPFEFVHGITNAGIWAASCSYIAQSFEPQYRISTQGVLQGLNHGFGKGLGAIIGGAITTAYGTGNLFRAYGAASAIILIGFLLINYLVKEKAASDDEKTAGTGDEASLATTDPLASQKALLKGGT----FDESAFMSPAGTPFIPAS--RTPAGVAAAK-STNTSAF 730          
BLAST of Major facilitator superfamily domain containing protein vs. TrEMBL
Match: A0A5K3FLI5 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 520.39 bits (1339), Expect = 7.977e-171
Identity = 319/721 (44.24%), Postives = 446/721 (61.86%), Query Frame = 2
Query:  215 MENPTS-----KRDVLDMLLTHVNRTLLVFKLXXXXXXXXXGSLFPLISVYFKQLGLSATQCGILVGCRPFVEFISAPFWGVIAERWXXXXXXXXXXXXXXXXFTVGIGFTRPIPEGCLLK-----------GKFPNETIIKEPGDYGNQPQLLVSDPK---ILYPKL-MGQSPIRL--------------------VDQNILM------ELNAE-----SGNFVIPVYSPIVYTTENIYQTFVILLVLLILGEFMSSPSLALADTAVLNYLKEDREN-YGRQRLYGSVGWGLAMFCIGISLDQAIKFHNHPCGWPGEREKNYVICFTIFSVFMCFSLITATQMTFTYDDQSENMYFKVVKDKVSQTILGGKT-KNRQHLINE--PDDS---------EINRR---KDDEILEQQLSIKLDKTNYQSK-------SEDPY-EDNYQINNFDLNVWVGALKTFKSIRLISLLFLAWFMGFGVGIVFTFLFWHLQDIKGSPTLFGIASVINHISEILAYFFSGKLIASIGHTKVLYLGLLGNVVRFLYVSWIQNSWWILPFEMIQGLTHAAVWSACYSYMAQTTPKEYRNASQRILQGIHHGLGKXXXXXXXXXXXXXXXTPVLFRAYGIMCCFVLIGFLTINYFLAEISPTDPIKSVPNQSNFENSAPHEYYSGYDQPADSTTYVEEETFMSPHGIPFMPNNEYRNTENYNAIKGNSNQAAF 2152
            ME P+      KR++L+   + +NR+LL+FKL+YF ++AAFGSLFPL+S+YFKQLGL+ATQCG L G R  VE++ APFW  IAERWKKGKL ++ISL   ++FT+G+GF RP PEGCL+             K   +  I EP       ++   + K    +Y K  +GQSP++L                    +D++ L       E  AE      G+ V+P++S +VY    I Q F++ ++L+ +G F SSP++ LAD+AV+ YL+E+  N YGRQR++GSVGWGLAMF +GI+LDQ+  F +HPC  PG REKNY++ F +F+VFM  + I A+Q +F YD  SE+MYFKVVKDKV++T+  G+  KNR  L+NE  PDD+          +N      +++ILEQQL IKLD+ +           + DP+ ED        +  ++  LK F   RL   LF+ WFMG G GIVF FLFWHLQ++ GSPTL+GIAS+IN++SEI+ Y+FS   I   GH ++LYLGLL NV+RFLYVSWI N WW+LPFE + G+T+A +W+A  SY+AQ+   +YR ++Q +LQG++HG GKG G+I GG I  ++GT  LFRAYG     +LIGFL INY + E + +D  K+     +  + A  +  +         T+ +E  FMSP G PF+P +  R      A K ++N +AF
Sbjct:   15 METPSGGIRAVKRELLEWFHSPINRSLLIFKLFYFLFYAAFGSLFPLLSIYFKQLGLNATQCGSLGGVRSLVEWVGAPFWSGIAERWKKGKLFLMISLFSWIVFTLGLGFVRPQPEGCLVSVAGSRSHLKNASKHALDIRIMEPYREVTSDRIEAIEMKPYLAVYGKTRIGQSPLQLDLKKLFHNSSSSDGDLDSMSIDRSGLHARLTNNEAFAEPSHYPEGSLVMPLFSTVVYRQSKINQIFILAMILICIGAFFSSPAICLADSAVMTYLEENGLNVYGRQRMFGSVGWGLAMFFVGIALDQSQSFPDHPCLRPGRREKNYMVSFAVFTVFMSCAAIAASQFSFAYDGASESMYFKVVKDKVAKTLRRGRMGKNRGKLVNEDDPDDAYTKLSSGEPTVNAEASASNEDILEQQLGIKLDRGSLHRTDTLSTLPASDPFVEDLAATAQMKVTQYLAVLKQFTQPRLAIFLFVTWFMGIGAGIVFNFLFWHLQELGGSPTLYGIASIINYLSEIVTYYFSKPAIERFGHIRILYLGLLVNVLRFLYVSWIGNPWWVLPFEFVHGITNAGIWAASCSYIAQSFEPQYRISTQGVLQGLNHGFGKGLGAIIGGAITTAYGTGNLFRAYGAASAIILIGFLLINYLVKEKAASDDEKTA-GTGDEASLATTDPLASQKALLKGGTF-DESAFMSPAGTPFIPAS--RTPAGVAAAK-STNTSAF 730          
BLAST of Major facilitator superfamily domain containing protein vs. TrEMBL
Match: W6URJ4 (Major facilitator superfamily domain-containing protein 6 OS=Echinococcus granulosus OX=6210 GN=EGR_09158 PE=4 SV=1)

HSP 1 Score: 508.064 bits (1307), Expect = 4.033e-166
Identity = 306/712 (42.98%), Postives = 427/712 (59.97%), Query Frame = 2
Query:  233 KRDVLDMLLTHVNRTLLVFKLXXXXXXXXXGSLFPLISVYFKQLGLSATQCGILVGCRPFVEFISAPFWGVIAERWXXXXXXXXXXXXXXXXFTVGIGFTRPIPEGCLLK---------GKFPNETIIKEP------------------GDYGN----QPQLLVSDPKILYPKLMGQS-----------PIRLVDQNILMELNAES-GNFVIPVYSPIVYTTENIYQTFVILLVLLILGEFMSSPSLALADTAVLNYLKEDREN-YGRQRLYGSVGWGLAMFCIGISLDQAIKFHNHPCGWPGEREKNYVICFTIFSVFMCFSLITATQMTFTYDDQSENMYFKVVKDKVSQTILGGKT-KNRQHLINEPDDSEINRRKD---------------------DEILEQQLSIKLDKTNYQSK-------SEDPY-EDNYQINNFDLNVWVGALKTFKSIRLISLLFLAWFMGFGVGIVFTFLFWHLQDIKGSPTLFGIASVINHISEILAYFFSGKLIASIGHTKVLYLGLLGNVVRFLYVSWIQNSWWILPFEMIQGLTHAAVWSACYSYMAQTTPKEYRNASQRILQGIHHGLGKXXXXXXXXXXXXXXXTPVLFRAYGIMCCFVLIGFLTINYFLAEISPTDPIKSVPNQSNFENSAPHEYYSGYDQPADSTTYVEEETFMSPHGIPFMPNNEYRNTENYNAIKGNSNQA 2146
            KR++L+   + +NR+LL+FKL+YF ++AAFGSLFPL+S+YFKQLGL+ATQCG L G R  VE++ APFW  IA+RWKKG L ++ISL+  ++FT+G+GF RP PEGCL+             P +  I EP                    YGN    Q  L ++  K+L+ +    S             R+ D+    ++N  S G+ V+P++S +VY    I Q F++ ++L+ +G F SSP++ LAD+AV++YL+E+  + YGRQR++GSVGWGLAMF +GI+LDQ+  F +HPC  PG REKNY++ F +F+VFM  + I  +Q+ F YD   E+MYFKV+KDKV++T+  G+  KNR  L+NE D  E   R D                     ++ILEQQL IKL+++  +         + DP+ ED        +  ++  LK F   RL   L + WFMG G GIVF FLFWHLQ++ GSPTL+GIAS+IN++SEI+ Y+FS   I   GH K+LYLGLL NV+RFLYVSWI N WW+LPFE + GLT+A VW+A  SY+AQ+   +YR ++Q +LQG++HG GKG G+I GG+I   FGT  LFRAYG     +LIGFL INY + E +      +   +   ++  P     G           +E  FMSP G PF+P +  R      A +   N +
Sbjct:   26 KRELLEWFHSPINRSLLIFKLFYFLFYAAFGSLFPLLSIYFKQLGLNATQCGSLGGARSLVEWVGAPFWSGIADRWKKGILFLMISLLSWVVFTLGLGFVRPQPEGCLVSVSGIQPKNSSDHPFDIRIMEPYREVTSERIEAIEMKPYLAVYGNTRIGQSPLELNLKKLLHKERSEGSLESMSIDRSGTHARVTDEEAFADINHYSEGSLVMPLFSTVVYRRSKINQIFIVAMILICVGAFFSSPAICLADSAVMSYLEENGPHLYGRQRMFGSVGWGLAMFFVGIALDQSQSFPDHPCLRPGRREKNYMVGFAVFTVFMSCAAIAGSQLRFAYDGAVESMYFKVMKDKVTKTLRRGRIGKNRGKLVNEDDGDEEEWRGDGGYSQVPSGSEGVAGEASASNEDILEQQLGIKLNRSRVERSNTLADLPASDPFVEDLAATAQTKITEYLTVLKQFTRPRLTFFLIVTWFMGIGSGIVFNFLFWHLQELGGSPTLYGIASIINYLSEIVTYYFSKPAIERFGHIKILYLGLLVNVLRFLYVSWIGNPWWVLPFEFVHGLTNAGVWAASCSYIAQSFESQYRISTQGVLQGVNHGFGKGLGAIIGGVITTYFGTGNLFRAYGATSALILIGFLLINYLVKEKTAA----TSEGEKTIDDKKPTLATGG---------TFDESAFMSPAGTPFIPAS--RTPAGVAATRSGPNNS 722          
BLAST of Major facilitator superfamily domain containing protein vs. TrEMBL
Match: A0A0R3WAW1 (MFS_1_like domain-containing protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS7720 PE=4 SV=1)

HSP 1 Score: 508.449 bits (1308), Expect = 4.102e-166
Identity = 309/713 (43.34%), Postives = 432/713 (60.59%), Query Frame = 2
Query:  233 KRDVLDMLLTHVNRTLLVFKLXXXXXXXXXGSLFPLISVYFKQLGLSATQCGILVGCRPFVEFISAPFWGVIAERWXXXXXXXXXXXXXXXXFTVGIGFTRPIPEGCLLK---------GKFPNETIIKEP------------------GDYGN----QPQLLVSDPKILYPKL-----------MGQSPIRLVDQNILMELNAES-GNFVIPVYSPIVYTTENIYQTFVILLVLLILGEFMSSPSLALADTAVLNYLKEDREN-YGRQRLYGSVGWGLAMFCIGISLDQAIKFHNHPCGWPGEREKNYVICFTIFSVFMCFSLITATQMTFTYDDQSENMYFKVVKDKVSQTILGGKT-KNRQHLINEPDDSEINRRKD---------------------DEILEQQLSIKLDKTNYQSK-------SEDPY-EDNYQINNFDLNVWVGALKTFKSIRLISLLFLAWFMGFGVGIVFTFLFWHLQDIKGSPTLFGIASVINHISEILAYFFSGKLIASIGHTKVLYLGLLGNVVRFLYVSWIQNSWWILPFEMIQGLTHAAVWSACYSYMAQTTPKEYRNASQRILQGIHHGLGKXXXXXXXXXXXXXXXTPVLFRAYGIMCCFVLIGFLTINYFLAEISPTDPIKSVPNQSNFENSAPHEYYSGYDQPADSTTYVEEETFMSPHGIPFMPNNEYRNTENYNAIKGNSNQAA 2149
            KR++L+   + +NR+LL+FKL+YF ++AAFGSLFPL+S+YFKQLGL+ATQCG L G R  VE++ APFW  IA+RWKKGKL ++ISL+  ++FT+G+GF RP PEGCL+             P +  I EP                    YGN    Q  L ++  K+L+ +               +  R  D+    +++  S G+ V+P++S +VY    I Q F+I ++L+ +G F SSP++ LAD+AV+ YL+E+  + YGRQR++GSVGWGLAMF +GI+LDQ+  F +HPC  PG REKNY++ F +F+VFM  + I  +Q+ F YD  SE+MYFKV+KDKV++T   G+  KNR  L+N+ D+ E   R D                     ++ILEQQL IKLD+   +         + DP+ ED        +  ++  LK F   RL   LF+ WFMG G GIVF+FLFWHLQ++ GSPTL+GIAS+IN++SEI+ Y+FS   I   GHTK+LYLGLL NV+RFLYVSWI N WW+LPFE + GLT+A VW+A  SY+ Q+   +YR ++Q +LQG++HG GKG G++FGG+I   FGT  LFRAYG    F+LIGFL INY + E +     +    ++    +            A   T+ +E  F+SP G PF+P +  R      A +   N A+
Sbjct:   26 KRELLEWFHSPINRSLLIFKLFYFLFYAAFGSLFPLLSIYFKQLGLNATQCGSLGGARSLVEWVGAPFWSGIADRWKKGKLFLMISLLSWIVFTLGLGFVRPQPEGCLVSVSGIHPRNSSDHPFDIRIMEPFREVTSERIEAIEMKPYLAVYGNTRIGQSPLELNLKKLLHKESSWGPFESMSLDRSGTHARFTDEEAFADISHYSEGSLVMPLFSTVVYRKSKINQIFIIAMILICVGAFFSSPAICLADSAVMTYLEENGPHLYGRQRMFGSVGWGLAMFFVGIALDQSQSFPDHPCLRPGRREKNYMVSFAVFTVFMSCAAIAGSQLRFAYDGASESMYFKVMKDKVAKTFRRGRMGKNRGKLVNQDDEDEEEWRGDGGYSQVQSGNGGTAGDAPASNEDILEQQLGIKLDRNKAERSDAITGLPASDPFVEDLAATAQTKITQYLTVLKQFTRPRLAFFLFVTWFMGIGSGIVFSFLFWHLQELGGSPTLYGIASIINYLSEIITYYFSKPAIERFGHTKILYLGLLVNVLRFLYVSWIGNPWWVLPFEFVHGLTNAGVWAASCSYITQSFEPQYRISTQGVLQGVNHGFGKGLGAVFGGVITTYFGTGNLFRAYGATSAFILIGFLLINYLVKEKAAATLEEEKTTEAEKTPTL-----------ATDGTF-DESAFISPAGTPFIPAS--RTPAAVAATRSGPNNAS 724          
BLAST of Major facilitator superfamily domain containing protein vs. Ensembl Cavefish
Match: mfsd6b (major facilitator superfamily domain containing 6 [Source:NCBI gene;Acc:103022376])

HSP 1 Score: 313.923 bits (803), Expect = 5.026e-95
Identity = 206/578 (35.64%), Postives = 304/578 (52.60%), Query Frame = 2
Query:  227 TSKRDVLDMLLTHVNRTLLVFKLXXXXXXXXXGSLFPLISVYFKQLGLSATQCGILVGCRPFVEFISAPFWGVIAERWXXXXXXXXXXXXXXXXFTVGIGFTRPIPEGCLLK----GKFPNETIIKEPGDYGNQPQLLVSDPKILYPKLMG-----QSPIRLVDQNILMELNAESGNFVIPVYSP--------------------------------------------IVYTTENIYQTFVILLVLLILGEFMSSPSLALADTAVLNYLKEDRENYGRQRLYGSVGWGLAMFCIGISLDQA-IKFHNHPCGWPGEREKNYVICFTIFSVFMCFSLITATQMTFTYDDQSENMYFKVVKDKVSQTILGGKTKNRQHLINEPDDSEINRRKDDEILEQQLSIKLDKTNYQSKSEDPYEDNYQINNFDLNVWVGALKTFKSIRLISLLFLAWFMGFGVGIVFTFLFWHLQDIKGSPTLFGIASVINHISEILAYFFSGKLIASIGHTKVLYLGLLGNVVRFLYVSWIQNSWWILPFEMIQGLTHAAVWSACYSYMAQTTPKEYRNASQRILQGIHHGLGK 1798
            +   D L  +   V+  LLV K++YFF++AA+GSL PL++VY+KQLG++ +Q G+LVG R F+EF SAPFWGV+A+R+ KGK ++L S+ C ++F  GIGF +P    C+ K        N T+   PG+     + L  +   L   + G      S  R +  N +  L+  +   V  V S                                             I+Y  E +   F+++L+++I+GEF S+P++ + DT  L YL   R+ YG QR++GS+GWG+AM  +GI +D   I       G      KNY   F +F V M  +LI +T   F   D        V + K                   P+D+EI        + Q LS        +S SE            DL      ++    +R  S+LF+AWFMGFG G VFTFL+WHL+D+KG+ TLFG+ +V++HISE+ AYF S KLI  +GH +VLY+GL  N  R+LY+S+++N+W +LP E++QGLTHA+VW+AC S+++   P   R ++Q ILQG+H GLG+
Sbjct:   57 SQSTDCLQRMCLRVDSRLLVSKVFYFFFYAAYGSLHPLLAVYYKQLGMTPSQSGLLVGIRYFIEFCSAPFWGVVADRFNKGKAVLLFSVFCWVVFNCGIGFVKPAAMTCVEKVPDAAPAANGTLPGPPGNQSRHRRELTEELFALPSLIQGLAEAHSSHNRYIRSNNISTLDVTTARNVTTVPSIDLLTTVSTTATTATSTTTKTTSTTTRTTSTTKSTSSTAKSKEYIIIYNKEQVETIFLVILLVIIIGEFFSAPAVTIVDTVTLQYLGTHRDRYGLQRMWGSLGWGIAMLSVGIWIDHTHITLIIQGVGCILPDYKNYRSAFIVFGVLMTLALIISTLFRFDSRDSQPASAETVEQQK-------------------PEDAEIPN------VVQNLS--------ESGSEQAPVCPESSRRPDL------IRLLCGVRYGSVLFVAWFMGFGYGFVFTFLYWHLEDLKGTTTLFGVCAVLSHISELTAYFISHKLIELVGHIRVLYIGLACNTARYLYISYLENAWIVLPMEVLQGLTHASVWAACISFLSAAVPPALRTSAQGILQGLHLGLGR 595          
BLAST of Major facilitator superfamily domain containing protein vs. Ensembl Cavefish
Match: mfsd6b (major facilitator superfamily domain containing 6 [Source:NCBI gene;Acc:103022376])

HSP 1 Score: 314.694 bits (805), Expect = 1.273e-94
Identity = 203/580 (35.00%), Postives = 306/580 (52.76%), Query Frame = 2
Query:  227 TSKRDVLDMLLTHVNRTLLVFKLXXXXXXXXXGSLFPLISVYFKQLGLSATQCGILVGCRPFVEFISAPFWGVIAERWXXXXXXXXXXXXXXXXFTVGIGFTRPIPEGCLLK----GKFPNETIIKEPGDYGNQPQLLVSDPKILYPKLMG-----QSPIRLVDQNILMELNAESGNFVIPVYSP--------------------------------------------IVYTTENIYQTFVILLVLLILGEFMSSPSLALADTAVLNYLKEDRENYGRQRLYGSVGWGLAMFCIGISLDQA-IKFHNHPCGWPGEREKNYVICFTIFSVFMCFSLITATQMTFTYDDQSENMYFKVVKDKVSQTILGGKTKNRQHLINEPDDSEINR--RKDDEILEQQLSIKLDKTNYQSKSEDPYEDNYQINNFDLNVWVGALKTFKSIRLISLLFLAWFMGFGVGIVFTFLFWHLQDIKGSPTLFGIASVINHISEILAYFFSGKLIASIGHTKVLYLGLLGNVVRFLYVSWIQNSWWILPFEMIQGLTHAAVWSACYSYMAQTTPKEYRNASQRILQGIHHGLGK 1798
            +   D L  +   V+  LLV K++YFF++AA+GSL PL++VY+KQLG++ +Q G+LVG R F+EF SAPFWGV+A+R+ KGK ++L S+ C ++F  GIGF +P    C+ K        N T+   PG+     + L  +   L   + G      S  R +  N +  L+  +   V  V S                                             I+Y  E +   F+++L+++I+GEF S+P++ + DT  L YL   R+ YG QR++GS+GWG+AM  +GI +D   I       G      KNY   F +F V M  +LI +T   F   D        V + K                   P+D+EI    +   E   +Q  +  + +    +   PY+D               ++    +R  S+LF+AWFMGFG G VFTFL+WHL+D+KG+ TLFG+ +V++HISE+ AYF S KLI  +GH +VLY+GL  N  R+LY+S+++N+W +LP E++QGLTHA+VW+AC S+++   P   R ++Q ILQG+H GLG+
Sbjct:   57 SQSTDCLQRMCLRVDSRLLVSKVFYFFFYAAYGSLHPLLAVYYKQLGMTPSQSGLLVGIRYFIEFCSAPFWGVVADRFNKGKAVLLFSVFCWVVFNCGIGFVKPAAMTCVEKVPDAAPAANGTLPGPPGNQSRHRRELTEELFALPSLIQGLAEAHSSHNRYIRSNNISTLDVTTARNVTTVPSIDLLTTVSTTATTATSTTTKTTSTTTRTTSTTKSTSSTAKSKEYIIIYNKEQVETIFLVILLVIIIGEFFSAPAVTIVDTVTLQYLGTHRDRYGLQRMWGSLGWGIAMLSVGIWIDHTHITLIIQGVGCILPDYKNYRSAFIVFGVLMTLALIISTLFRFDSRDSQPASAETVEQQK-------------------PEDAEIPNVVQNLSESGSEQAPVCPESSR---RPAFPYKD--------------LIRLLCGVRYGSVLFVAWFMGFGYGFVFTFLYWHLEDLKGTTTLFGVCAVLSHISELTAYFISHKLIELVGHIRVLYIGLACNTARYLYISYLENAWIVLPMEVLQGLTHASVWAACISFLSAAVPPALRTSAQGILQGLHLGLGR 600          
BLAST of Major facilitator superfamily domain containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000014300.2 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000051.1:874605:888776:1 gene:ENSAMXG00000013890.2 transcript:ENSAMXT00000014300.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 265.388 bits (677), Expect = 2.491e-78
Identity = 205/612 (33.50%), Postives = 315/612 (51.47%), Query Frame = 2
Query:  194 RLHLVTKMENPTSKR-DVLDMLLTHVNRTLLVFKLXXXXXXXXXGSLFPLISVYFKQLGLSATQCGILVGCRPFVEFISAPFWGVIAERWXXXXXXXXXXXXXXXXFTVGIGFTRPIPEGCLLKGKFPNETIIKEP---GDYGNQPQLLVSDPKILYPKL-MGQSPIRLV--DQNILMELNAESG---NF-------------------------VIPVYSPIV-YTTENIYQTFVILLVLLILGEFMSSPSLALADTAVLNYLKEDRENYGRQRLYGSV--GWGLAMFCIGISLDQAIKFHNHPCGWPGEREKNYVICFTIFSVFMCFSLITATQMTFTYDDQSENMYFKVVKDKVSQTILGGKTKNRQHLINEPDDSEINRRKDDEILEQQLSIKLDKTNYQSKSEDPYEDNYQINNFDLNVWVGALKTFKSIRLISLLFLAWFMGFGVGIVFTFLFWHLQDIKGSPTLFGIASVINHISEILAYFFSGKLIASIGHTKVLYLGLLGNVVRFLYVSWIQNSWWILPFEMIQGLTHAAVWSACYSYMAQTTPKEYRNASQRILQGIHHGLGKXXXXXXXXXXXXXXXTPVLFRAYGIMCCFVLIGFLTINY 1915
            RL L  + +  T+   +  + L   VNR LLV K++YFF++AA+GSL PL++VY+KQLG++ +  G+LVG R F+EF SAPFWGV+A+R++KGK ++L S+ C L+F  GIGF +P    C L+   P  +I   P      G Q   +       +  L    + +  V  D N+ + + + S    NF                            +  P++ Y ++ +   F+++L+++I+GEF S+P++ + DT  L YL   R+ YG QR++GS+  G  +    I I     I   +   G      KNY I       F+ F ++ A  +      Q                                     + R+ DE      +   D  + Q                    ++  L+    +R  ++LF+AWFMGFG G VFTFL+WHL+D+ G+PTLFG+ SV++H+SE+ AYF S KLI  +GH +VLY+GL  N  R+LY+S++QN+W +LP E++QG+THAAVW+AC SY++   P   R ++Q ILQG+H GLG+GCG++ GG+    FG    FR  G+    +L+ F  I +
Sbjct:   30 RLSLEVQDDTATTHELNCCERLFLRVNRHLLVSKVFYFFFYAAYGSLHPLLAVYYKQLGMNPSYSGLLVGIRYFIEFCSAPFWGVVADRYRKGKYVLLFSVFCWLMFNCGIGFVKPAAMSCTLQN--PTTSITLNPTIASTNGTQASTIAFTNVTQHRDLNFAYNSLERVKRDANVSLSMTSTSQPVQNFNTSPQSNTTQSSTTSSTSTPPPPPSTSTLEPPVIRYNSDQVEAIFLLILLVIIIGEFFSAPAVTIVDTITLQYLGPHRDRYGLQRMWGSLGWGLAMLFVGIWIDHTHVIYVIDGVVGCVMPDYKNYQI------AFIVFGILMAMALVVATQFQ------------------------------------FDIRRLDECSSSSRAESSDHASGQEFR-----------------YLELLRLLCGVRYSTVLFVAWFMGFGYGFVFTFLYWHLEDLNGTPTLFGVCSVLSHVSELAAYFTSHKLIELVGHIRVLYIGLACNTARYLYISYLQNAWTVLPMEVLQGVTHAAVWAACISYLSAAVPPALRTSAQGILQGLHLGLGRGCGAMVGGVFANYFGPAETFRGIGMASLVILLLFAFIQH 580          
BLAST of Major facilitator superfamily domain containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000057486.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000051.1:871799:885428:1 gene:ENSAMXG00000013890.2 transcript:ENSAMXT00000057486.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 243.047 bits (619), Expect = 5.163e-69
Identity = 145/389 (37.28%), Postives = 220/389 (56.56%), Query Frame = 2
Query:  755 IVYTTENIYQTFVILLVLLILGEFMSSPSLALADTAVLNYLKEDRENYGRQRLYGSVGWGLAMFCIGISLDQA--IKFHNHPCGWPGEREKNYVICFTIFSVFMCFSLITATQMTFTYDDQSENMYFKVVKDKVSQTILGGKTKNRQHLINEPDDSEINRRKDDEILEQQLSIKLDKTNYQSKSEDPYEDNYQINNFDLNVWVGALKTFKSIRLISLLFLAWFMGFGVGIVFTFLFWHLQDIKGSPTLFGIASVINHISEILAYFFSGKLIASIGHTKVLYLGLLGNVVRFLYVSWIQNSWWILPFEMIQGLTHAAVWSACYSYMAQTTPKEYRNASQRILQGIHHGLGKXXXXXXXXXXXXXXXTPVLFRAYGIMCCFVLIGFLTINY 1915
            I Y ++ +   F+++L+++I+GEF S+P++ + DT  L YL   R+ YG QR++GS+GWGLAM  +GI +D    I   +   G      KNY I F +F + M  +L+ ATQ  F +D +                            ++E  DSE ++           +   D  + Q                    ++  L+    +R  ++LF+AWFMGFG G VFTFL+WHL+D+ G+PTLFG+ SV++H+SE+ AYF S KLI  +GH +VLY+GL  N  R+LY+S++QN+W +LP E++QG+THAAVW+AC SY++   P   R ++Q ILQG+H GLG+GCG++ GG+    FG    FR  G+    +L+ F  I +
Sbjct:  382 IRYNSDQVEAIFLLILLVIIIGEFFSAPAVTIVDTITLQYLGPHRDRYGLQRMWGSLGWGLAMLFVGIWIDHTHVIYVIDGVVGCVMPDYKNYQIAFIVFGILMAMALVVATQ--FQFDIRR---------------------------LDECGDSENHQDTQSGGSSSSRAESSDHASGQEFR-----------------YLELLRLLCGVRYSTVLFVAWFMGFGYGFVFTFLYWHLEDLNGTPTLFGVCSVLSHVSELAAYFTSHKLIELVGHIRVLYIGLACNTARYLYISYLQNAWTVLPMEVLQGVTHAAVWAACISYLSAAVPPALRTSAQGILQGLHLGLGRGCGAMVGGVFANYFGPAETFRGIGMASLVILLLFAFIQH 724          

HSP 2 Score: 87.8113 bits (216), Expect = 2.057e-17
Identity = 61/128 (47.66%), Postives = 89/128 (69.53%), Query Frame = 2
Query:  221 NPTSKRDV--LDMLLTHVNRTLLVFKLXXXXXXXXXGSLFPLISVYFKQLGLSATQCGILVGCRPFVEFISAPFWGVIAERWXXXXXXXXXXXXXXXXFTVGIGFTRPIPEGCLLKGKFPNETIIKEP 598
             P S+ ++   + L   VNR LLV K++YFF++AA+GSL PL++VY+KQLG++ +  G+LVG R F+EF SAPFWGV+A+R++KGK ++L S+ C L+F  GIGF +P    C L+   P  +I   P
Sbjct:   56 TPMSQHELNCCERLFLRVNRHLLVSKVFYFFFYAAYGSLHPLLAVYYKQLGMNPSYSGLLVGIRYFIEFCSAPFWGVVADRYRKGKYVLLFSVFCWLMFNCGIGFVKPAAMSCTLQN--PTTSITLNP 181          
BLAST of Major facilitator superfamily domain containing protein vs. Ensembl Sea Lamprey
Match: mfsd6a (major facilitator superfamily domain containing 6a [Source:NCBI gene;Acc:100034426])

HSP 1 Score: 252.677 bits (644), Expect = 2.272e-73
Identity = 155/401 (38.65%), Postives = 228/401 (56.86%), Query Frame = 2
Query:  734 VIPVYSPIVYTTENIYQTFVILLVLLILGEFMSSPSLALADTAVLNYLKEDRENYGRQRLYGSVGWGLAMFCIGISLD----QAIKFHNHPCGWPGEREKNYVICFTIFSVFMCFSLITATQMTFTYDDQSENMYFKVVKDKVSQTILGGKTKNRQHLINEPDDSEINRRKDDEILEQQLSIKLDKTNYQSKSEDPYEDNYQINNFDLNVWVGALKTFKSIRLISLLFLAWFMGFGVGIVFTFLFWHLQDIKGSPTLFGIASVINHISEILAYFFSGKLIASIGHTKVLYLGLLGNVVRFLYVSWIQNSWWILPFEMIQGLTHAAVWSACYSYMAQTTPKEYRNASQRILQGIHHGLGKXXXXXXXXXXXXXXXTPVLFRAYGIMCCFVLIGFLTINYFLA 1924
            V P    IVY    +   F++LLVL+++GEF S+P++ + DT  L YL  +R+ YGRQR++GS+GWG  M  IG+ +D        +   PC  P     NY I F  F V M  +L+ ATQ  F Y         +  ++ + +T    ++    H+  EP DS    R+               T+  + +   Y   + +            K   ++R  S+L++ WFMGFG G VFTFLFWHL D+ G+PTLFG+ SV++H+SE+ AYFFS +LIA IGH +VLYLGL  N  R+LY+S++ N W++LP E++QG+THAA+W+AC SY++   P   R ++Q ILQG+H GLG+GCG++ GG+++  FG    FR  G+     L+ F  I + L 
Sbjct:  267 VDPTKYMIVYDQLELRTIFLLLLVLVLIGEFFSAPAITIVDTVTLLYLGRNRDRYGRQRMWGSLGWGACMLSIGLLIDYTDVDMTGWVEAPCLPP--EYHNYQIAFIAFGVTMTVALVVATQFHFDYK--------RFSREAIEET----ESIEIPHV--EPVDSTARERR---------------TSSSTTTVVKYRYGHLV------------KLLCNVRYGSVLYVTWFMGFGYGFVFTFLFWHLGDLGGTPTLFGVCSVLDHLSELTAYFFSHRLIALIGHVRVLYLGLACNTARYLYISYLVNPWYVLPMEILQGVTHAAIWAACISYLSAAVPPSLRTSAQGILQGLHLGLGRGCGAMLGGVMVNYFGAAETFRGIGMASLVTLLLFALIQWLLG 624          

HSP 2 Score: 83.1889 bits (204), Expect = 1.190e-16
Identity = 55/108 (50.93%), Postives = 80/108 (74.07%), Query Frame = 2
Query:  239 DVLDMLLTHVNRTLLVFKLXXXXXXXXXGSLFPLISVYFKQLGLSATQCGILVGCRPFVEFISAPFWGVIAERWXXXXXXXXXXXXXXXXFTVGIGFTRPIPEGCLLK 562
            D ++     +N  LL+ K +YFF+++A+GSLFPL+ VY+KQLG++A+Q G+LVG R F+EF SAP WG +A+R++KGK L+L SL+C + F++GIGF  P    C LK
Sbjct:   49 DWIERRCIKINDDLLISKAFYFFFYSAYGSLFPLLPVYYKQLGINASQSGLLVGIRYFIEFCSAPLWGALADRFQKGKHLLLFSLLCWIGFSLGIGFVHPATPHCTLK 156          
BLAST of Major facilitator superfamily domain containing protein vs. Ensembl Nematostella
Match: EDO42916 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S080])

HSP 1 Score: 176.792 bits (447), Expect = 1.641e-47
Identity = 162/592 (27.36%), Postives = 268/592 (45.27%), Query Frame = 2
Query:  269 NRTLLVFKLXXXXXXXXXGSLFPLISVYFKQLGLSATQCGILVGCRPFVEFISAPFWGVIAERWXXXXXXXXXXXXXXXXFTVGIGFTRPIPEGCLLKGKFPNETIIKEPGDYGNQPQLLVSDPKILYPKLMGQS------PIRLVDQNILMELNAESGNFV-IPVYSPIVYTTENIY------QTFVILLVLLILGEFMSSPSLALADTAVLNYLKEDRE--NYGRQRLYGSVGWGLAMFCIGISLDQAIKFHNHPCGWPGEREKNYVICFTIFSVFMCFSLITATQMTFTYDDQSENMYFKVVKDKVSQTILGGKTKNRQHLINEPDDSEINRRKDDEILEQQLSIKLDKTNYQSKSEDPYEDNYQINNFDLNVWVGALKTFKSIRLISLLFLAWFMGFGVGIVFTFLFWHLQDIKGSPTLFGIASVINHISEILAYFFSGKLIASIGHTKVLYLGLLGNVVRFLYVSWIQNSWWILPFEMIQGLTHAAVWSACYSYMAQTTPKEYRNASQRILQGIHHGLGKXXXXXXXXXXXXXXXTPVLFRAYGIMCCFVLIGFLTINYFLAEI-SPTDPIKSVPNQSNFENSAPHE 1996
            NR  L+ K +YFF+FAA GSL P +S+Y KQL L A+Q GI+ G +P++ F   P W  IA++++  +LL  IS             T  I  G L                Y   P  L  D  +       +S      P  +     + E+  +S +    P    I +   + Y      Q F+ LL++ +    +S PSL   D+A +  L+E+ E   YG+QRL+GS+GWG+  F +G ++    K H  P G    ++ NY  CF  +  FM  +L    ++ F                                        E N+ + D +L + + I       +  SE P   +           +  +++  +   +  L   +++G  +G++  FLFWHL+D+ G+  LF I S +N ++E+  YF S +LI+S G  +VL+LGL+    R  + ++++N W+++P E + G+T A VW++  S++  T+ +      Q IL  +H GLG GCG   GG  I + G P  F  +G++    L  ++ I++F  +  SP D  + V  + + E     E
Sbjct:   25 NRKYLIPKGFYFFFFAAQGSLLPYLSLYLKQLELPASQVGIITGIKPYIAFFFIPVWSAIADKYRISRLLFFIS-------------TIAINLGLL---------------SYAFAPMDLCEDKSLRNVTKFHRSVEFHGIPYNISYMERVTEMAQDSSDLTPWPQGDQIAFEGTDTYHSAKKTQVFLYLLLVTVFFTVISCPSLTFGDSATVQLLRENNETHKYGKQRLWGSIGWGMMAFLVGAAVS---KTHLCPPGSAKRKDVNYYPCFYTYGGFMLIALFIGLKLDF----------------------------------------EKNKSEPDNVLLEDIEIA------EHSSEPPQRKSV----------LKGIQSLMTAHYMIFLTTVFYVGIAMGLIKVFLFWHLKDLGGTQMLFSIMSGVNCVAEVTVYFLSSRLISSFGAVRVLWLGLMCYSFRLFFYAFVKNPWYVIPIETLSGVTTAGVWASLMSFVGNTSVEGATFTLQGILHSVHWGLGHGCGEFIGGFFISAVGAPRTFALFGVLSLADLGAYVLIDHFATKTESPGDGYEKVSTKKSPETGVDDE 529          
BLAST of Major facilitator superfamily domain containing protein vs. Ensembl Nematostella
Match: EDO43627 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RY34])

HSP 1 Score: 164.851 bits (416), Expect = 1.090e-44
Identity = 88/151 (58.28%), Postives = 112/151 (74.17%), Query Frame = 2
Query: 1448 FLFWHLQDIKGSPTLFGIASVINHISEILAYFFSGKLIASIGHTKVLYLGLLGNVVRFLYVSWIQNSWWILPFEMIQGLTHAAVWSACYSYMAQTTPKEYRNASQRILQGIHHGLGKXXXXXXXXXXXXXXXTPVLFRAYGIMCCFVLIGF 1900
            + F    ++ G PTLFGIAS+I+H+SEI+ YF  G+LI SIGH  VLY+GL GN VRFLY+SWIQN W +LP E++QGLTHAAVW++C SYM +  P  Y  ++Q ILQG+HHGLG+GCG+I GG++I  FGT   F  YGI C  VL+ F
Sbjct:  230 YFFVVFMNLGGPPTLFGIASLIDHLSEIICYFHVGRLINSIGHIPVLYIGLAGNFVRFLYISWIQNPWLVLPLEVLQGLTHAAVWASCTSYMGRIAPPGYSTSAQGILQGVHHGLGRGCGAIVGGVMIHHFGTNKTFSLYGIACLVVLVIF 380          

HSP 2 Score: 143.665 bits (361), Expect = 2.535e-37
Identity = 107/268 (39.93%), Postives = 148/268 (55.22%), Query Frame = 2
Query:  266 VNRTLLVFKLXXXXXXXXXGSLFPLISVYFKQLGLSATQCGILVGCRPFVEFISAPFWGVIAERWXXXXXXXXXXXXXXXXFTVGIGFTRPIPEGCLLKGKFPNETIIKEPGDYGNQPQLLV-SDPKILYPKLMGQSPIRLVDQNILMELNAESGNFVIPVYSPIVYTTENIYQTFVILLVLLILGEFMSSPSLALADTAVLNYLKEDRENYGRQRLYGSVGWGLAMFCIGISLD--QAIKFHNHPCGWPGEREKNYVICFTIFSVFM 1060
            +N+ LLV KL+YF Y+ A GS FPL+ VYFKQLG++    GILVGCRP VEF SAP  G +A+R  K K+L++ SL+C + FT  + F +P P  C               G+     + L  + PK   PK                  NA+S          +VY  + ++Q F++LL L I+GEF S+P++ LAD+A L  L E++E YGRQRL+GS+GWG AMF +G  +D  Q ++     CG      +NY + F  F VFM
Sbjct:    1 LNKKLLVSKLFYFCYWGAVGSFFPLLGVYFKQLGMNPYLSGILVGCRPMVEFFSAPILGSLADRLDKRKVLMIFSLMCWVSFTFSLAFIKPAPVTCRKYFVLTKNVSQITSGETSEVKKFLQPATPKEKEPKF-----------------NAKS---------SLVYDPDGVHQVFLVLLFLTIIGEFFSAPAITLADSATLGVLGENKELYGRQRLWGSLGWGTAMFLLGFVIDRLQGVEM----CG--EIISQNYTVGFYFFVVFM 236          
BLAST of Major facilitator superfamily domain containing protein vs. Ensembl Nematostella
Match: EDO37430 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFX7])

HSP 1 Score: 127.872 bits (320), Expect = 1.523e-30
Identity = 75/177 (42.37%), Postives = 105/177 (59.32%), Query Frame = 2
Query: 1361 ALKTFKSIRLISLLFLAWFMGFGVGIVFTFLFWHLQDIKGSPTLFGIASVINHISEILAYFFSGKLIASIGHTKVLYLGLLGNVVRFLYVSWIQNSWWILPFEMIQGLTHAAVWSACYSYMAQTTPKEYRNASQRILQGIHHGLGKXXXXXXXXXXXXXXXTPVLFRAYGIMCCFVL 1891
             L+  K+ + I  LF A ++GF +  + TFLFWHL+D+ G+  LF I S +N  +E+  YF S KLI  IGH KVLYLGL+   +R  Y S I   W +L  E++ G+T AAVW+AC SY++  +        Q IL G+H GLG G G + GG+++  +G P  F  +G  C  VL
Sbjct:  495 GLRALKNPKYIMFLFTALYLGFLMAFIKTFLFWHLKDLGGTQLLFSIISAVNCFAEVSMYFLSAKLIKKIGHAKVLYLGLICYSIRLFYYSAIPIPWLVLVVELLPGITTAAVWAACLSYVSLNSGPGAATTMQCILHGVHWGLGYGAGEVIGGVMVHHYGAPFTFVFFGCFCIIVL 671          

HSP 2 Score: 103.219 bits (256), Expect = 9.571e-23
Identity = 50/137 (36.50%), Postives = 80/137 (58.39%), Query Frame = 2
Query: 1385 RLISLLFLAWFMGFGVGIVFTFLFWHLQDIKGSPTLFGIASVINHISEILAYFFSGKLIASIGHTKVLYLGLLGNVVRFLYVSWIQNSWWILPFEMIQGLTHAAVWSACYSYMAQTTPKEYRNASQRILQGIHHGLG 1795
            R +  L +A+  GF +    TFLFWHL+++ G+  LF I + +N I+E+  YF S KL+  I HT+VLY+G L   +R      I + W +L  E++ G+T AA W+A  +++++ +   Y    Q ++  IH GLG
Sbjct:  123 RFLMFLLVAFHFGFMIAFTKTFLFWHLKELGGTQLLFCIITAVNCIAEVTMYFLSAKLLTFITHTRVLYMGFLCYAIRAFAYYLITSPWMVLTVEILSGITSAASWAAMLAFVSENSTPGYTATFQGVIHAIHWGLG 259          

HSP 3 Score: 75.485 bits (184), Expect = 4.872e-14
Identity = 41/113 (36.28%), Postives = 58/113 (51.33%), Query Frame = 2
Query:  785 TFVILLVLLILGEFMSSPSLALADTAVLNYLKEDRENYGRQRLYGSVGWGLAMFCIGISLDQAIKFHNHPCGWPGERE-KNYVICFTIFSVFMCFSLITATQMTFTYDDQSEN 1120
             F+ L ++   G   SSP+LAL DTA +  L ++   YG QRL GS+GWG+  F +G SL        H C      E  +Y+ CF  F+V M   L+ AT+  F    Q+ +
Sbjct:  381 AFITLFLITFFGTLFSSPTLALVDTATIQLLGKETYKYGMQRLTGSIGWGIGAFVVGASLKT-----THKCSNDISYEIVDYIPCFYTFAVLMFLGLVVATRYKFDESAQTSH 488          

HSP 4 Score: 70.0922 bits (170), Expect = 2.230e-12
Identity = 41/103 (39.81%), Postives = 62/103 (60.19%), Query Frame = 2
Query:  797 LLVLLILGEFMSSPSLALADTAVLNYLKEDRENYGRQRLYGSVGWGLAMFCIGISLDQAIKFHNHPCGWPGEREKNYVICFTIFSVFMCFSLITATQMTFTYD 1105
            +L+LLI G  ++SPSL+LADT  ++ L  D+  YG QRL+GS+G+G+A F IG +L  A  +     G     + +Y  CF  F+ F+  +LIT+ +  F  D
Sbjct:    1 VLLLLIFGNIIASPSLSLADTVTMHNLGGDKHRYGVQRLWGSLGFGVAAFGIG-ALVSARGYCMGDSGDSQTVDVDYTPCFYSFAAFLSCALITSFKFNFPND 102          

HSP 5 Score: 54.299 bits (129), Expect = 1.754e-7
Identity = 23/45 (51.11%), Postives = 33/45 (73.33%), Query Frame = 2
Query:  323 GSLFPLISVYFKQLGLSATQCGILVGCRPFVEFISAPFWGVIAER 457
            GSL P +++YFKQL LS ++ GIL+G +PFV F+  P WG I ++
Sbjct:  299 GSLLPYLALYFKQLMLSPSEVGILMGLKPFVNFLVIPIWGAIVDK 343          
BLAST of Major facilitator superfamily domain containing protein vs. Ensembl Nematostella
Match: EDO37839 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEM6])

HSP 1 Score: 115.546 bits (288), Expect = 9.362e-27
Identity = 69/209 (33.01%), Postives = 115/209 (55.02%), Query Frame = 2
Query: 1361 ALKTFKSIRLISLLFLAWFMGFGVGIVFTFLFWHLQDIKGSPTLFGIASVINHISEILAYFFSGKLIASIGHTKVLYLGLLGNVVRFLYVSWIQNSWWILPFEMIQGLTHAAVWSACYSYMAQTTPKEYRNASQRILQGIHHGLGKXXXXXXXXXXXXXXXTPVLFRAYGIMCCFVLIGFLTINYFLAEISPTDPIKSVPNQSNFENSA 1987
             LK F +++  S +F+  F+GF   +  +FLFW LQDI G+P LF +  ++N +SE+  + +S   +  IG+  +LY+GL    VRFL+ S+I+  W++LP E++QG T+  VW+A  SY+       Y    Q I+ G++ GLG   G + GG+++ ++G  + FR        +L+ F  +N         +  + VP +   EN A
Sbjct:  413 GLKVFCNVKNASFIFVLLFLGFSHSLQLSFLFWFLQDIGGTPMLFTMVMLVNSLSEVFMFLWSTYAVQRIGNDGMLYVGLGCYGVRFLFYSYIEQPWYVLPLEILQGATYGGVWTASVSYVPPN--PAYSATVQGIIHGVYWGLGMAIGGVLGGVLVHTYGARITFRMEAACAFAILVSFFVLNRVYYR-RMDNRYQQVPTRETEENGA 618          

HSP 2 Score: 63.5438 bits (153), Expect = 2.056e-10
Identity = 34/67 (50.75%), Postives = 48/67 (71.64%), Query Frame = 2
Query:  254 LLTHVNRTLLVFKLXXXXXXXXXGSLFPLISVYFKQLGLSATQCGILVGCRPFVEFISAPFWGVIAE 454
            LL  VN+ LLV KL +FF+F A G+  P + VY+KQL L+A + GIL+G RPF++ + +P WGVI +
Sbjct:   42 LLNKVNKELLVPKLSFFFFFMATGAFLPYLGVYYKQLWLNARESGILLGIRPFIKMLCSPLWGVITD 108          

HSP 3 Score: 60.4622 bits (145), Expect = 1.941e-9
Identity = 33/108 (30.56%), Postives = 55/108 (50.93%), Query Frame = 2
Query:  752 PIVYTTENIYQTFVILLVLLILGEFMSSPSLALADTAVLNYLKEDRENYGRQRLYGSVGWGLAMFCIGISLDQAIKFHNHPCGWPGEREKNYVICFTIFSVFMCFSLI 1075
            P  +   +  + FV LLV++I+GE +++P+  L D+  L+ L      YG+QRL+GS+GWG      G  +        H C +      NYV  F +F++ M  + +
Sbjct:  290 PDDFRVRDNAKIFVTLLVIVIMGETVAAPAPMLTDSGTLSLLTGKEHEYGKQRLFGSLGWGAGALVAGFVVTAF-----HSCQY--SDNINYVPVFYVFALAMFLNFV 390          
BLAST of Major facilitator superfamily domain containing protein vs. Ensembl Nematostella
Match: EDO42972 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S081])

HSP 1 Score: 111.309 bits (277), Expect = 1.321e-25
Identity = 83/293 (28.33%), Postives = 143/293 (48.81%), Query Frame = 2
Query:  266 VNRTLLVFKLXXXXXXXXXGSLFPLISVYFKQLGLSATQCGILVGCRPFVEFISAPFWGVIAERWXXXXXXXXXXXXXXXXFTVGIGFTRPIPEGCLLKGKFPNETIIKEPGDYGNQPQLLVSDPKILYPKLMGQSPIRLVDQNILMELNAESGNFVIP-----VYSPIVYTTENIY---QTFVILLVLLILGEFMSSPSLALADTAVLNYLKEDRENYGRQRLYGSVGWGLAMFCIGISLDQAIKFHNHPCGWPGEREKNYVICFTIFSVFMCFSLITATQMTFTYDDQSEN 1120
            +NR +LV K +Y  ++   G+L+P + +YFKQL LS  Q G+L+G RP ++F++ P WGVIA+R+       +I L+  L + +        P+           TI+ E     +  ++ +      Y     ++     + +  M +  + GN   P     +  P+    +N+      F  L V+ ++G  +S+P+  +ADTA L  L+     YG  RL+GS+GWG+  F +G ++      +NH     GE   +Y+ CF ++ V M  +LI ATQ  +  D  +E+
Sbjct:   43 INRRVLVPKAFYTSFYTGIGALYPYLPMYFKQLHLSPNQTGMLIGSRPLIQFLATPVWGVIADRF---CKGKVILLMSVLGWLLSNALLALAPD--------TRHTIVCEYDPLSDDERMPLRRQLTPYKTFTSKAVTWSRNHSRNMSIQ-DHGNLPRPWALQLMDEPVTSLHDNVTAENHVFTYLFVVTVVGTLVSAPTHVMADTATLTTLEGQLHKYGGIRLWGSLGWGIGGFSVGAAVS-----NNHQSRCNGEVVIDYLPCFYVYIVAMATALICATQFQYNADSGAES 318          

HSP 2 Score: 102.834 bits (255), Expect = 6.503e-23
Identity = 59/187 (31.55%), Postives = 104/187 (55.61%), Query Frame = 2
Query: 1355 VGALKTFKSIRLISLLFLAWFMGFGVGIVFTFLFWHLQDIKGSPTLFGIASVINHISEILAYFFSGKLIASIGHTKVLYLGLLGNVVRFLYVSWIQNSWWILPFEMIQGLTHAAVWSACYSYMAQTTPKEYRNASQRILQGIHHGLGKXXXXXXXXXXXXXXXTPVLFRAYGIMCCFVLIGFLTINY 1915
            + AL+  +  +   +L +A++ G   G + TFLFW+L ++ G   L+ + +  N  +E+L +  + +LI  +G   ++YL L    +RF+Y   + + WW+LP E++QG+T AA W+AC SY+       +    Q IL  ++ GLG   G  FGG+++   G P  F  +G     +L+ F+T+N+
Sbjct:  325 MAALQVLRCPQHCCVLVIAFYCGSATGFIETFLFWYLHELGGDQLLYSVVNGTNCAAEVLVFMITDRLITRLGQVTIIYLALACYALRFVYFYCLTSPWWVLPAEILQGITTAAFWAACVSYIGLHPGASH--TLQGILNAMYMGLGFAAGGFFGGVVVHLVGLPDAFLVFGAASLVLLVIFVTLNH 509          
BLAST of Major facilitator superfamily domain containing protein vs. Ensembl Medaka
Match: mfsd6b (major facilitator superfamily domain containing 6 [Source:NCBI gene;Acc:101169093])

HSP 1 Score: 315.079 bits (806), Expect = 9.590e-96
Identity = 224/594 (37.71%), Postives = 331/594 (55.72%), Query Frame = 2
Query:  239 DVLDMLLTHVNRTLLVFKLXXXXXXXXXGSLFPLISVYFKQLGLSATQCGILVGCRPFVEFISAPFWGVIAERWXXXXXXXXXXXXXXXXFTVGIGFTRPIPEGCL------LKGKFPNETIIKEPGDYGNQPQLLVSDPKILYPKLMGQSPIRLVDQNILMELNAESGNFVIPVYSP---------------------------IVYTTENIYQTFVILLVLLILGEFMSSPSLALADTAVLNYLKEDRENYGRQRLYGSVGWGLAMFCIGISLDQA---IKFHNHPCGWPGEREKNYVICFTIFSVFMCFSLITATQMTFTYDDQSENMYFKVVKDKVSQTILGGKTKNRQHLINEPDDSEINRRKDDEILEQQLSIKLDKTNYQSKSEDPYEDNYQINNFDLNVWVGALKTFKSIRLISLLFLAWFMGFGVGIVFTFLFWHLQDIKGSPTLFGIASVINHISEILAYFFSGKLIASIGHTKVLYLGLLGNVVRFLYVSWIQNSWWILPFEMIQGLTHAAVWSACYSYMAQTTPKEYRNASQRILQGIHHGLGKXXXXXXXXXXXXXXXTPVLFRAYGIMCCFVLIGFLTIN 1912
            D  + L   VN  LL+ K++YFF++AA+GSL PL++VY+KQLG+SA++ G+LVG R F+EF SAPFWG++A+R+KKGK ++L S++C L+F  GIGF  P    C+           P  + + +P +  N        P      ++  +   L+     +ELNA S       YSP                           IV+  + +   F+I+L+++I+GEF S+P++ + DT  L YL + R+ YG QR++GS+GWGLAM  +GI +D     I+ H   C  P  R  NY I F +F V M  + + ATQ  F    +    Y   V D V ++       N Q     P DS  + +  +                   SE P E NY     DL      L+   ++R  S+LF+AWFMGFG G VF+FL+WHL+D+KG+ TLFG+ SV++HISE+ AYF S K I  +GH +VLY+GL  N  R+LY+S+++N+W +LP E++QG+THA+VW+AC S+++   P   R ++Q ILQG+H GLG+GCG++ GG+ +  FG    FR  G+    +L+ F  I 
Sbjct:   61 DCCERLCLRVNSHLLISKVFYFFFYAAYGSLHPLLAVYYKQLGMSASRSGLLVGIRYFIEFCSAPFWGIVADRFKKGKAVLLFSVLCWLVFNCGIGFVNPADMQCVEVSGSSTTTAVPTVSNVTQPSNSTN--------PTRNRRSVLDWTVGVLLRHERSVELNATSAP-----YSPTNSTENSTAPSTTTSTQPPTTPMKEYQIVFNQDQVEAIFLIILLVIIVGEFFSAPAVTIVDTVTLQYLGKARDRYGLQRMWGSLGWGLAMLLVGIWIDNTHVVIQTHIEGCVPPDYRLHNYRIAFIVFGVLMGVAFVVATQFYF----EPGADYTPEVPDVVEES------PNSQ----TPTDSSSSNQTPN------------------GSEAPQEFNYS----DL------LRLLCTVRYSSVLFVAWFMGFGYGFVFSFLYWHLEDLKGTTTLFGVCSVLSHISELGAYFTSHKFIELVGHVRVLYIGLACNTARYLYISYLENAWIVLPMEVLQGVTHASVWAACISFLSAAVPPALRTSAQGILQGLHLGLGRGCGAMVGGVFVNYFGAAETFRGIGMASLVILLIFSLIQ 599          
BLAST of Major facilitator superfamily domain containing protein vs. Planmine SMEST
Match: SMESG000010822.1 (SMESG000010822.1)

HSP 1 Score: 1226.46 bits (3172), Expect = 0.000e+0
Identity = 648/649 (99.85%), Postives = 648/649 (99.85%), Query Frame = 2
Query:  215 MENPTSKRDVLDMLLTHVNRTLLVFKLXXXXXXXXXGSLFPLISVYFKQLGLSATQCGILVGCRPFVEFISAPFWGVIAERWXXXXXXXXXXXXXXXXFTVGIGFTRPIPEGCLLKGKFPNETIIKEPGDYGNQPQLLVSDPKILYPKLMGQSPIRLVDQNILMELNAESGNFVIPVYSPIVYTTENIYQTFVILLVLLILGEFMSSPSLALADTAVLNYLKEDRENYGRQRLYGSVGWGLAMFCIGISLDQAIKFHNHPCGWPGEREKNYVICFTIFSVFMCFSLITATQMTFTYDDQSENMYFKVVKDKVSQTILGGKTKNRQHLINEPDDSEINRRKDDEILEQQLSIKLDKTNYQSKSEDPYEDNYQINNFDLNVWVGALKTFKSIRLISLLFLAWFMGFGVGIVFTFLFWHLQDIKGSPTLFGIASVINHISEILAYFFSGKLIASIGHTKVLYLGLLGNVVRFLYVSWIQNSWWILPFEMIQGLTHAAVWSACYSYMAQTTPKEYRNASQRILQGIHHGLGKXXXXXXXXXXXXXXXTPVLFRAYGIMCCFVLIGFLTINYFLAEISPTDPIKSVPNQSNFENSAPHEYYSGYDQPADSTTYVEEETFMSPHGIPFMPNNEYRNTENYNAIKGNSNQAAFRPF 2161
            MENPTSKRDVLDMLLTHVNRTLLVFKLYYFFYFAAFGSLFPLISVYFKQLGLSATQCGILVGCRPFVEFISAPFWGVIAERWKKGKLLILISLICGLLFTVGIGFTRPIPEGCLLKGKFPNETIIKEPGDYGNQPQLLVSDPKILYPKLMGQSPIRLVDQNILMELNAESGNFVIPVYSPIVYTTENIYQTFVILLVLLILGEFMSSPSLALADTAVLNYLKEDRENYGRQRLYGSVGWGLAMFCIGISLDQAIKFHNHPCGWPGEREKNYVICFTIFSVFMCFSLITATQMTFTYDDQSENMYFKVVKDKVSQTILGGKTKNRQHLINEPDDSEINRRKDDEILEQQLSIKLDKTNYQSKSEDPYEDNYQINNFDLNVWVGALKTFKSIRLISLLFLAWFMGFGVGIVFTFLFWHLQDIKGSPTLFGIASV NHISEILAYFFSGKLIASIGHTKVLYLGLLGNVVRFLYVSWIQNSWWILPFEMIQGLTHAAVWSACYSYMAQTTPKEYRNASQRILQGIHHGLGKGCGSIFGGMIIGSFGTPVLFRAYGIMCCFVLIGFLTINYFLAEISPTDPIKSVPNQSNFENSAPHEYYSGYDQPADSTTYVEEETFMSPHGIPFMPNNEYRNTENYNAIKGNSNQAAFRPF
Sbjct:    1 MENPTSKRDVLDMLLTHVNRTLLVFKLYYFFYFAAFGSLFPLISVYFKQLGLSATQCGILVGCRPFVEFISAPFWGVIAERWKKGKLLILISLICGLLFTVGIGFTRPIPEGCLLKGKFPNETIIKEPGDYGNQPQLLVSDPKILYPKLMGQSPIRLVDQNILMELNAESGNFVIPVYSPIVYTTENIYQTFVILLVLLILGEFMSSPSLALADTAVLNYLKEDRENYGRQRLYGSVGWGLAMFCIGISLDQAIKFHNHPCGWPGEREKNYVICFTIFSVFMCFSLITATQMTFTYDDQSENMYFKVVKDKVSQTILGGKTKNRQHLINEPDDSEINRRKDDEILEQQLSIKLDKTNYQSKSEDPYEDNYQINNFDLNVWVGALKTFKSIRLISLLFLAWFMGFGVGIVFTFLFWHLQDIKGSPTLFGIASVFNHISEILAYFFSGKLIASIGHTKVLYLGLLGNVVRFLYVSWIQNSWWILPFEMIQGLTHAAVWSACYSYMAQTTPKEYRNASQRILQGIHHGLGKGCGSIFGGMIIGSFGTPVLFRAYGIMCCFVLIGFLTINYFLAEISPTDPIKSVPNQSNFENSAPHEYYSGYDQPADSTTYVEEETFMSPHGIPFMPNNEYRNTENYNAIKGNSNQAAFRPF 649          
The following BLAST results are available for this feature:
BLAST of Major facilitator superfamily domain containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MFSD61.821e-10136.48major facilitator superfamily domain containing 6 ... [more]
MFSD61.821e-10136.48major facilitator superfamily domain containing 6 ... [more]
MFSD69.074e-4650.00major facilitator superfamily domain containing 6 ... [more]
MFSD61.046e-1852.38major facilitator superfamily domain containing 6 ... [more]
MFSD68.862e-1444.71major facilitator superfamily domain containing 6 ... [more]
back to top
BLAST of Major facilitator superfamily domain containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mfsd-61.746e-8032.74Major Facilitator Superfamily Domain containing ho... [more]
back to top
BLAST of Major facilitator superfamily domain containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
jef5.867e-13542.57gene:FBgn0033958 transcript:FBtr0309056[more]
jef5.867e-13542.57gene:FBgn0033958 transcript:FBtr0087476[more]
Sugb8.534e-1327.36gene:FBgn0036191 transcript:FBtr0273362[more]
Sugb1.110e-1227.36gene:FBgn0036191 transcript:FBtr0344966[more]
Sugb1.165e-1227.36gene:FBgn0036191 transcript:FBtr0300100[more]
back to top
BLAST of Major facilitator superfamily domain containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
mfsd6b5.241e-7636.18major facilitator superfamily domain containing 6b... [more]
mfsd6a6.519e-7138.87major facilitator superfamily domain containing 6a... [more]
back to top
BLAST of Major facilitator superfamily domain containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
MFSD67.432e-10137.73major facilitator superfamily domain containing 6 ... [more]
MFSD62.007e-10037.73major facilitator superfamily domain containing 6 ... [more]
MFSD6L8.838e-825.97major facilitator superfamily domain containing 6-... [more]
back to top
BLAST of Major facilitator superfamily domain containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Mfsd69.259e-10136.94major facilitator superfamily domain containing 6 ... [more]
Mfsd61.436e-10036.94major facilitator superfamily domain containing 6 ... [more]
Mfsd63.064e-8239.90major facilitator superfamily domain containing 6 ... [more]
Mfsd6l4.601e-631.48major facilitator superfamily domain containing 6-... [more]
back to top
BLAST of Major facilitator superfamily domain containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A1DWM3|MFSD6_PIG4.009e-10135.94Major facilitator superfamily domain-containing pr... [more]
sp|Q6ZSS7|MFSD6_HUMAN8.746e-10136.48Major facilitator superfamily domain-containing pr... [more]
sp|Q8CBH5|MFSD6_MOUSE6.476e-10036.94Major facilitator superfamily domain-containing pr... [more]
sp|B0UYT5|MFD6B_DANRE3.956e-7536.18Major facilitator superfamily domain-containing pr... [more]
sp|Q1LUQ4|MFD6A_DANRE4.921e-7038.87Major facilitator superfamily domain-containing pr... [more]
back to top
BLAST of Major facilitator superfamily domain containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0V0J5I94.703e-17444.13MFS_1_like domain-containing protein OS=Schistocep... [more]
A0A0R3UN895.118e-17143.98Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A5K3FLI57.977e-17144.24Uncharacterized protein OS=Mesocestoides corti OX=... [more]
W6URJ44.033e-16642.98Major facilitator superfamily domain-containing pr... [more]
A0A0R3WAW14.102e-16643.34MFS_1_like domain-containing protein OS=Taenia asi... [more]
back to top
BLAST of Major facilitator superfamily domain containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
mfsd6b5.026e-9535.64major facilitator superfamily domain containing 6 ... [more]
mfsd6b1.273e-9435.00major facilitator superfamily domain containing 6 ... [more]
ENSAMXT00000014300.22.491e-7833.50pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000057486.15.163e-6937.28pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of Major facilitator superfamily domain containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mfsd6a2.272e-7338.65major facilitator superfamily domain containing 6a... [more]
back to top
BLAST of Major facilitator superfamily domain containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Major facilitator superfamily domain containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO429161.641e-4727.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO436271.090e-4458.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO374301.523e-3042.37Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO378399.362e-2733.01Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO429721.321e-2528.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Major facilitator superfamily domain containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mfsd6b9.590e-9637.71major facilitator superfamily domain containing 6 ... [more]
back to top
BLAST of Major facilitator superfamily domain containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000010822.10.000e+099.85SMESG000010822.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027945 ID=SMED30027945|Name=Major facilitator superfamily domain containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2375bp
TTCTCTTCTCATAGACTCTCATTTGGTTCGTGTAGTTGCTTATTGTCATC
CCGTAAGAGGCTATGAATTTCTTCTATTAAATCATGTTGTATTGAATTCG
AAGAAATTGCTCTAGCTTATTTGTTTGCAAATATCCCATTATTAGTTAAA
TTGCTTTTCTATTTCACTAACTTAATAAACTTTAAAGGATTTTAGACTTC
ATTTAGTTACTAAAATGGAAAATCCGACTAGTAAAAGAGACGTTCTAGAC
ATGCTTCTTACACATGTTAATAGAACGTTGCTGGTATTTAAACTGTATTA
TTTTTTCTACTTCGCTGCATTTGGATCGTTGTTTCCTCTGATTTCAGTAT
ACTTCAAACAACTTGGACTTAGTGCTACTCAATGTGGAATATTAGTCGGA
TGTAGACCATTTGTTGAATTTATCAGTGCTCCATTTTGGGGTGTTATTGC
TGAGCGTTGGAAAAAAGGAAAATTATTAATTTTAATATCTTTGATATGTG
GATTGCTATTTACGGTTGGAATTGGATTTACTCGACCTATTCCGGAAGGC
TGTTTGTTGAAAGGGAAATTTCCAAATGAAACCATAATTAAAGAACCTGG
TGATTATGGAAATCAACCCCAATTGCTAGTAAGTGATCCTAAAATTCTTT
ATCCAAAGTTGATGGGTCAATCCCCAATAAGATTAGTTGATCAAAATATT
TTAATGGAACTTAATGCAGAATCTGGAAACTTTGTAATTCCGGTTTATTC
TCCAATAGTATATACAACAGAAAATATTTACCAAACATTTGTTATTCTTC
TCGTTCTTCTGATTCTAGGTGAATTCATGAGCTCTCCATCATTGGCTTTA
GCCGATACGGCAGTGCTAAATTATCTAAAAGAAGATCGAGAAAATTATGG
AAGACAGCGTTTGTATGGTTCGGTTGGGTGGGGTTTGGCAATGTTTTGTA
TAGGGATTTCTCTTGATCAAGCAATAAAGTTTCATAATCATCCCTGTGGT
TGGCCAGGCGAAAGAGAAAAAAATTATGTTATATGCTTTACAATATTTTC
AGTTTTTATGTGCTTTTCTTTGATAACTGCTACTCAAATGACTTTTACAT
ATGATGACCAAAGTGAGAATATGTATTTCAAAGTAGTAAAAGATAAGGTC
TCTCAAACCATTCTTGGGGGTAAAACCAAAAACCGACAACATTTAATAAA
TGAACCCGATGATTCAGAAATTAATAGAAGGAAAGACGATGAAATTTTAG
AGCAACAGTTATCTATAAAGTTGGACAAGACTAATTATCAATCTAAATCT
GAAGATCCTTATGAAGATAACTATCAAATAAATAATTTTGATTTAAACGT
ATGGGTTGGAGCTTTGAAAACTTTCAAATCAATTAGACTTATTTCCTTAC
TTTTTCTTGCCTGGTTTATGGGATTTGGCGTGGGAATCGTTTTTACTTTT
CTTTTTTGGCATCTTCAAGACATAAAAGGATCACCGACGTTATTTGGAAT
AGCATCAGTTATTAATCACATTTCAGAAATATTGGCATACTTTTTCAGCG
GGAAATTAATTGCTTCAATTGGTCATACAAAGGTATTATACCTCGGTTTG
TTAGGAAACGTAGTTAGATTTCTTTATGTTTCATGGATTCAAAATTCCTG
GTGGATTCTACCTTTCGAAATGATTCAAGGCCTTACACATGCAGCTGTTT
GGTCAGCTTGTTACAGTTACATGGCACAAACAACGCCCAAAGAATATAGA
AATGCATCTCAAAGAATTTTACAAGGAATCCATCATGGTCTTGGTAAGGG
TTGTGGCTCTATATTCGGAGGAATGATAATTGGATCTTTTGGGACTCCAG
TTTTATTCAGAGCTTACGGAATTATGTGCTGCTTTGTCTTAATAGGATTC
CTGACAATAAATTACTTTTTGGCTGAGATTTCTCCAACAGATCCCATAAA
AAGTGTTCCTAATCAAAGTAATTTTGAAAATTCTGCACCACATGAATACT
ATAGTGGTTATGACCAGCCTGCTGATTCTACTACTTATGTTGAGGAAGAA
ACTTTCATGTCTCCTCATGGGATTCCATTCATGCCTAATAATGAATATAG
AAATACAGAAAATTACAATGCTATAAAAGGAAATTCTAACCAAGCGGCAT
TTAGACCATTTTAAAGTATACATTTTATCAATGTGACCCTTTTCTTAATT
GATTGTCAATAATTTGTTTTATTTTAATGGATATAGATTTAGCTATTCTA
TTACTTTTATAGTTGTTTTTAGTTTATTTCATTGATGTAGAACTTTTTAA
AAATCCTGATGTAGCTGTATATTGTTTGTCGACACATTCATGCATTTTAT
ATTAATATTTATTAATGTTATTGCT
back to top

protein sequence of SMED30027945-orf-1

>SMED30027945-orf-1 ID=SMED30027945-orf-1|Name=SMED30027945-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=650bp
MENPTSKRDVLDMLLTHVNRTLLVFKLYYFFYFAAFGSLFPLISVYFKQL
GLSATQCGILVGCRPFVEFISAPFWGVIAERWKKGKLLILISLICGLLFT
VGIGFTRPIPEGCLLKGKFPNETIIKEPGDYGNQPQLLVSDPKILYPKLM
GQSPIRLVDQNILMELNAESGNFVIPVYSPIVYTTENIYQTFVILLVLLI
LGEFMSSPSLALADTAVLNYLKEDRENYGRQRLYGSVGWGLAMFCIGISL
DQAIKFHNHPCGWPGEREKNYVICFTIFSVFMCFSLITATQMTFTYDDQS
ENMYFKVVKDKVSQTILGGKTKNRQHLINEPDDSEINRRKDDEILEQQLS
IKLDKTNYQSKSEDPYEDNYQINNFDLNVWVGALKTFKSIRLISLLFLAW
FMGFGVGIVFTFLFWHLQDIKGSPTLFGIASVINHISEILAYFFSGKLIA
SIGHTKVLYLGLLGNVVRFLYVSWIQNSWWILPFEMIQGLTHAAVWSACY
SYMAQTTPKEYRNASQRILQGIHHGLGKGCGSIFGGMIIGSFGTPVLFRA
YGIMCCFVLIGFLTINYFLAEISPTDPIKSVPNQSNFENSAPHEYYSGYD
QPADSTTYVEEETFMSPHGIPFMPNNEYRNTENYNAIKGNSNQAAFRPF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000017photoreceptor neuron
PLANA:0000074oocyte
PLANA:0000099neuron
PLANA:0000231vitelline gland
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036259MFS_trans_sf
IPR024989MFS_assoc_dom
IPR020846MFS_dom
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:1.20.1250.20coord: 381..570
e-value: 2.1E-33
score: 117.5
NoneNo IPR availableGENE3DG3DSA:1.20.1250.20coord: 17..112
e-value: 4.7E-15
score: 57.5
NoneNo IPR availablePANTHERPTHR16172UNCHARACTERIZEDcoord: 16..574
NoneNo IPR availablePANTHERPTHR16172:SF2MAJOR FACILITATOR SUPERFAMILY DOMAIN-CONTAINING PROTEIN 6coord: 16..574
NoneNo IPR availableCDDcd17335MFS_MFSD6coord: 24..567
e-value: 2.47997E-127
score: 378.85
NoneNo IPR availableTMHMMTMhelixcoord: 21..43
NoneNo IPR availableTMHMMTMhelixcoord: 457..475
NoneNo IPR availableTMHMMTMhelixcoord: 233..250
NoneNo IPR availableTMHMMTMhelixcoord: 425..444
NoneNo IPR availableTMHMMTMhelixcoord: 270..289
NoneNo IPR availableTMHMMTMhelixcoord: 191..213
NoneNo IPR availableTMHMMTMhelixcoord: 521..543
NoneNo IPR availableTMHMMTMhelixcoord: 87..109
NoneNo IPR availableTMHMMTMhelixcoord: 393..415
NoneNo IPR availableTMHMMTMhelixcoord: 58..80
NoneNo IPR availableTMHMMTMhelixcoord: 547..569
NoneNo IPR availableTMHMMTMhelixcoord: 479..501
IPR024989Major facilitator superfamily associated domainPFAMPF12832MFS_1_likecoord: 23..550
e-value: 4.4E-91
score: 305.6
IPR036259MFS transporter superfamilySUPERFAMILYSSF103473MFS general substrate transportercoord: 19..566