cAMP-dependent protein kinase type I-alpha regulatory subunit

Overview
NamecAMP-dependent protein kinase type I-alpha regulatory subunit
Smed IDSMED30027940
Length (bp)2047
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of cAMP-dependent protein kinase type I-alpha regulatory subunit (SMED30027940) t-SNE clustered cells

Violin plots show distribution of expression levels for cAMP-dependent protein kinase type I-alpha regulatory subunit (SMED30027940) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of cAMP-dependent protein kinase type I-alpha regulatory subunit (SMED30027940) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for cAMP-dependent protein kinase type I-alpha regulatory subunit (SMED30027940) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027940

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parapharyngeal regionSMED30027940SMESG000078298.1 SmedASXL_010063SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
parapharyngeal regionSMED30027940SMESG000078298.1 SmedASXL_010062SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30027940SMESG000078298.1 dd_Smed_v4_15589_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 4 cellSMED30027940SMESG000078298.1 dd_Smed_v4_15589_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30027940SMESG000078298.1 dd_Smed_v4_15589_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Human
Match: CNBD2 (cyclic nucleotide binding domain containing 2 [Source:HGNC Symbol;Acc:HGNC:16145])

HSP 1 Score: 85.1149 bits (209), Expect = 6.757e-17
Identity = 63/261 (24.14%), Postives = 116/261 (44.44%), Query Frame = 3
Query:  813 FADYQVAEV-----------DKK--SNGMFDISKFKAQKESILSTDAIEIMRINPKQRSIEMVHSARLAINATVEAFSEFPLNMQTSLIERGWYEKFEAKRIIIRQGHSALNFYFIISGITTVSVARTNKATGETYSETVAFLKKGNSFGELALMFGGKRSATVSCKTDVELLAVSREDFIDIFMSTSSNEEPDH-IRLLRGLPLLSQWPIDELPYDDPSICLFTYFRRGTVLCHDSNSGSWVYIVKSGTCRIIKFIQLNS 1553
            F +YQ+ E            DKK  S   FD   F A+ E      AI+IM+  P  R+ + +  A   I   ++++  +   +Q  L +   +E+F  +R+II++G    +FYFI  G  TV++ +    +          L KG+ FGE+ ++    R +T+ C  + E L V REDF    +     ++  +     R + L + W  DE  +   ++     F  G ++  D     ++  +  G+C +++ + L +
Sbjct:   43 FREYQIIETAHWKHPIFSFWDKKMQSRVTFDTMDFIAE-EGHFPPKAIQIMQKKPSWRTEDEIQ-AVCNILQVLDSYRNYAEPLQLLLAKVMRFERFGRRRVIIKKGQKGNSFYFIYLG--TVAITKDEDGSSAFLDPHPKLLHKGSCFGEMDVLHASVRRSTIVCMEETEFLVVDREDFFANKLDQEVQKDAQYRFEFFRKMELFASWS-DEKLWQLVAMAKIERFSYGQLISKDFGESPFIMFISKGSCEVLRLLDLGA 298          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Human
Match: CNBD2 (cyclic nucleotide binding domain containing 2 [Source:HGNC Symbol;Acc:HGNC:16145])

HSP 1 Score: 85.8853 bits (211), Expect = 9.004e-17
Identity = 63/261 (24.14%), Postives = 116/261 (44.44%), Query Frame = 3
Query:  813 FADYQVAEV-----------DKK--SNGMFDISKFKAQKESILSTDAIEIMRINPKQRSIEMVHSARLAINATVEAFSEFPLNMQTSLIERGWYEKFEAKRIIIRQGHSALNFYFIISGITTVSVARTNKATGETYSETVAFLKKGNSFGELALMFGGKRSATVSCKTDVELLAVSREDFIDIFMSTSSNEEPDH-IRLLRGLPLLSQWPIDELPYDDPSICLFTYFRRGTVLCHDSNSGSWVYIVKSGTCRIIKFIQLNS 1553
            F +YQ+ E            DKK  S   FD   F A+ E      AI+IM+  P  R+ + +  A   I   ++++  +   +Q  L +   +E+F  +R+II++G    +FYFI  G  TV++ +    +          L KG+ FGE+ ++    R +T+ C  + E L V REDF    +     ++  +     R + L + W  DE  +   ++     F  G ++  D     ++  +  G+C +++ + L +
Sbjct:   43 FREYQIIETAHWKHPIFSFWDKKMQSRVTFDTMDFIAE-EGHFPPKAIQIMQKKPSWRTEDEIQ-AVCNILQVLDSYRNYAEPLQLLLAKVMRFERFGRRRVIIKKGQKGNSFYFIYLG--TVAITKDEDGSSAFLDPHPKLLHKGSCFGEMDVLHASVRRSTIVCMEETEFLVVDREDFFANKLDQEVQKDAQYRFEFFRKMELFASWS-DEKLWQLVAMAKIERFSYGQLISKDFGESPFIMFISKGSCEVLRLLDLGA 298          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Human
Match: CNBD2 (cyclic nucleotide binding domain containing 2 [Source:HGNC Symbol;Acc:HGNC:16145])

HSP 1 Score: 85.8853 bits (211), Expect = 9.020e-17
Identity = 63/261 (24.14%), Postives = 116/261 (44.44%), Query Frame = 3
Query:  813 FADYQVAEV-----------DKK--SNGMFDISKFKAQKESILSTDAIEIMRINPKQRSIEMVHSARLAINATVEAFSEFPLNMQTSLIERGWYEKFEAKRIIIRQGHSALNFYFIISGITTVSVARTNKATGETYSETVAFLKKGNSFGELALMFGGKRSATVSCKTDVELLAVSREDFIDIFMSTSSNEEPDH-IRLLRGLPLLSQWPIDELPYDDPSICLFTYFRRGTVLCHDSNSGSWVYIVKSGTCRIIKFIQLNS 1553
            F +YQ+ E            DKK  S   FD   F A+ E      AI+IM+  P  R+ + +  A   I   ++++  +   +Q  L +   +E+F  +R+II++G    +FYFI  G  TV++ +    +          L KG+ FGE+ ++    R +T+ C  + E L V REDF    +     ++  +     R + L + W  DE  +   ++     F  G ++  D     ++  +  G+C +++ + L +
Sbjct:   43 FREYQIIETAHWKHPIFSFWDKKMQSRVTFDTMDFIAE-EGHFPPKAIQIMQKKPSWRTEDEIQ-AVCNILQVLDSYRNYAEPLQLLLAKVMRFERFGRRRVIIKKGQKGNSFYFIYLG--TVAITKDEDGSSAFLDPHPKLLHKGSCFGEMDVLHASVRRSTIVCMEETEFLVVDREDFFANKLDQEVQKDAQYRFEFFRKMELFASWS-DEKLWQLVAMAKIERFSYGQLISKDFGESPFIMFISKGSCEVLRLLDLGA 298          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Human
Match: PRKAR1A (protein kinase cAMP-dependent type I regulatory subunit alpha [Source:HGNC Symbol;Acc:HGNC:9388])

HSP 1 Score: 61.2326 bits (147), Expect = 1.485e-9
Identity = 37/112 (33.04%), Postives = 57/112 (50.89%), Query Frame = 3
Query: 1002 FSEFPLNMQTSLIERGWYEKFEAKRIIIRQGHSALNFYFIISGITTVSVARTNKATGETYSETVAFLKKGNSFGELALMFGGKRSATVSCKTDVELLAVSREDFIDIFMSTS 1337
            FS    N ++ + +  +   F A   +I+QG    NFY I  G T V V           +E    + +G SFGELAL++G  R+ATV  KT+V+L  + R+ +  I M ++
Sbjct:  138 FSHLDDNERSDIFDAMFSVSFIAGETVIQQGDEGDNFYVIDQGETDVYVN----------NEWATSVGEGGSFGELALIYGTPRAATVKAKTNVKLWGIDRDSYRRILMGST 239          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Human
Match: PRKAR1A (protein kinase cAMP-dependent type I regulatory subunit alpha [Source:HGNC Symbol;Acc:HGNC:9388])

HSP 1 Score: 61.2326 bits (147), Expect = 2.361e-9
Identity = 37/112 (33.04%), Postives = 57/112 (50.89%), Query Frame = 3
Query: 1002 FSEFPLNMQTSLIERGWYEKFEAKRIIIRQGHSALNFYFIISGITTVSVARTNKATGETYSETVAFLKKGNSFGELALMFGGKRSATVSCKTDVELLAVSREDFIDIFMSTS 1337
            FS    N ++ + +  +   F A   +I+QG    NFY I  G T V V           +E    + +G SFGELAL++G  R+ATV  KT+V+L  + R+ +  I M ++
Sbjct:  138 FSHLDDNERSDIFDAMFSVSFIAGETVIQQGDEGDNFYVIDQGETDVYVN----------NEWATSVGEGGSFGELALIYGTPRAATVKAKTNVKLWGIDRDSYRRILMGST 239          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Celegans
Match: kin-2 (cAMP-dependent protein kinase regulatory subunit [Source:UniProtKB/Swiss-Prot;Acc:P30625])

HSP 1 Score: 62.7734 bits (151), Expect = 2.847e-10
Identity = 49/163 (30.06%), Postives = 70/163 (42.94%), Query Frame = 3
Query: 1068 AKRIIIRQGHSALNFYFIISGITTVSVARTNKATGETYSETVAFLKKGNSFGELALMFGGKRSATVSCKTDVELLAVSREDFIDIFMSTSSNEEPDHIRLLRGLPLLS---QWP----IDELPYDDPSICLFTYFRRGTVLCHDSNSGSWVYIVKSGTCRIIK 1535
            A   II QG    NFY I  G   V V            E V  + +G SFGELAL++G  R+ATV  KTDV+L A+ R  +  I M + + +   +   L  + +L+   QW      D L   D        F  GT +      G   +I+  G   +++
Sbjct:  113 AGETIIEQGEEGDNFYVIDKGTVDVYVNH----------EYVLTINEGGSFGELALIYGTPRAATVIAKTDVKLWAIDRLTYRRILMGSVTKKRKMYDEFLSKVQILADLDQWERANVADALERCD--------FEPGTHVVEQGQPGDEFFIILEGEANVLQ 257          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Celegans
Match: kin-2 (cAMP-dependent protein kinase regulatory subunit [Source:UniProtKB/Swiss-Prot;Acc:P30625])

HSP 1 Score: 62.7734 bits (151), Expect = 3.029e-10
Identity = 49/163 (30.06%), Postives = 70/163 (42.94%), Query Frame = 3
Query: 1068 AKRIIIRQGHSALNFYFIISGITTVSVARTNKATGETYSETVAFLKKGNSFGELALMFGGKRSATVSCKTDVELLAVSREDFIDIFMSTSSNEEPDHIRLLRGLPLLS---QWP----IDELPYDDPSICLFTYFRRGTVLCHDSNSGSWVYIVKSGTCRIIK 1535
            A   II QG    NFY I  G   V V            E V  + +G SFGELAL++G  R+ATV  KTDV+L A+ R  +  I M + + +   +   L  + +L+   QW      D L   D        F  GT +      G   +I+  G   +++
Sbjct:  145 AGETIIEQGEEGDNFYVIDKGTVDVYVNH----------EYVLTINEGGSFGELALIYGTPRAATVIAKTDVKLWAIDRLTYRRILMGSVTKKRKMYDEFLSKVQILADLDQWERANVADALERCD--------FEPGTHVVEQGQPGDEFFIILEGEANVLQ 289          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Celegans
Match: kin-2 (cAMP-dependent protein kinase regulatory subunit [Source:UniProtKB/Swiss-Prot;Acc:P30625])

HSP 1 Score: 62.7734 bits (151), Expect = 3.356e-10
Identity = 49/163 (30.06%), Postives = 70/163 (42.94%), Query Frame = 3
Query: 1068 AKRIIIRQGHSALNFYFIISGITTVSVARTNKATGETYSETVAFLKKGNSFGELALMFGGKRSATVSCKTDVELLAVSREDFIDIFMSTSSNEEPDHIRLLRGLPLLS---QWP----IDELPYDDPSICLFTYFRRGTVLCHDSNSGSWVYIVKSGTCRIIK 1535
            A   II QG    NFY I  G   V V            E V  + +G SFGELAL++G  R+ATV  KTDV+L A+ R  +  I M + + +   +   L  + +L+   QW      D L   D        F  GT +      G   +I+  G   +++
Sbjct:  155 AGETIIEQGEEGDNFYVIDKGTVDVYVNH----------EYVLTINEGGSFGELALIYGTPRAATVIAKTDVKLWAIDRLTYRRILMGSVTKKRKMYDEFLSKVQILADLDQWERANVADALERCD--------FEPGTHVVEQGQPGDEFFIILEGEANVLQ 299          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Fly
Match: Pka-R1 (gene:FBgn0259243 transcript:FBtr0302639)

HSP 1 Score: 63.5438 bits (153), Expect = 1.380e-10
Identity = 55/180 (30.56%), Postives = 85/180 (47.22%), Query Frame = 3
Query: 1080 IIRQGHSALNFYFIISGITTVSVARTNKATGETYSETVAFLKKGNSFGELALMFGGKRSATVSCKTDVELLAVSREDFIDIFMSTSSNEEPDHIRLLRGLPL---LSQWPIDELPYDDP-SICLFTYFRRGTVLCHDSNSGSWVYIVKSGTCRIIKFIQLNSQEQKEKLKHQR-DSNDYF 1604
            II+QG    NFY I  G   V V           SE V  + +G SFGELAL++G  R+ATV  KTDV+L  + R+ +  I M ++  +   +   L  + +   L +W  + L   D    C    F  G  +     +G   YI+  G C ++  +Q  S++ ++  +  R  S+DYF
Sbjct:   79 IIQQGDEGDNFYVIDVGEVDVFVN----------SELVTTISEGGSFGELALIYGTPRAATVRAKTDVKLWGIDRDSYRRILMGSTIRKRKMYEEFLSRVSILESLDKW--ERLTVADSLETC---SFDDGETIVKQGAAGDDFYIILEG-CAVV--LQQRSEQGEDPAEVGRLGSSDYF 240          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Fly
Match: Pka-R1 (gene:FBgn0259243 transcript:FBtr0300533)

HSP 1 Score: 62.7734 bits (151), Expect = 2.119e-10
Identity = 54/179 (30.17%), Postives = 82/179 (45.81%), Query Frame = 3
Query: 1080 IIRQGHSALNFYFIISGITTVSVARTNKATGETYSETVAFLKKGNSFGELALMFGGKRSATVSCKTDVELLAVSREDFIDIFMSTSSNEEPDHIRLLRGLPL---LSQWPIDELPYDDP-SICLFTYFRRGTVLCHDSNSGSWVYIVKSGTCRIIKFIQLNSQEQKEKLKHQRDSNDYF 1604
            II+QG    NFY I  G   V V           SE V  + +G SFGELAL++G  R+ATV  KTDV+L  + R+ +  I M ++  +   +   L  + +   L +W  + L   D    C    F  G  +     +G   YI+  G C ++  +Q  S+ +      +  S+DYF
Sbjct:   79 IIQQGDEGDNFYVIDVGEVDVFVN----------SELVTTISEGGSFGELALIYGTPRAATVRAKTDVKLWGIDRDSYRRILMGSTIRKRKMYEEFLSRVSILESLDKW--ERLTVADSLETC---SFDDGETIVKQGAAGDDFYIILEG-CAVV--LQQRSEGEDPAEVGRLGSSDYF 239          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Fly
Match: Pka-R1 (gene:FBgn0259243 transcript:FBtr0300529)

HSP 1 Score: 62.7734 bits (151), Expect = 2.119e-10
Identity = 54/179 (30.17%), Postives = 82/179 (45.81%), Query Frame = 3
Query: 1080 IIRQGHSALNFYFIISGITTVSVARTNKATGETYSETVAFLKKGNSFGELALMFGGKRSATVSCKTDVELLAVSREDFIDIFMSTSSNEEPDHIRLLRGLPL---LSQWPIDELPYDDP-SICLFTYFRRGTVLCHDSNSGSWVYIVKSGTCRIIKFIQLNSQEQKEKLKHQRDSNDYF 1604
            II+QG    NFY I  G   V V           SE V  + +G SFGELAL++G  R+ATV  KTDV+L  + R+ +  I M ++  +   +   L  + +   L +W  + L   D    C    F  G  +     +G   YI+  G C ++  +Q  S+ +      +  S+DYF
Sbjct:   79 IIQQGDEGDNFYVIDVGEVDVFVN----------SELVTTISEGGSFGELALIYGTPRAATVRAKTDVKLWGIDRDSYRRILMGSTIRKRKMYEEFLSRVSILESLDKW--ERLTVADSLETC---SFDDGETIVKQGAAGDDFYIILEG-CAVV--LQQRSEGEDPAEVGRLGSSDYF 239          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Fly
Match: Pka-R1 (gene:FBgn0259243 transcript:FBtr0302638)

HSP 1 Score: 63.1586 bits (152), Expect = 2.173e-10
Identity = 55/180 (30.56%), Postives = 85/180 (47.22%), Query Frame = 3
Query: 1080 IIRQGHSALNFYFIISGITTVSVARTNKATGETYSETVAFLKKGNSFGELALMFGGKRSATVSCKTDVELLAVSREDFIDIFMSTSSNEEPDHIRLLRGLPL---LSQWPIDELPYDDP-SICLFTYFRRGTVLCHDSNSGSWVYIVKSGTCRIIKFIQLNSQEQKEKLKHQR-DSNDYF 1604
            II+QG    NFY I  G   V V           SE V  + +G SFGELAL++G  R+ATV  KTDV+L  + R+ +  I M ++  +   +   L  + +   L +W  + L   D    C    F  G  +     +G   YI+  G C ++  +Q  S++ ++  +  R  S+DYF
Sbjct:  104 IIQQGDEGDNFYVIDVGEVDVFV----------NSELVTTISEGGSFGELALIYGTPRAATVRAKTDVKLWGIDRDSYRRILMGSTIRKRKMYEEFLSRVSILESLDKW--ERLTVADSLETC---SFDDGETIVKQGAAGDDFYIILEG-CAVV--LQQRSEQGEDPAEVGRLGSSDYF 265          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Fly
Match: Pka-R1 (gene:FBgn0259243 transcript:FBtr0302640)

HSP 1 Score: 63.1586 bits (152), Expect = 2.179e-10
Identity = 55/180 (30.56%), Postives = 85/180 (47.22%), Query Frame = 3
Query: 1080 IIRQGHSALNFYFIISGITTVSVARTNKATGETYSETVAFLKKGNSFGELALMFGGKRSATVSCKTDVELLAVSREDFIDIFMSTSSNEEPDHIRLLRGLPL---LSQWPIDELPYDDP-SICLFTYFRRGTVLCHDSNSGSWVYIVKSGTCRIIKFIQLNSQEQKEKLKHQR-DSNDYF 1604
            II+QG    NFY I  G   V V           SE V  + +G SFGELAL++G  R+ATV  KTDV+L  + R+ +  I M ++  +   +   L  + +   L +W  + L   D    C    F  G  +     +G   YI+  G C ++  +Q  S++ ++  +  R  S+DYF
Sbjct:  102 IIQQGDEGDNFYVIDVGEVDVFV----------NSELVTTISEGGSFGELALIYGTPRAATVRAKTDVKLWGIDRDSYRRILMGSTIRKRKMYEEFLSRVSILESLDKW--ERLTVADSLETC---SFDDGETIVKQGAAGDDFYIILEG-CAVV--LQQRSEQGEDPAEVGRLGSSDYF 263          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Zebrafish
Match: prkar1ab (protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) b [Source:ZFIN;Acc:ZDB-GENE-050417-238])

HSP 1 Score: 59.3066 bits (142), Expect = 6.727e-9
Identity = 36/112 (32.14%), Postives = 57/112 (50.89%), Query Frame = 3
Query: 1002 FSEFPLNMQTSLIERGWYEKFEAKRIIIRQGHSALNFYFIISGITTVSVARTNKATGETYSETVAFLKKGNSFGELALMFGGKRSATVSCKTDVELLAVSREDFIDIFMSTS 1337
            FS    N ++ + +  +   + A  I+I+QG    NFY I  G   V V           +E    + +G SFGELAL++G  R+ATV  KT+V+L  + R+ +  I M ++
Sbjct:  136 FSHLDDNERSDIFDAMFPVTYIAGEIVIQQGDEGDNFYVIDQGEMDVYVN----------NEWATSIGEGGSFGELALIYGTPRAATVRAKTNVKLWGIDRDSYRRILMGST 237          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Zebrafish
Match: prkg2 (protein kinase cGMP-dependent 2 [Source:ZFIN;Acc:ZDB-GENE-060531-80])

HSP 1 Score: 60.077 bits (144), Expect = 7.906e-9
Identity = 44/190 (23.16%), Postives = 86/190 (45.26%), Query Frame = 3
Query: 1035 LIERGWYEKFEAKRIIIRQGHSALNFYFIISGITTVSVARTNKATGETYSETVAFLKKGNSFGELALMFGGKRSATVSCKTDVELLAVSREDFIDIFMSTSSNEEPDHIRLLRGLPLLSQWPIDELPYDDPSICLFTYFRRGTVLCHDSNSGSWVYIVKSGTCRIIKFIQLNSQEQKEKLKHQRDSNDYF 1604
            ++E  +   ++    +I+QG    + + +  G   + V + NK         +  +    +FGELA+++   R+A+V   ++V+  A+ RE F +I   T+      +   LR + LL+  P D+L       CL  Y+ +G  +  +   G+  YI+ +G    IK  Q     ++ ++ +     DYF
Sbjct:  187 MVECMYERTYQQGEYVIKQGEPGNHLFVLADG--KLDVYQHNKL--------LTSIAVWTTFGELAILYNCTRTASVKAASNVKTWALDREVFHNIMRMTAEARHEQYRNFLRSVSLLASLPGDKLT--KIVDCLEEYYNKGDYIIREGEEGNTFYIIANGK---IKVTQSTQDHEEPQIINTLGKGDYF 361          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Zebrafish
Match: prkar1b (protein kinase, cAMP-dependent, regulatory, type I, beta [Source:ZFIN;Acc:ZDB-GENE-060929-580])

HSP 1 Score: 58.9214 bits (141), Expect = 1.088e-8
Identity = 33/90 (36.67%), Postives = 47/90 (52.22%), Query Frame = 3
Query: 1068 AKRIIIRQGHSALNFYFIISGITTVSVARTNKATGETYSETVAFLKKGNSFGELALMFGGKRSATVSCKTDVELLAVSREDFIDIFMSTS 1337
            A   +I+QG    NFY I  G   V V            E V  + +G SFGELAL++G  R+ATV  KTD++L  + R+ +  I M ++
Sbjct:  159 AGETVIQQGDEGDNFYVIDQGEVDVYVN----------GEWVTSIGEGGSFGELALIYGTPRAATVKAKTDLKLWGIDRDSYRRILMGST 238          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Zebrafish
Match: prkar1b (protein kinase, cAMP-dependent, regulatory, type I, beta [Source:ZFIN;Acc:ZDB-GENE-060929-580])

HSP 1 Score: 58.9214 bits (141), Expect = 1.088e-8
Identity = 33/90 (36.67%), Postives = 47/90 (52.22%), Query Frame = 3
Query: 1068 AKRIIIRQGHSALNFYFIISGITTVSVARTNKATGETYSETVAFLKKGNSFGELALMFGGKRSATVSCKTDVELLAVSREDFIDIFMSTS 1337
            A   +I+QG    NFY I  G   V V            E V  + +G SFGELAL++G  R+ATV  KTD++L  + R+ +  I M ++
Sbjct:  159 AGETVIQQGDEGDNFYVIDQGEVDVYVN----------GEWVTSIGEGGSFGELALIYGTPRAATVKAKTDLKLWGIDRDSYRRILMGST 238          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Zebrafish
Match: prkar1aa (protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) a [Source:ZFIN;Acc:ZDB-GENE-050116-2])

HSP 1 Score: 58.5362 bits (140), Expect = 1.388e-8
Identity = 35/112 (31.25%), Postives = 57/112 (50.89%), Query Frame = 3
Query: 1002 FSEFPLNMQTSLIERGWYEKFEAKRIIIRQGHSALNFYFIISGITTVSVARTNKATGETYSETVAFLKKGNSFGELALMFGGKRSATVSCKTDVELLAVSREDFIDIFMSTS 1337
            F+    N ++ + +  +   + A   +I+QG    NFY I  G   V V           +E V  + +G SFGELAL++G  R+ATV  KT+V+L  + R+ +  I M ++
Sbjct:  136 FAHLDDNERSDIFDAMFSVTYIAGETVIQQGDEGDNFYVIDQGEMDVYVN----------NEWVTSIGEGGSFGELALIYGTPRAATVRAKTNVKLWGIDRDSYRRILMGST 237          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Xenopus
Match: bmp4 (bone morphogenetic protein 4 [Source:Xenbase;Acc:XB-GENE-483058])

HSP 1 Score: 85.5001 bits (210), Expect = 2.550e-17
Identity = 58/214 (27.10%), Postives = 100/214 (46.73%), Query Frame = 3
Query:  912 AIEIMRINPKQRSIEMVHSARLAINATVEAFSEFPLNMQTSLIERGWYEKFEAKRIIIRQGHSALNFYFIISGITTVSVARTNKATGETYSETVAFLKKGNSFGELALMFGGKRSATVSCKTDVELLAVSREDFIDIFMSTSSNEEPDH-IRLLRGLPLLSQWPIDELPYDDPSICLFTYFRRGTVLCHDSNSGSWVYIVKSGTCRIIKFIQLN 1550
            AIE+    P+QRS + +   R ++   + +F  +   MQ  L    +Y +F   R+I+R+GH   +FYF+ SG+  ++V +    +          L KG SFGE+AL+   +R+ATV C  + E L V R +F +  +     +E  +  +  R L L S W  D+        C         V+  D++    +  V  G C +++ + L+
Sbjct:    9 AIEVALRRPEQRSEQDIRFIR-SMMMGILSFRRYSSQMQLMLARVVYYRRFGRGRVIVRKGHRGDSFYFVFSGV--IAVTQDVDGSSALLDPEPILLHKGASFGEVALLKDLRRNATVVCMEETEFLVVDRMEFFENKLDQELQKELKYRFQHFRSLDLFSSWS-DKSLETLADHCKAEECHHSQVMVKDTHETKNIIFVTKGRCEVLRLVHLS 218          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Xenopus
Match: adarb1 (adenosine deaminase, RNA-specific, B1 [Source:Xenbase;Acc:XB-GENE-954085])

HSP 1 Score: 59.3066 bits (142), Expect = 1.169e-8
Identity = 33/90 (36.67%), Postives = 47/90 (52.22%), Query Frame = 3
Query: 1068 AKRIIIRQGHSALNFYFIISGITTVSVARTNKATGETYSETVAFLKKGNSFGELALMFGGKRSATVSCKTDVELLAVSREDFIDIFMSTS 1337
            A   +I+QG    NFY I  G   V V            E V  + +G SFGELAL++G  R+ATV  KTD++L  + R+ +  I M ++
Sbjct:  159 AGETVIQQGDEGDNFYVIDQGEADVYVN----------GEWVTNIGEGGSFGELALIYGTPRAATVKAKTDLKLWGIDRDSYRRILMGST 238          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Xenopus
Match: adarb1 (adenosine deaminase, RNA-specific, B1 [Source:Xenbase;Acc:XB-GENE-954085])

HSP 1 Score: 58.9214 bits (141), Expect = 1.275e-8
Identity = 33/90 (36.67%), Postives = 47/90 (52.22%), Query Frame = 3
Query: 1068 AKRIIIRQGHSALNFYFIISGITTVSVARTNKATGETYSETVAFLKKGNSFGELALMFGGKRSATVSCKTDVELLAVSREDFIDIFMSTS 1337
            A   +I+QG    NFY I  G   V V            E V  + +G SFGELAL++G  R+ATV  KTD++L  + R+ +  I M ++
Sbjct:  120 AGETVIQQGDEGDNFYVIDQGEADVYVN----------GEWVTNIGEGGSFGELALIYGTPRAATVKAKTDLKLWGIDRDSYRRILMGST 199          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Xenopus
Match: adarb1 (adenosine deaminase, RNA-specific, B1 [Source:Xenbase;Acc:XB-GENE-954085])

HSP 1 Score: 58.5362 bits (140), Expect = 1.817e-8
Identity = 33/90 (36.67%), Postives = 47/90 (52.22%), Query Frame = 3
Query: 1068 AKRIIIRQGHSALNFYFIISGITTVSVARTNKATGETYSETVAFLKKGNSFGELALMFGGKRSATVSCKTDVELLAVSREDFIDIFMSTS 1337
            A   +I+QG    NFY I  G   V V            E V  + +G SFGELAL++G  R+ATV  KTD++L  + R+ +  I M ++
Sbjct:  193 AGETVIQQGDEGDNFYVIDQGEADVYVN----------GEWVTNIGEGGSFGELALIYGTPRAATVKAKTDLKLWGIDRDSYRRILMGST 272          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Xenopus
Match: tnpo2 (transportin 2 [Source:Xenbase;Acc:XB-GENE-968452])

HSP 1 Score: 57.3806 bits (137), Expect = 6.294e-8
Identity = 42/173 (24.28%), Postives = 88/173 (50.87%), Query Frame = 3
Query: 1053 YEKFEAK-RIIIRQGHSALNFYFIISGITTVSVARTNKATGETYSETVAFLKKGNSFGELALMFGGKRSATVSCKTDVELLAVSREDFIDIFMSTSSNEEPDHIRLLRGLPLLSQWPIDELPYDDPSICLFTYFRRGTVLCHDSNSGSWVYIVKSGTCRIIKFIQLNSQEQKE 1568
            YE+  +K +++I++G +  + Y +  G+  + V + ++  G+ +         G +FGELA+++  KR+ATV   TD ++  + R+ F +I MS++  +  ++   LR    L    I  L Y   +I    ++ +G  +  +   G+  +I+  G   + + ++  SQE +E
Sbjct:  171 YERVYSKSQLVIQEGAAGNHLYVLADGL--LDVIQNSRLLGQMHP--------GTAFGELAILYNCKRTATVKAVTDSKIWVLDRQVFQNIMMSSAQAQHQEYFSFLRRYVGLFSVMIYRLLY---TIKNTDFYDKGDYIIREGEEGNTFFIIAKGKVCVTQAVE-GSQEPQE 329          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Mouse
Match: Cnbd2 (cyclic nucleotide binding domain containing 2 [Source:MGI Symbol;Acc:MGI:1918123])

HSP 1 Score: 83.5741 bits (205), Expect = 3.569e-16
Identity = 65/260 (25.00%), Postives = 114/260 (43.85%), Query Frame = 3
Query:  813 FADYQVAE-----------VDKKSNGM--FDISKFKAQKESILSTDAIEIMRINPKQRSIEMVHSARLAINATVEAFSEFPLNMQTSLIERGWYEKFEAKRIIIRQGHSALNFYFIISGITTVSVARTNKATGETYSETVAFLKKGNSFGELALMFGGKRSATVSCKTDVELLAVSREDFIDIFMSTSSNEEPDH-IRLLRGLPLLSQWPIDELPYDDPSICLFTYFRRGTVLCHDSNSGSWVYIVKSGTCRIIKFIQLN 1550
            F +YQ+ E            DKK  G   F    F AQ E      AI I +  P  R+ + +      + A ++ +  +  ++Q  L +   +E+F  +R+I+++G    +FYFI  G  TV++      +          L +G SFGE+ L+    RSATV C  + E L V REDF+   +     +E  +     R L +   W  ++L +   ++     F  G ++  D  + +++  +  G C I++ + L 
Sbjct:  133 FREYQIIEPVHKKHPDFSFWDKKKQGRISFVTEDFAAQ-EGHFPPRAISITQKKPSWRTHQEIQDLCNILQA-LDCYRSYTESLQLLLAKVIRFERFGRRRVIVKKGQMGNSFYFIYLG--TVAITEDEDGSSAFLDPHPTLLHRGGSFGEMGLLSTTVRSATVVCMEETEFLVVDREDFVANKLGDEVQKETQYRYNFFRNLDIFQSWSEEKL-WKLVALGRIERFSYGQMVSKDFMNSAFITFICQGNCEILRLVALG 387          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Mouse
Match: Cnbd2 (cyclic nucleotide binding domain containing 2 [Source:MGI Symbol;Acc:MGI:1918123])

HSP 1 Score: 81.6481 bits (200), Expect = 1.115e-15
Identity = 58/247 (23.48%), Postives = 107/247 (43.32%), Query Frame = 3
Query:  813 FADYQVAEVDKKSNGMFDISKFKAQKESILSTDAIEIMRINPKQRSIEMVHSARLAINATVEAFSEFPLNMQTSLIERGWYEKFEAKRIIIRQGHSALNFYFIISGITTVSVARTNKATGETYSETVAFLKKGNSFGELALMFGGKRSATVSCKTDVELLAVSREDFIDIFMSTSSNEEPDH-IRLLRGLPLLSQWPIDELPYDDPSICLFTYFRRGTVLCHDSNSGSWVYIVKSGTCRIIKFIQLN 1550
            F +YQ+ E   K +  F     K Q      T+        P  R+ + +      I   ++ +  +  ++Q  L +   +E+F  +R+I+++G    +FYFI  G  TV++      +          L +G SFGE+ L+    RSATV C  + E L V REDF+   +     +E  +     R L +   W  ++L +   ++     F  G ++  D  + +++  +  G C I++ + L 
Sbjct:   16 FREYQIIEPVHKKHPDFSFWDKKKQGRISFVTEDFAAQEKKPSWRTHQEIQDL-CNILQALDCYRSYTESLQLLLAKVIRFERFGRRRVIVKKGQMGNSFYFIYLG--TVAITEDEDGSSAFLDPHPTLLHRGGSFGEMGLLSTTVRSATVVCMEETEFLVVDREDFVANKLGDEVQKETQYRYNFFRNLDIFQSWSEEKL-WKLVALGRIERFSYGQMVSKDFMNSAFITFICQGNCEILRLVALG 258          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Mouse
Match: Cnbd2 (cyclic nucleotide binding domain containing 2 [Source:MGI Symbol;Acc:MGI:1918123])

HSP 1 Score: 80.1073 bits (196), Expect = 2.344e-15
Identity = 65/260 (25.00%), Postives = 113/260 (43.46%), Query Frame = 3
Query:  813 FADYQVAE-----------VDKKSNGM--FDISKFKAQKESILSTDAIEIMRINPKQRSIEMVHSARLAINATVEAFSEFPLNMQTSLIERGWYEKFEAKRIIIRQGHSALNFYFIISGITTVSVARTNKATGETYSETVAFLKKGNSFGELALMFGGKRSATVSCKTDVELLAVSREDFIDIFMSTSSNEEPDH-IRLLRGLPLLSQWPIDELPYDDPSICLFTYFRRGTVLCHDSNSGSWVYIVKSGTCRIIKFIQLN 1550
            F +YQ+ E            DKK  G   F    F AQ E      AI I +  P  R+ + +      I   ++ +  +  ++Q  L +   +E+F  +R+I+++G    +FYFI  G  TV++      +          L +G SFGE+ L+    RSATV C  + E L V REDF+   +     +E  +     R L +   W  ++L +   ++     F  G ++  D  + +++  +  G C I++ + L 
Sbjct:   16 FREYQIIEPVHKKHPDFSFWDKKKQGRISFVTEDFAAQ-EGHFPPRAISITQKKPSWRTHQEIQDL-CNILQALDCYRSYTESLQLLLAKVIRFERFGRRRVIVKKGQMGNSFYFIYLG--TVAITEDEDGSSAFLDPHPTLLHRGGSFGEMGLLSTTVRSATVVCMEETEFLVVDREDFVANKLGDEVQKETQYRYNFFRNLDIFQSWSEEKL-WKLVALGRIERFSYGQMVSKDFMNSAFITFICQGNCEILRLVALG 270          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Mouse
Match: Prkar1b (protein kinase, cAMP dependent regulatory, type I beta [Source:MGI Symbol;Acc:MGI:97759])

HSP 1 Score: 59.3066 bits (142), Expect = 2.945e-9
Identity = 32/86 (37.21%), Postives = 47/86 (54.65%), Query Frame = 3
Query: 1080 IIRQGHSALNFYFIISGITTVSVARTNKATGETYSETVAFLKKGNSFGELALMFGGKRSATVSCKTDVELLAVSREDFIDIFMSTS 1337
            +I+QG+   NFY I  G   V V            E V  + +G SFGELAL++G  R+ATV  KTD++L  + R+ +  I M ++
Sbjct:  164 VIQQGNEGDNFYVIDQGEVDVYVN----------GEWVTNISEGGSFGELALIYGTPRAATVKAKTDLKLWGIDRDSYRRILMGST 239          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Mouse
Match: Prkar1b (protein kinase, cAMP dependent regulatory, type I beta [Source:MGI Symbol;Acc:MGI:97759])

HSP 1 Score: 58.9214 bits (141), Expect = 5.138e-9
Identity = 32/86 (37.21%), Postives = 47/86 (54.65%), Query Frame = 3
Query: 1080 IIRQGHSALNFYFIISGITTVSVARTNKATGETYSETVAFLKKGNSFGELALMFGGKRSATVSCKTDVELLAVSREDFIDIFMSTS 1337
            +I+QG+   NFY I  G   V V            E V  + +G SFGELAL++G  R+ATV  KTD++L  + R+ +  I M ++
Sbjct:   40 VIQQGNEGDNFYVIDQGEVDVYVN----------GEWVTNISEGGSFGELALIYGTPRAATVKAKTDLKLWGIDRDSYRRILMGST 115          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. UniProt/SwissProt
Match: sp|Q95JR6|CNBD2_MACFA (Cyclic nucleotide-binding domain-containing protein 2 OS=Macaca fascicularis OX=9541 GN=CNBD2 PE=2 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 2.240e-16
Identity = 92/392 (23.47%), Postives = 162/392 (41.33%), Query Frame = 3
Query:  690 LLKQRTPIEKFLHGIRIAMLLMKTCRTSSQQTERNNKKFLTFADYQVAE-----------VDKK--SNGMFDISKFKAQKESILSTDAIEIMRINPKQRSIEMVHSARLAINATVEAFSEFPLNMQTSLIERGWYEKFEAKRIIIRQGHSALNFYFIISGITTVSVARTNKATGETYSETVAFLKKGNSFGELALMFGGKRSATVSCKTDVELLAVSREDFIDIFMSTSSNEEPDH-IRLLRGLPLLSQWPIDELPYDDPSICLFTYFRRGTVLCHDSNSGSWVYIVKSGTCRIIKFIQLNSQEQKEKLKHQRDSNDYFTFLTQSFXXXXXXXXXXEIPPPEIRPS---KEFNGKYYI-----QLKILSVGSVFGLEPMAFEFVGGTTGVTL 1799
            LLK+   + +F   I   +++++ C+   Q           F +YQ+ E            DKK  S   FD   F A+ E      AI+IM+  P  R+ + + +    I   ++++  +   +Q  L +   +E+F  +R+II++G    +FYFI  G  TV++      +          L+KG+ FGE  +     R +T+ C  + E L V REDF    +     ++  +     R + L + W  DE  +   ++     F  G ++  D    S++  +  G+C +++ + L +            S  Y  ++ Q          K  +   E  P    KEF  K Y       LK+L +   +GL+  +F    GT+G TL
Sbjct:   12 LLKKELGLYQFATDI---IVMIRVCKMFRQGLR-------GFREYQIIESAHWKHPIFSFWDKKIQSRVTFDTMDFIAE-EGHFPPKAIQIMQKKPSWRTEDEIQTV-CNILQVLDSYRNYAEPLQLLLAKVMRFERFGRRRVIIKKGQKGNSFYFIYLG--TVAITNDEDGSSAFLDPHPKLLQKGSCFGETDIQHASLRRSTIVCMEETEFLVVDREDFFANKLDQEVQKDAQYRFEFFRKMDLFASWS-DEKLWQLVNMSKIERFSYGQLISKDFGESSFIMFISKGSCEVLRLLDLGA------------SPSYHRWVWQHLELIDDRPLKTHL--REYSPMERFKEFQIKSYPLQDFSSLKLLHLKKAWGLQGTSFSRKIGTSGDTL 374          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. UniProt/SwissProt
Match: sp|Q96M20|CNBD2_HUMAN (Cyclic nucleotide-binding domain-containing protein 2 OS=Homo sapiens OX=9606 GN=CNBD2 PE=2 SV=2)

HSP 1 Score: 85.8853 bits (211), Expect = 4.332e-16
Identity = 63/261 (24.14%), Postives = 116/261 (44.44%), Query Frame = 3
Query:  813 FADYQVAEV-----------DKK--SNGMFDISKFKAQKESILSTDAIEIMRINPKQRSIEMVHSARLAINATVEAFSEFPLNMQTSLIERGWYEKFEAKRIIIRQGHSALNFYFIISGITTVSVARTNKATGETYSETVAFLKKGNSFGELALMFGGKRSATVSCKTDVELLAVSREDFIDIFMSTSSNEEPDH-IRLLRGLPLLSQWPIDELPYDDPSICLFTYFRRGTVLCHDSNSGSWVYIVKSGTCRIIKFIQLNS 1553
            F +YQ+ E            DKK  S   FD   F A+ E      AI+IM+  P  R+ + +  A   I   ++++  +   +Q  L +   +E+F  +R+II++G    +FYFI  G  TV++ +    +          L KG+ FGE+ ++    R +T+ C  + E L V REDF    +     ++  +     R + L + W  DE  +   ++     F  G ++  D     ++  +  G+C +++ + L +
Sbjct:   43 FREYQIIETAHWKHPIFSFWDKKMQSRVTFDTMDFIAE-EGHFPPKAIQIMQKKPSWRTEDEIQ-AVCNILQVLDSYRNYAEPLQLLLAKVMRFERFGRRRVIIKKGQKGNSFYFIYLG--TVAITKDEDGSSAFLDPHPKLLHKGSCFGEMDVLHASVRRSTIVCMEETEFLVVDREDFFANKLDQEVQKDAQYRFEFFRKMELFASWS-DEKLWQLVAMAKIERFSYGQLISKDFGESPFIMFISKGSCEVLRLLDLGA 298          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. UniProt/SwissProt
Match: sp|Q9D5U8|CNBD2_MOUSE (Cyclic nucleotide-binding domain-containing protein 2 OS=Mus musculus OX=10090 GN=Cnbd2 PE=1 SV=2)

HSP 1 Score: 83.5741 bits (205), Expect = 2.496e-15
Identity = 65/260 (25.00%), Postives = 114/260 (43.85%), Query Frame = 3
Query:  813 FADYQVAE-----------VDKKSNGM--FDISKFKAQKESILSTDAIEIMRINPKQRSIEMVHSARLAINATVEAFSEFPLNMQTSLIERGWYEKFEAKRIIIRQGHSALNFYFIISGITTVSVARTNKATGETYSETVAFLKKGNSFGELALMFGGKRSATVSCKTDVELLAVSREDFIDIFMSTSSNEEPDH-IRLLRGLPLLSQWPIDELPYDDPSICLFTYFRRGTVLCHDSNSGSWVYIVKSGTCRIIKFIQLN 1550
            F +YQ+ E            DKK  G   F    F AQ E      AI I +  P  R+ + +      + A ++ +  +  ++Q  L +   +E+F  +R+I+++G    +FYFI  G  TV++      +          L +G SFGE+ L+    RSATV C  + E L V REDF+   +     +E  +     R L +   W  ++L +   ++     F  G ++  D  + +++  +  G C I++ + L 
Sbjct:  133 FREYQIIEPVHKKHPDFSFWDKKKQGRISFVTEDFAAQ-EGHFPPRAISITQKKPSWRTHQEIQDLCNILQA-LDCYRSYTESLQLLLAKVIRFERFGRRRVIVKKGQMGNSFYFIYLG--TVAITEDEDGSSAFLDPHPTLLHRGGSFGEMGLLSTTVRSATVVCMEETEFLVVDREDFVANKLGDEVQKETQYRYNFFRNLDIFQSWSEEKL-WKLVALGRIERFSYGQMVSKDFMNSAFITFICQGNCEILRLVALG 387          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. UniProt/SwissProt
Match: sp|P31320|KAPR_BLAEM (cAMP-dependent protein kinase regulatory subunit OS=Blastocladiella emersonii OX=4808 GN=PKAR PE=2 SV=1)

HSP 1 Score: 66.6254 bits (161), Expect = 2.681e-10
Identity = 59/208 (28.37%), Postives = 88/208 (42.31%), Query Frame = 3
Query: 1002 FSEFPLNMQTSLIERGWYEKFEAKRIIIRQGHSALNFYFIISGITTVSVARTNKATGETYSETVAFLKKGNSFGELALMFGGKRSATVSCKTDVELLAVSREDFIDIFMSTSSNEEPDHIRLLRGLPLLSQWPIDELPYDDPSICLF---TYFRRGTVLCHDSNSGSWVYIVKSGTCRIIKFIQLNSQEQKEKLKHQRDSNDYFTFLT 1616
            F     +  T ++     +K  A  ++IRQG     FY + +G   V V R     G+     V     G SFGELALM+   R+ATV    +  L A+ R  F  I M  +S +   +   L  +PLLS       PY+   I        +  G V+    + G   YI+++G   +IK I  N +E   +  H+    +YF  L 
Sbjct:  157 FRNLDEDQYTDVVNAMAEKKVAAGEVVIRQGGVGDYFYVVETGALDVFVNRN--GNGDV---KVTDYSAGGSFGELALMYNAPRAATVVATAESVLWALDRVTFRRILMDHTSRKRRMYEAFLEEVPLLSSLE----PYERHKIADALESVAYADGDVVIRQGDVGENFYIIEAGDAEVIK-IDENGEEHHFRPLHK---GNYFGELA 351          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. UniProt/SwissProt
Match: sp|Q8MLZ3|PDE5_DICDI (cGMP-dependent 3',5'-cGMP phosphodiesterase A OS=Dictyostelium discoideum OX=44689 GN=pdeD PE=1 SV=1)

HSP 1 Score: 66.2402 bits (160), Expect = 7.514e-10
Identity = 44/151 (29.14%), Postives = 71/151 (47.02%), Query Frame = 3
Query:  870 SKFKAQKESILSTDAIEIMRINPKQRSIEMVHSARLAINATVEAFSEFPLNMQTSLIERGWYEKFEAKRIIIRQGHSALNFYFIISGITTVSVARTNKATGETYSETVAFLKKGNSFGELALMFGGKRSATVSCKTDVELLAVSREDFIDI 1322
            S  K  KE +  T ++++M    K    E V   +L    +V+ F   PL     +++     K+    +II +      FY + SG+  V++    K            L  G+ FGE++L+ GG RSA V   TDVE+L+ ++EDF+ I
Sbjct:  570 SGLKIAKEGVAHTLSLDVM----KSSHSEAVDILKLV--ESVDIFRSIPLTQACEILQTATKRKYSQGSVIIARDTEPDAFYVVASGVVCVNIGELKKN-----------LIVGDYFGEMSLVMGGLRSANVQAVTDVEVLSFNKEDFLSI 703          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. TrEMBL
Match: A0A267GLV4 (Cyclic nucleotide-binding domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig018331g2 PE=4 SV=1)

HSP 1 Score: 449.129 bits (1154), Expect = 1.100e-143
Identity = 254/598 (42.47%), Postives = 364/598 (60.87%), Query Frame = 3
Query:  264 SDQEKENKITPFQIPDFVIEATVDENETQTNTDNSSQTPISSEIQSENKLNVVDKGPQEKNADKKVYKLQIGVADFAKKVKDNEGMGISTFSXXXXXXXXXXXXXXXXXXRKRKIMKSSLSTLRTDHYVKMLAIATTK----RKEFLLKQRTPIEKFLHGIRIAMLLMKTCRTSSQQTERNNKKFLTFADYQVAEV-DKKSNGM-FDISKFKAQKESILSTDAIEIMRINPKQRSIEMVHSARLAINATVEAFSEFPLNMQTSLIERGWYEKFEAKRIIIRQGHSALNFYFIISGITTVSVARTNKATGETYSETVAFLKKGNSFGELALMFGGKRSATVSCKTDVELLAVSREDFIDIFMSTSSNEEPDHIRLLRGLPLLSQWPIDELPYDDPSICLFTYFRRGTVLCHDSNSGSWVYIVKSGTCRIIKFIQ---------LNSQEQKEKLKHQRDSND--YFTFLTQSFXXXXXXXXX----XEIPPPEIRPSKEFNGKYYIQLKILSVGSVFGLEPMAFEFVGGTTGVTLVSDGAELVAIERNFFQKHMSRQYQSWLRKELQPFPTIENLKGKLKNFYQWADYKESMIRAIIFDK 1994
            SDQ + +  +P         A  DE    +++ +S ++ +  E+ +  +  V         A  K   L++ +ADF +K++DNEG  ISTFS   E +    +E E         + +       D   + L  A  +    +K++  K  TP+ +    ++   LL+K C T  +QT +N ++ +TF+D   +   D +S+ + F +S +KA+KE  LS +A EI+R++P  R+ EM+H+A +++   VEAFSEFP NM+ SL++ GWYEKF A ++IIRQGH+ALNFYFIISG T VSVA   K TGE +++TVAFL+KG SFGELAL++GGKRSATV CK +VELLAVSREDFIDIFM+  S +EP+HI  LR +P L+ WPID+LPYD+P +C+F YFR+G VLC DSNS   V IVKSG C ++K +Q          + Q   +    ++D++D  Y  F+ +      KS  +      +P    RPS    GK YIQLK+L     FGLEP+AF   GGTTGVTLVS GAE + I + FF KHM+ +Y   LR+E+Q FPT+E+L  KL+++Y W  YKE+++  ++  K
Sbjct:  235 SDQPQSSAASPTAEAAESKPAATDEGAEDSDSGSSCRSCL--EMVTAQRAGVEKPQAAAGPAGGKKPGLKMAMADFTRKIEDNEGTEISTFSFLGEKDKPAPDEEEEVGQDSAADVGAPAFGAPIDLSRESLRQAAKQLHQHKKKY--KNMTPLNRMRRAVKTVNLLIKACTTKEEQTRKNQQRMMTFSDIASSLAQDSQSDELNFQLSYYKAKKEMTLSPEAQEILRLHPFLRTKEMLHTAMVSLQTAVEAFSEFPTNMKQSLVKVGWYEKFNANQVIIRQGHNALNFYFIISGTTAVSVA-LKKPTGEPFNKTVAFLRKGESFGELALLYGGKRSATVYCKDEVELLAVSREDFIDIFMNLESEDEPEHISFLRDIPTLNGWPIDQLPYDNPKVCMFAYFRKGIVLCRDSNSADSVLIVKSGHCLVMKDLQPCASTIPRLRSRQRMCDSYPVEQDTDDQRYLEFMQRDCLPEPKSGDRGGVGQSLPRVVARPS----GKLYIQLKVLQRRDTFGLEPIAFRVFGGTTGVTLVSMGAECILINKEFFLKHMTEKYYQLLRREIQMFPTLESLNEKLQSYYNWDAYKETLVNFVVRPK 823          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. TrEMBL
Match: A0A267GJ56 (Cyclic nucleotide-binding domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig018331g3 PE=4 SV=1)

HSP 1 Score: 448.358 bits (1152), Expect = 2.025e-143
Identity = 254/598 (42.47%), Postives = 364/598 (60.87%), Query Frame = 3
Query:  264 SDQEKENKITPFQIPDFVIEATVDENETQTNTDNSSQTPISSEIQSENKLNVVDKGPQEKNADKKVYKLQIGVADFAKKVKDNEGMGISTFSXXXXXXXXXXXXXXXXXXRKRKIMKSSLSTLRTDHYVKMLAIATTK----RKEFLLKQRTPIEKFLHGIRIAMLLMKTCRTSSQQTERNNKKFLTFADYQVAEV-DKKSNGM-FDISKFKAQKESILSTDAIEIMRINPKQRSIEMVHSARLAINATVEAFSEFPLNMQTSLIERGWYEKFEAKRIIIRQGHSALNFYFIISGITTVSVARTNKATGETYSETVAFLKKGNSFGELALMFGGKRSATVSCKTDVELLAVSREDFIDIFMSTSSNEEPDHIRLLRGLPLLSQWPIDELPYDDPSICLFTYFRRGTVLCHDSNSGSWVYIVKSGTCRIIKFIQ---------LNSQEQKEKLKHQRDSND--YFTFLTQSFXXXXXXXXX----XEIPPPEIRPSKEFNGKYYIQLKILSVGSVFGLEPMAFEFVGGTTGVTLVSDGAELVAIERNFFQKHMSRQYQSWLRKELQPFPTIENLKGKLKNFYQWADYKESMIRAIIFDK 1994
            SDQ + +  +P         A  DE    +++ +S ++ +  E+ +  +  V         A  K   L++ +ADF +K++DNEG  ISTFS   E +    +E E         + +       D   + L  A  +    +K++  K  TP+ +    ++   LL+K C T  +QT +N ++ +TF+D   +   D +S+ + F +S +KA+KE  LS +A EI+R++P  R+ EM+H+A +++   VEAFSEFP NM+ SL++ GWYEKF A ++IIRQGH+ALNFYFIISG T VSVA   K TGE +++TVAFL+KG SFGELAL++GGKRSATV CK +VELLAVSREDFIDIFM+  S +EP+HI  LR +P L+ WPID+LPYD+P +C+F YFR+G VLC DSNS   V IVKSG C ++K +Q          + Q   +    ++D++D  Y  F+ +      KS  +      +P    RPS    GK YIQLK+L     FGLEP+AF   GGTTGVTLVS GAE + I + FF KHM+ +Y   LR+E+Q FPT+E+L  KL+++Y W  YKE+++  ++  K
Sbjct:  235 SDQPQSSAASPTAEAAESKPAATDEGAEDSDSGSSCRSCL--EMVTAQRAGVEKPQAAAGPAGGKKPGLKMAMADFTRKIEDNEGTEISTFSFLGEKDKPAPDEEEEVGQDSAADVGAPAFGAPIDLSRESLRQAAKQLHQHKKKY--KNMTPLNRMRRAVKTVNLLIKACTTKEEQTRKNQQRMMTFSDIASSLAQDSQSDELNFQLSYYKAKKEMTLSPEAQEILRLHPFLRTKEMLHTAMVSLQTAVEAFSEFPTNMKQSLVKVGWYEKFNANQVIIRQGHNALNFYFIISGTTAVSVA-LKKPTGEPFNKTVAFLRKGESFGELALLYGGKRSATVYCKDEVELLAVSREDFIDIFMNLESEDEPEHISFLREIPTLNGWPIDQLPYDNPKVCMFAYFRKGIVLCRDSNSADSVLIVKSGHCLVMKDLQPCASTIPRLRSRQRMCDSYPVEQDTDDQRYLEFMQRDCLPEPKSGDRGGVGQSLPRVVARPS----GKLYIQLKVLQRRDTFGLEPIAFRVFGGTTGVTLVSMGAECILINKEFFLKHMTEKYYQLLRREIQMFPTLESLNEKLQSYYNWDAYKETLVNFVVRPK 823          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. TrEMBL
Match: A0A267FBU3 (Cyclic nucleotide-binding domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig018331g1 PE=4 SV=1)

HSP 1 Score: 444.891 bits (1143), Expect = 4.963e-142
Identity = 253/598 (42.31%), Postives = 363/598 (60.70%), Query Frame = 3
Query:  264 SDQEKENKITPFQIPDFVIEATVDENETQTNTDNSSQTPISSEIQSENKLNVVDKGPQEKNADKKVYKLQIGVADFAKKVKDNEGMGISTFSXXXXXXXXXXXXXXXXXXRKRKIMKSSLSTLRTDHYVKMLAIATTK----RKEFLLKQRTPIEKFLHGIRIAMLLMKTCRTSSQQTERNNKKFLTFADYQVAEV-DKKSNGM-FDISKFKAQKESILSTDAIEIMRINPKQRSIEMVHSARLAINATVEAFSEFPLNMQTSLIERGWYEKFEAKRIIIRQGHSALNFYFIISGITTVSVARTNKATGETYSETVAFLKKGNSFGELALMFGGKRSATVSCKTDVELLAVSREDFIDIFMSTSSNEEPDHIRLLRGLPLLSQWPIDELPYDDPSICLFTYFRRGTVLCHDSNSGSWVYIVKSGTCRIIKFIQ---------LNSQEQKEKLKHQRDSND--YFTFLTQSFXXXXXXXXX----XEIPPPEIRPSKEFNGKYYIQLKILSVGSVFGLEPMAFEFVGGTTGVTLVSDGAELVAIERNFFQKHMSRQYQSWLRKELQPFPTIENLKGKLKNFYQWADYKESMIRAIIFDK 1994
            SDQ + +  +P         A  DE    +++ +S ++ +  E+ +  +  V         A  K   L++ +ADF +K++DNEG  ISTFS   E +    +E E         + +       D   + L  A  +    +K++  K  TP+ +    ++   LL+K C T  +QT +N ++ +TF+D   +   D +S+ + F +S +KA+KE  LS +A EI+R++P  R+ EM+H+A +++   VEAFSEFP NM+ SL++ GWYEKF A ++IIRQGH+ALNFYFIISG T VSVA   K TGE +++TVAFL+KG SFGELAL++GGKRSATV CK +VELLAVSREDFIDIFM+  S +EP+HI  LR +  L+ WPID+LPYD+P +C+F YFR+G VLC DSNS   V IVKSG C ++K +Q          + Q   +    ++D++D  Y  F+ +      KS  +      +P    RPS    GK YIQLK+L     FGLEP+AF   GGTTGVTLVS GAE + I + FF KHM+ +Y   LR+E+Q FPT+E+L  KL+++Y W  YKE+++  ++  K
Sbjct:  235 SDQPQSSAASPTAEAAESKPAATDEGAEDSDSGSSCRSCL--EMVTAQRAGVEKPQATAGPAGGKKPGLKMAMADFTRKIEDNEGTEISTFSFLGEKDKPAPDEEEEVGQDSAADVGAPAFGAPIDLSRESLRQAAKQLHQHKKKY--KNMTPLNRMRRAVKTVNLLIKACTTKEEQTRKNQQRMMTFSDIASSLAQDSQSDELNFQLSYYKAKKEMTLSPEAQEILRLHPFLRTKEMLHTAMVSLQTAVEAFSEFPTNMKQSLVKVGWYEKFNANQVIIRQGHNALNFYFIISGTTAVSVA-LKKPTGEPFNKTVAFLRKGESFGELALLYGGKRSATVYCKDEVELLAVSREDFIDIFMNLESEDEPEHISFLREITTLNGWPIDQLPYDNPKVCMFAYFRKGIVLCRDSNSADSVLIVKSGHCLVMKDLQPCASTIPRLRSRQRMCDSYPVEQDTDDQRYLEFMQRDCLPEPKSGDRGGVGQSLPRVVARPS----GKLYIQLKVLQRRDTFGLEPIAFRVFGGTTGVTLVSMGAECILINKEFFLKHMTEKYYQLLRREIQMFPTLESLNEKLQSYYNWDAYKETLVNFVVRPK 823          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. TrEMBL
Match: A0A4Z2DPW9 (Cyclic nucleotide-binding domain-containing protein OS=Schistosoma japonicum OX=6182 GN=EWB00_010064 PE=4 SV=1)

HSP 1 Score: 345.125 bits (884), Expect = 1.258e-105
Identity = 176/377 (46.68%), Postives = 248/377 (65.78%), Query Frame = 3
Query:  861 FDISKFKAQKESILSTDAIEIMRINPKQRSIEMVHSARLAINATVEAFSEFPLNMQTSLIERGWYEKFEAKRIIIRQGHSALNFYFIISGITTVSVARTNKATGETYSETVAFLKKGNSFGELALMFGGKRSATVSCKTDVELLAVSREDFIDIFMSTSSNEEPDHIRLLRGLPLLSQWPIDELPYDDPSICLFTYFRRGTVLCHDSNSGSWVYIVKSGTCRIIKFIQLNSQEQKEKLKHQRDSNDYFTFLTQSFXXXXXXXXXXEIPPPEIRPSKEFNG---KYYIQLKILSVGSVFGLEPMAFEFVGGTTGVTLVSDGAELVAIERNFFQKHMSRQYQSWLRKELQPFPTIENLKGKLKNFYQWADYKESMIRAI 1982
            FD   FK  +E  L+ DA++I+ +  K R+  M+HSA +A+ AT+EAFSEFP+ MQ ++I + WYEK+EA+R+IIRQG   LNFYFIISG   VSV+R +K TGE Y ETVAFLK G SFGELAL++GGKRSAT+ CKT VELL +S+++F  IFM  ++N E +H+  LR +PL+    +D+L   D +I LFTYFRR   +C DSN  +W+YIVK+G CRI+K ++L  +  K   + +     +F  +                     + +K+ N    K +I+LKIL   SVFGLE +AFE  GGTT V+LVS+GAE VAI + FF ++    + +WLR ++QPFP+++ L+ KL  + QW  Y++S++R I
Sbjct:  288 FDKFAFKINREKHLTYDAVKILTLPSKYRTESMIHSATVAVIATIEAFSEFPIAMQKAIIGKAWYEKYEARRMIIRQGQPPLNFYFIISGSVVVSVSRRDKQTGEPYEETVAFLKAGQSFGELALIYGGKRSATIICKTLVELLVMSQDEFNKIFMQNTNNNEIEHVAFLRTIPLIPNEVVDKLCQADDTILLFTYFRRNVTICIDSNQSNWIYIVKTGQCRILKDVELRQEHLKSTDRPKTSCQYHFNSMENKKKSELDHQ----------KSTKQLNNTNVKVFIELKILEPNSVFGLESIAFEPFGGTTSVSLVSNGAECVAINKQFFVENCPTNFLNWLRSKVQPFPSVDELESKLNTYRQWKIYRKSVVRHI 654          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. TrEMBL
Match: A0A5K4FDU7 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 345.51 bits (885), Expect = 5.613e-105
Identity = 191/435 (43.91%), Postives = 264/435 (60.69%), Query Frame = 3
Query:  693 LKQRTPIEKFLHGIRIAMLLMKTCRT-----SSQQTERNNKKFLTFADYQV-AEVDKKSNGM-FDISKFKAQKESILSTDAIEIMRINPKQRSIEMVHSARLAINATVEAFSEFPLNMQTSLIERGWYEKFEAKRIIIRQGHSALNFYFIISGITTVSVARTNKATGETYSETVAFLKKGNSFGELALMFGGKRSATVSCKTDVELLAVSREDFIDIFMSTSSNEEPDHIRLLRGLPLLSQWPIDELPYDDPSICLFTYFRRGTVLCHDSNSGSWVYIVKSGTCRIIKFIQLNSQEQKEKLKHQRDSNDYFTFLTQSFXXXXXXXXXXEIPPPEIRPSKEFNGKYYIQLKILSVGSVFGLEPMAFEFVGGTTGVTLVSDGAELVAIERNFFQKHMSRQYQSWLRKELQPFPTIENLKGKLKNFYQWADYKESMIR 1976
            +K+  PI+ F   I   +LL  T          +  +  NK   TF + Q   EV    + + FD   +K  +E  L+ DA++I+ +  K R+  M+HSA +++ AT EAFSEFP+ MQ ++I + WYEK+EA+R+IIRQG   LNFYFIISG   VSV+R NK TGE Y ETVAFLK G SFGELAL++GGKRSAT+ CKT VELL +S  +F  IFM  + N E DHI  LR +  + +  ++ L   D +I LFT+FRR   +C DSN  +W+YIVK+G CRI+K ++L  +  K  +K  R   D   +   S  ++    +         +     N K +I+LKIL   SVFGLE +AFE  GGTT V+LVSDGAE VAI + FF +H    + +WLR ++QPFP++E L+ KL  + QW  Y+  +I+
Sbjct:  290 MKKIQPIKLFKRIIIAGLLLRATLNLIRPIQELKDAKLRNKSAQTFVELQKNIEVKLNIDHLGFDKYAYKINREKYLTHDAVKILTLPSKYRTESMIHSATVSVIATTEAFSEFPIAMQKAIIGKAWYEKYEARRMIIRQGQPPLNFYFIISGSVVVSVSRKNKQTGEPYEETVAFLKAGQSFGELALIYGGKRSATIICKTPVELLVMSNNEFNQIFMQNTLNHEADHITFLRTIQFIPKQVVNHLNGVDSTILLFTFFRRNVTICIDSNQSNWIYIVKTGQCRILKDVELKPKHLKSTIKTHRPGTDLQYYFESSCHNAKSKLNSQN----SAKKLDNKNDKIFIELKILEPSSVFGLESIAFEPFGGTTSVSLVSDGAECVAINKTFFIEHCPTNFLNWLRSKVQPFPSVEELESKLNTYRQWKMYRHHIIQ 720          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Cavefish
Match: ENSAMXT00000002114.2 (cGMP-dependent protein kinase 2-like [Source:NCBI gene;Acc:103041230])

HSP 1 Score: 63.5438 bits (153), Expect = 5.467e-10
Identity = 42/163 (25.77%), Postives = 78/163 (47.85%), Query Frame = 3
Query: 1053 YEK-FEAKRIIIRQGHSALNFYFIISGITTVSVARTNKATGETYSETVAFLKKGNSFGELALMFGGKRSATVSCKTDVELLAVSREDFIDIFMSTSSNEEPDHIRLLRGLPLLSQWPIDELPYDDPSICL-FTYFRRGTVLCHDSNSGSWVYIVKSGTCRIIK 1535
            YEK + A +++I++G      Y +  G+  + V +  K  G+        ++ G +FGELA+++  KR+ATV   T   + A+ R+ F  I M ++     ++   LR + LL   P ++L       CL   YF +G  +  +   G+  +I+  G   + +
Sbjct:  194 YEKVYTANQLVIQEGEPGNYLYVLAEGL--LEVIQNGKLLGQ--------MRPGTAFGELAILYNCKRTATVKAVTQSHIWALDRQTFQSIMMRSTQARHEEYFSFLRSVSLLKDLPEEKLA--KIVDCLEIDYFDKGEYIIREGEEGNTFFIIAKGEVSVTQ 344          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Cavefish
Match: prkar1b (protein kinase cAMP-dependent type I regulatory subunit beta [Source:NCBI gene;Acc:111191378])

HSP 1 Score: 58.5362 bits (140), Expect = 1.006e-8
Identity = 33/90 (36.67%), Postives = 47/90 (52.22%), Query Frame = 3
Query: 1068 AKRIIIRQGHSALNFYFIISGITTVSVARTNKATGETYSETVAFLKKGNSFGELALMFGGKRSATVSCKTDVELLAVSREDFIDIFMSTS 1337
            A   +I+QG    NFY I  G   V V            E V  + +G SFGELAL++G  R+ATV  KTD++L  + R+ +  I M ++
Sbjct:  161 AGETVIQQGDEGDNFYVIDQGEVDVYVN----------GEWVTGIGEGGSFGELALIYGTPRAATVKAKTDLKLWGIDRDSYRRILMGST 240          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Cavefish
Match: prkar1ab (cAMP-dependent protein kinase type I-alpha regulatory subunit [Source:NCBI gene;Acc:103038385])

HSP 1 Score: 57.7658 bits (138), Expect = 2.163e-8
Identity = 35/112 (31.25%), Postives = 56/112 (50.00%), Query Frame = 3
Query: 1002 FSEFPLNMQTSLIERGWYEKFEAKRIIIRQGHSALNFYFIISGITTVSVARTNKATGETYSETVAFLKKGNSFGELALMFGGKRSATVSCKTDVELLAVSREDFIDIFMSTS 1337
            FS    N ++ + +  +   + A  I+I+QG    NFY I  G   V V           +E    + +G SFGELAL++G  R+ATV  KT+ +L  + R+ +  I M ++
Sbjct:  136 FSHLDDNERSDIFDAMFPVTYIAGEIVIQQGDEGDNFYVIDQGEMDVYVN----------NEWATSIGEGGSFGELALIYGTPRAATVRAKTNAKLWGIDRDSYRRILMGST 237          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Cavefish
Match: prkar1aa (cAMP-dependent protein kinase type I-alpha regulatory subunit [Source:NCBI gene;Acc:103047413])

HSP 1 Score: 56.6102 bits (135), Expect = 4.045e-8
Identity = 36/112 (32.14%), Postives = 57/112 (50.89%), Query Frame = 3
Query: 1002 FSEFPLNMQTSLIERGWYEKFEAKRIIIRQGHSALNFYFIISGITTVSVARTNKATGETYSETVAFLKKGNSFGELALMFGGKRSATVSCKTDVELLAVSREDFIDIFMSTS 1337
            F+    N ++ + +  +   + A   +I+QG    NFY I  G   V V   N A        V  + +G SFGELAL++G  R+ATV  KT+V+L  + R+ +  I M ++
Sbjct:  136 FAHLDDNERSDIFDAMFPVNYIAGETVIQQGDEGDNFYVIDQGEMDVYV---NNAW-------VTSIGEGGSFGELALIYGTPRAATVRAKTNVKLWGIDRDSYRRILMGST 237          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Cavefish
Match: prkg2 (protein kinase cGMP-dependent 2 [Source:NCBI gene;Acc:103030142])

HSP 1 Score: 56.225 bits (134), Expect = 1.116e-7
Identity = 43/191 (22.51%), Postives = 82/191 (42.93%), Query Frame = 3
Query: 1035 LIERGWYEKFEAKRIIIRQGHSALNFYFIISGITTVSVARTNKATGETYSETVAFLKKGNSFGELALMFGGKRSATVSCKTDVELLAVSREDFIDIFMSTSSNEEPDHIRLLRGLPLLSQWPIDELPYDDPSICL-FTYFRRGTVLCHDSNSGSWVYIVKSGTCRIIKFIQLNSQEQKEKLKHQRDSNDYF 1604
            ++E  +   ++    +I+QG    + + +  G   + V + NK         +  +    +FGELA+++   R+A+V   + V    + RE F +I   T+      H   LR + LL+  P D+L       CL   Y+ +G  +  +   G+  YI+  G    +K  Q     ++ ++ +     DYF
Sbjct:  187 MVECMYERTYQQGEFVIKQGEPGNHLFVLADG--NIDVYQNNK--------LLTSIAVWTTFGELAILYNCTRTASVKAASGVRTWVLDREVFHNIMRMTAEARHEQHRSFLRSVSLLASLPEDKLT--KIVDCLEVEYYDKGDYVIREGEEGNTFYIIARGK---VKVTQSTKDHEEPQVINTLQKGDYF 362          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005682.1 (pep scaffold:Pmarinus_7.0:GL476331:764222:769958:1 gene:ENSPMAG00000005146.1 transcript:ENSPMAT00000005682.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 101.293 bits (251), Expect = 3.667e-23
Identity = 91/380 (23.95%), Postives = 158/380 (41.58%), Query Frame = 3
Query:  993 VEAFSEFPLNMQTSLIERGWYEKFEAKRIIIRQGHSALNFYFIISGITTVSVARTNKATGETYSETVAFLKKGNSFGELALMFGGKRSATVSCKTDVELLAVSREDFIDIFMSTSSNEEPDH-IRLLRGLPLLSQWPIDELPYDDPSICLFTYFRRGTVLCHDSNSGSWVYIVKSGTCRIIKFIQLNSQ-------EQKEKLKHQRDSNDYFTF-------LTQSFXXXXXXXXXXEIPPPEIRPSKEFNG-----KY---------------------------------YIQLKILSVGSVFGLEP-MAFEFVGGTTGVTLVSDGAELVAIERNFFQKHMSRQYQSWLRKELQPFPTIENLKGKLKNFYQWADYKESM 1970
            + +F  +  ++Q  L     YEKF  +R+I+++GH    FYF+ SG+  V+V + N  +          L+KG  FGE+AL+    R+AT+ C  + ELL V +EDF    +     +E  H     R L L S W  DE        C    F  G V+  D++    +  V  G C +++ + L+         +Q+ K++ ++ +  +F         +  S   S   + K   P   IRP+++ +G     KY                                 YI++  +  G  FGL+  +  EF      + + S GA+++ +  + F + M+      L+K+ +P+P  + L        QW  YK  +
Sbjct:   31 LSSFRRYTAHLQLMLAGVVRYEKFGRRRVIVKKGHYGRRFYFVFSGL--VAVTKDNDGSSAFIDPEPILLRKGAGFGEIALLKDLSRNATIVCMEETELLVVDKEDFFAYKLDQELRKEFQHRYNYFRSLELFSTWS-DESLETMADHCKIEEFNHGQVVTGDTSETKNIIFVIKGCCDVLRLVDLSGCPSYHDWLQQQVKIQEKKIAGTHFNVYLHDSDKIKNSKKKSCSLNCKTYFPCLSIRPTRQSSGSDENLKYSVITEKLQVIEQTSKTVNANTINTKPTLNLSAVYIRVDAIRPGQYFGLKQFLVPEFHRDGRPMVITSQGAKVLRVRLDKFGELMNDATLKELKKQSEPYPKDDALCQIFLEQNQWKLYKREL 407          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005026.1 (pep scaffold:Pmarinus_7.0:GL484567:1893:8879:-1 gene:ENSPMAG00000004571.1 transcript:ENSPMAT00000005026.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 48.1358 bits (113), Expect = 1.916e-7
Identity = 22/51 (43.14%), Postives = 34/51 (66.67%), Query Frame = 3
Query: 1185 ETVAFLKKGNSFGELALMFGGKRSATVSCKTDVELLAVSREDFIDIFMSTS 1337
            E V  + +G SFGELAL++G  R+ATV  KTD++L  + R+ +  I M ++
Sbjct:   28 ELVTSIGEGGSFGELALIYGTPRAATVKAKTDLKLWGIDRDSYRRILMGST 78          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001198.1 (pep scaffold:Pmarinus_7.0:GL480445:10050:25657:1 gene:ENSPMAG00000001068.1 transcript:ENSPMAT00000001198.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 50.8322 bits (120), Expect = 4.844e-7
Identity = 47/172 (27.33%), Postives = 75/172 (43.60%), Query Frame = 3
Query: 1026 QTSLIERGWYEKFEAK-RIIIRQGHSALNFYFIISGITTVSVARTNKATGETYSETVAFLKKGNSFGELALMFGGKRSATVSCKTDVELLAVSREDFIDIFMSTSSNEEPDHIRLLRGLPLLSQWPIDELP--YDDPSICL-FTYFRRGTVLCHDSNSGSWVYIVKSGTCRI 1529
            QT L+     E   A+   II +G S+      + G+  VS             E++  L+ G  FGELA+++   R+ATV   TDV LL +SR  F  + M  S       I+ L+    L   P ++L   +D    C+  + F  G  + ++   G   Y++  G  R+
Sbjct:   20 QTVLLGDCMSETTRARGETIIAEGDSSRRLKVDVEGLLDVS----------KQGESLCTLQPGALFGELAILYDCTRTATVKALTDVRLLYLSRHAFRSVLMRESQLRRKLIIKFLKTAKTLKNLPDEQLSKMFD----CMEESAFADGEAIVNEGEVGHIFYVILRGQVRV 177          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Yeast
Match: BCY1 (Regulatory subunit of the cyclic AMP-dependent protein kinase (PKA); PKA is a component of a signaling pathway that controls a variety of cellular processes, including metabolism, cell cycle, stress response, stationary phase, and sporulation [Source:SGD;Acc:S000001295])

HSP 1 Score: 51.6026 bits (122), Expect = 2.223e-7
Identity = 43/155 (27.74%), Postives = 67/155 (43.23%), Query Frame = 3
Query: 1080 IIRQGHSALNFYFIISGITTVSVARTNKATGETYSETVAFLKKGNSFGELALMFGGKRSATVSCKTDVELLAVSREDFIDIFMSTSSNEEPDHIRLLRGLPLLSQWPIDELPYDDPSI--CLFT-YFRRGTVLCHDSNSGSWVYIVKSGTCRIIK 1535
            II+QG     FY +  G     V   NK               G+SFGELALM+   R+ATV   +D  L A+ R  F  I + +S  +   +  LL+ +P+L         YD   +   L T  ++ G  +  + + G   Y+++ G   + K
Sbjct:  211 IIKQGDQGDYFYVVEKGTVDFYV-NDNKVNSSG---------PGSSFGELALMYNSPRAATVVATSDCLLWALDRLTFRKILLGSSFKKRLMYDDLLKSMPVLKSLTT----YDRAKLADALDTKIYQPGETIIREGDQGENFYLIEYGAVDVSK 351          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Nematostella
Match: EDO37972 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SE96])

HSP 1 Score: 192.2 bits (487), Expect = 1.331e-57
Identity = 96/174 (55.17%), Postives = 121/174 (69.54%), Query Frame = 3
Query:  855 GM-FDISKFKAQKESILSTDAIEIMRINPKQRSIEMVHSARLAINATVEAFSEFPLNMQTSLIERGWYEKFEAKRIIIRQGHSALNFYFIISGITTVSVARTNKATGETYSETVAFLKKGNSFGELALMFGGKRSATVSCKTDVELLAVSREDFIDIFMSTSSNEEPDHIRLLR 1373
            GM FD + +KA +E  LS DA++I+ ++P  R+ E +  A +A+ A+V AF E+PL MQ   ++ GWYE FEAKR+IIRQGH A NFYFI+SG   V++   +  TGE  S TVA L KG+SFGELAL+    RSATV CK DV LLAV REDF DIFMS    +EPDHI+ LR
Sbjct:    1 GMAFDPNYYKAVREIKLSQDAVQILSMSPGTRTDEQLQGALVALKASVPAFGEYPLKMQQQPVKVGWYESFEAKRVIIRQGHPAENFYFILSGTALVTLLFVDPVTGEQRSNTVAVLGKGSSFGELALLHHKTRSATVLCKEDVALLAVGREDFRDIFMSYEDGKEPDHIQFLR 174          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Nematostella
Match: EDO48124 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RK87])

HSP 1 Score: 196.052 bits (497), Expect = 1.191e-54
Identity = 117/328 (35.67%), Postives = 180/328 (54.88%), Query Frame = 3
Query:  624 STLRTDHYVKMLAIATTKRKEFLLKQRTPIEKFLHGIRIAMLLMKTCRTS-SQQTERNNKKFLTFADYQVAEVDKKSNG--MFDISKFKAQKESILSTDAIEIMRINPKQRSIEMVHSARLAINATVEAFSEFPLNMQTSLIERGWYEKFEAKRIIIRQGHSALNFYFIISGITTVSVARTNKATGETYSETVAFLKKGNSFGELALMFGGKRSATVSCKTDVELLAVSREDFIDIFMSTSSNE---EPDHIRLLRGLPLLSQWPIDELPYDDPSICLFTYFRRGTVLCHDSNSGSWVYIVKSGTCRIIKFIQLNSQEQKEKLKHQRD 1589
            STL  DH+ +  A   TK   +  K   P+E     IR+  +    C+    ++TE ++     F  Y   + DK  +G   FD S +KA ++  +S +   I++   +QR+ +       ++  ++ AF+E+P  +Q  LI  GWYE   +KR I+RQG     FYF++SG   V+V        +T++ TV FL++G+SFGELA++   +R +TV  +  +ELL +SREDFIDIFM     +   +PDH   LR L  L  WPI EL   +P  CLF +FR G+VL  DSN   W+YI+K G+C+++K +    +E K +L   +D
Sbjct:   60 STL--DHWGQRTAPGVTK---YFDKNLPPVELLRRCIRLVQMFASLCQYKFEKETEESDVAHTVFTQYINDDEDKPMDGGLAFDASFYKANRKMRVSAEVKNILQSPQEQRTEQQCAKVLFSLR-SIRAFAEYPQRIQHKLINVGWYESHSSKRAILRQGQIPQAFYFVLSGSAVVTVL----GEHDTFARTVHFLRRGDSFGELAILHDTQRQSTVISREPIELLVISREDFIDIFMLAGGIKNITDPDHQIFLRSLEFLKGWPI-ELLATNPKKCLFHFFRSGSVLVKDSNHTDWIYIIKWGSCQVLKKL----KEVKSRLTEHKD 372          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Nematostella
Match: EDO49748 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFM7])

HSP 1 Score: 121.709 bits (304), Expect = 3.664e-32
Identity = 62/159 (38.99%), Postives = 102/159 (64.15%), Query Frame = 3
Query:  900 LSTDAIEIMRINPKQRSIEMVHSARLAINATVEAFSEFPLNMQTSLIERGWYEKFEAKRIIIRQGHSALNFYFIISGITTVSVARTNKATGETYSETVAFLKKGNSFGELALMFGGKRSATVSCKTDVELLAVSREDFIDIFMSTSSNE-EPDHIRLLR 1373
            +S +   I+ + P++R+ E + +   A+  T+ +F+E PL+MQ S+ +  W++   A +II++QGH A NFYFI+SG  TV V+  +  +G+ ++ +VA L++G SFG+LA++    R+ATV  K  + LL +SRED+  IFM  S +  EP HI+  R
Sbjct:    3 ISKEVKSILSLRPEERNTEQLQTVLYALQ-TMSSFAELPLHMQESVCKVAWHQSLPANKIIVKQGHLAENFYFIMSGSVTV-VSENDPTSGQVFA-SVATLRRGASFGDLAILKNCTRTATVVSKVPIHLLVISREDYQRIFMGRSQDGMEPSHIKFCR 158          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Nematostella
Match: EDO32932 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STN2])

HSP 1 Score: 98.5969 bits (244), Expect = 3.811e-24
Identity = 48/133 (36.09%), Postives = 82/133 (61.65%), Query Frame = 3
Query:  945 RSIEMVHSARLAINATVEAFSEFPLNMQTSLIERGWYEKFEAKRIIIRQGHSALNFYFIISGITTVSVARTNKATGETYSETVAFLKKGNSFGELALMFGGKRSATVSCKTDVELLAVSREDFIDIFMSTSSN 1343
            RS+E V    L I   ++ F  +P+ ++  L +  +Y+ +E  R+II+QGH  ++FYFI+SG   V     ++ TGE +++ ++ +  G+SFGELALM   +R+AT+ CK   E L V ++DF +++   SS+
Sbjct:   13 RSVEEVDMV-LQIVKRMKGFQRYPMYVKRELAKVLYYDVYEQDRVIIKQGHIGVSFYFIVSGSVVVQRVEEDRTTGEKHNQIISEMTGGDSFGELALMHDIRRTATIICKERSEFLRVDKDDFNEVYPVNSSS 144          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Nematostella
Match: EDO32940 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STN1])

HSP 1 Score: 80.1073 bits (196), Expect = 1.113e-17
Identity = 42/118 (35.59%), Postives = 69/118 (58.47%), Query Frame = 3
Query:  993 VEAFSEFPLNMQTSLIERGWYEKFEAKRIIIRQGHSALN-FYFIISGITTVSVARTNKATGETYSETVAFLKKGNSFGELALMFGGKRSATVSCKTDVELLAVSREDFIDIFMSTSSN 1343
            ++AF ++ +  +  L +  +YE+FE  R++++QGH  ++  YFI+SG   V VA  +K TG+     V  +  G+SFGELAL+   KR+AT+ CK   E L + +  F ++    SS 
Sbjct:   31 LKAFKKYSVLERRGLAKVVYYEQFEDGRVVVQQGHKGISSLYFILSGAVLVQVAEEDKTTGKITEHIVGEMFAGDSFGELALLHDIKRTATIICKGRAEFLRLDKPGFDEVRRQLSST 148          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Medaka
Match: ENSORLT00000001298.2 (cGMP-dependent protein kinase 2 [Source:NCBI gene;Acc:101165996])

HSP 1 Score: 61.6178 bits (148), Expect = 1.967e-9
Identity = 42/157 (26.75%), Postives = 74/157 (47.13%), Query Frame = 3
Query: 1053 YEK-FEAKRIIIRQGHSALNFYFIISGITTVSVARTNKATGETYSETVAFLKKGNSFGELALMFGGKRSATVSCKTDVELLAVSREDFIDIFMSTSSNEEPDHIRLLRGLPLLSQWPIDELPYDDPSICL-FTYFRRGTVLCHDSNSGSWVYIVKSG 1517
            YEK +   +++I++G +    Y +  G+  + V +  K  GE +         G +FGELA+++  KR+ATV       +  + R+ F  I M T+     ++   LR + LL Q P ++L       CL   YF +G  +  +   G+  +I+  G
Sbjct:  193 YEKVYSEGQLVIQEGDAGNYLYVLAEGL--LEVIQNGKLLGEMHP--------GTAFGELAILYNCKRTATVKAVLQSHIWTLERQTFQTIMMQTTQARHQEYFTFLRSVSLLKQLPEEKL--GRIVDCLEVEYFEKGEYIIREGEEGNTFFIIAKG 337          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Medaka
Match: ENSORLT00000001302.2 (cGMP-dependent protein kinase 2 [Source:NCBI gene;Acc:101165996])

HSP 1 Score: 61.2326 bits (147), Expect = 2.397e-9
Identity = 45/175 (25.71%), Postives = 82/175 (46.86%), Query Frame = 3
Query: 1053 YEK-FEAKRIIIRQGHSALNFYFIISGITTVSVARTNKATGETYSETVAFLKKGNSFGELALMFGGKRSATVSCKTDVELLAVSREDFIDIFMSTSSNEEPDHIRLLRGLPLLSQWPIDELPYDDPSICL-FTYFRRGTVLCHDSNSGSWVYIVKSGTCRIIKFIQLNSQEQKEK 1571
            YEK +   +++I++G +    Y +  G+  + V +  K  GE +         G +FGELA+++  KR+ATV       +  + R+ F  I M T+     ++   LR + LL Q P ++L       CL   YF +G  +  +   G+  +I+  G   + +  +  +Q Q+ K
Sbjct:  193 YEKVYSEGQLVIQEGDAGNYLYVLAEGL--LEVIQNGKLLGEMHP--------GTAFGELAILYNCKRTATVKAVLQSHIWTLERQTFQTIMMQTTQARHQEYFTFLRSVSLLKQLPEEKL--GRIVDCLEVEYFEKGEYIIREGEEGNTFFIIAKGQVTVTQSSEGFTQPQEIK 355          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Medaka
Match: prkar1b (protein kinase cAMP-dependent type I regulatory subunit beta [Source:NCBI gene;Acc:101155602])

HSP 1 Score: 58.9214 bits (141), Expect = 7.577e-9
Identity = 33/90 (36.67%), Postives = 47/90 (52.22%), Query Frame = 3
Query: 1068 AKRIIIRQGHSALNFYFIISGITTVSVARTNKATGETYSETVAFLKKGNSFGELALMFGGKRSATVSCKTDVELLAVSREDFIDIFMSTS 1337
            A   +I+QG    NFY I  G   V V            E V  + +G SFGELAL++G  R+ATV  KTD++L  + R+ +  I M ++
Sbjct:  159 AGETVIQQGDEGDNFYVIDQGEVDVYVN----------GELVTNIGEGGSFGELALIYGTPRAATVKAKTDLKLWGIDRDSYRRILMGST 238          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Medaka
Match: prkar1b (protein kinase cAMP-dependent type I regulatory subunit beta [Source:NCBI gene;Acc:101155602])

HSP 1 Score: 58.9214 bits (141), Expect = 8.317e-9
Identity = 33/90 (36.67%), Postives = 47/90 (52.22%), Query Frame = 3
Query: 1068 AKRIIIRQGHSALNFYFIISGITTVSVARTNKATGETYSETVAFLKKGNSFGELALMFGGKRSATVSCKTDVELLAVSREDFIDIFMSTS 1337
            A   +I+QG    NFY I  G   V V            E V  + +G SFGELAL++G  R+ATV  KTD++L  + R+ +  I M ++
Sbjct:  159 AGETVIQQGDEGDNFYVIDQGEVDVYVN----------GELVTNIGEGGSFGELALIYGTPRAATVKAKTDLKLWGIDRDSYRRILMGST 238          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Medaka
Match: prkar1ab (protein kinase cAMP-dependent type I regulatory subunit alpha [Source:NCBI gene;Acc:101156203])

HSP 1 Score: 57.7658 bits (138), Expect = 1.656e-8
Identity = 38/129 (29.46%), Postives = 63/129 (48.84%), Query Frame = 3
Query: 1002 FSEFPLNMQTSLIERGWYEKFEAKRIIIRQGHSALNFYFIISGITTVSVARTNKATGETYSETVAFLKKGNSFGELALMFGGKRSATVSCKTDVELLAVSREDFIDIFMSTSSNEEPDHIRLLRGLPLL 1388
            F+    N ++ + +  +   + A   +I QG    NFY I  G   V V           +E V  + +G SFGELAL++G  R+ATV  KT+V+L  + R+ +  I M ++  +   +   LR + +L
Sbjct:  137 FAHLDDNERSDIFDAMFPVTYIAGETVILQGDEGDNFYVIDQGEMDVYVN----------NEWVTSIGEGGSFGELALIYGTPRAATVKAKTNVKLWGIDRDSYRRILMGSTLRKRKMYEEFLRKVSIL 255          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Planmine SMEST
Match: SMESG000078298.1 (SMESG000078298.1)

HSP 1 Score: 1285.4 bits (3325), Expect = 0.000e+0
Identity = 650/650 (100.00%), Postives = 650/650 (100.00%), Query Frame = 3
Query:   54 MLNRLYDQNGKRLDHEKIKIKNQERWKHIFSSLALNNDTQYDCHFTTIEDYIKRKRKINVKQRHSEQICKSDQEKENKITPFQIPDFVIEATVDENETQTNTDNSSQTPISSEIQSENKLNVVDKGPQEKNADKKVYKLQIGVADFAKKVKDNEGMGISTFSXXXXXXXXXXXXXXXXXXRKRKIMKSSLSTLRTDHYVKMLAIATTKRKEFLLKQRTPIEKFLHGIRIAMLLMKTCRTSSQQTERNNKKFLTFADYQVAEVDKKSNGMFDISKFKAQKESILSTDAIEIMRINPKQRSIEMVHSARLAINATVEAFSEFPLNMQTSLIERGWYEKFEAKRIIIRQGHSALNFYFIISGITTVSVARTNKATGETYSETVAFLKKGNSFGELALMFGGKRSATVSCKTDVELLAVSREDFIDIFMSTSSNEEPDHIRLLRGLPLLSQWPIDELPYDDPSICLFTYFRRGTVLCHDSNSGSWVYIVKSGTCRIIKFIQLNSQEQKEKLKHQRDSNDYFTFLTQSFXXXXXXXXXXEIPPPEIRPSKEFNGKYYIQLKILSVGSVFGLEPMAFEFVGGTTGVTLVSDGAELVAIERNFFQKHMSRQYQSWLRKELQPFPTIENLKGKLKNFYQWADYKESMIRAIIFDKLNY 2003
            MLNRLYDQNGKRLDHEKIKIKNQERWKHIFSSLALNNDTQYDCHFTTIEDYIKRKRKINVKQRHSEQICKSDQEKENKITPFQIPDFVIEATVDENETQTNTDNSSQTPISSEIQSENKLNVVDKGPQEKNADKKVYKLQIGVADFAKKVKDNEGMGISTFSNEQETEDGENEENENSLNRKRKIMKSSLSTLRTDHYVKMLAIATTKRKEFLLKQRTPIEKFLHGIRIAMLLMKTCRTSSQQTERNNKKFLTFADYQVAEVDKKSNGMFDISKFKAQKESILSTDAIEIMRINPKQRSIEMVHSARLAINATVEAFSEFPLNMQTSLIERGWYEKFEAKRIIIRQGHSALNFYFIISGITTVSVARTNKATGETYSETVAFLKKGNSFGELALMFGGKRSATVSCKTDVELLAVSREDFIDIFMSTSSNEEPDHIRLLRGLPLLSQWPIDELPYDDPSICLFTYFRRGTVLCHDSNSGSWVYIVKSGTCRIIKFIQLNSQEQKEKLKHQRDSNDYFTFLTQSFTHSTKSHSKHEIPPPEIRPSKEFNGKYYIQLKILSVGSVFGLEPMAFEFVGGTTGVTLVSDGAELVAIERNFFQKHMSRQYQSWLRKELQPFPTIENLKGKLKNFYQWADYKESMIRAIIFDKLNY
Sbjct:    1 MLNRLYDQNGKRLDHEKIKIKNQERWKHIFSSLALNNDTQYDCHFTTIEDYIKRKRKINVKQRHSEQICKSDQEKENKITPFQIPDFVIEATVDENETQTNTDNSSQTPISSEIQSENKLNVVDKGPQEKNADKKVYKLQIGVADFAKKVKDNEGMGISTFSNEQETEDGENEENENSLNRKRKIMKSSLSTLRTDHYVKMLAIATTKRKEFLLKQRTPIEKFLHGIRIAMLLMKTCRTSSQQTERNNKKFLTFADYQVAEVDKKSNGMFDISKFKAQKESILSTDAIEIMRINPKQRSIEMVHSARLAINATVEAFSEFPLNMQTSLIERGWYEKFEAKRIIIRQGHSALNFYFIISGITTVSVARTNKATGETYSETVAFLKKGNSFGELALMFGGKRSATVSCKTDVELLAVSREDFIDIFMSTSSNEEPDHIRLLRGLPLLSQWPIDELPYDDPSICLFTYFRRGTVLCHDSNSGSWVYIVKSGTCRIIKFIQLNSQEQKEKLKHQRDSNDYFTFLTQSFTHSTKSHSKHEIPPPEIRPSKEFNGKYYIQLKILSVGSVFGLEPMAFEFVGGTTGVTLVSDGAELVAIERNFFQKHMSRQYQSWLRKELQPFPTIENLKGKLKNFYQWADYKESMIRAIIFDKLNY 650          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Planmine SMEST
Match: SMESG000069771.1 (SMESG000069771.1)

HSP 1 Score: 429.098 bits (1102), Expect = 4.275e-142
Identity = 233/538 (43.31%), Postives = 328/538 (60.97%), Query Frame = 3
Query:  405 NKLNVVDKGPQEKNADKK-VYKLQIGVADFAKKVKDNEGMGISTFSXXXXXXXXXXXXXXXXXXRKRKIMKSSLSTLRTDHYVKMLAIATTKRKEFLLKQRTPIEKFLHGIRIAMLLMKTCRTSSQQTERNNKKFLTFADYQVAEVDKKS------NGMFDISKFKAQKESILSTDAIEIMRINPKQRSIEMVHSARLAINATVEAFSEFPLNMQTSLIERGWYEKFEAKRIIIRQGHSALNFYFIISGITTVSVARTNKATGETYSETVAFLKKGNSFGELALMFGGKRSATVSCKTDVELLAVSREDFIDIFMSTSSNEEPDHIRLLRGLPLLSQWPIDELPYDDPSICLFTYFRRGTVLCHDSNSGSWVYIVKSGTCRIIKFIQLNSQE---------QKEKLKHQRDSNDYFTFLTQSFXXXXXXXXXXEIPPPEIRPSKEFNGK--YYIQLKILSVGSVFGLEPMAFEFVGGTTGVTLVSDGAELVAIERNFFQKHMSRQYQSWLRKELQPFPTIENLKGKLKNFYQWADYKE 1964
            N L+ +  G       KK  + L+  VADF+KK+ DNEGM ISTFS + E +                   +S S   +D+            +++ +K  TPI K +  I+   LL+K   TS++QT++N KK+LTF D Q ++++ K+      +  F++S F+A KE  L+ +A +I++ +   R+   + S  LA+  TVEAFSEFP++MQ +L+  GWYEK+  K++IIRQGH+A NFYFIISG T VSVAR N ++GE+Y ETVAFLKKGNSFGELALM+GGKRSA+V C  +VELL+V+REDFI+IFM+ ++N EP+HI+ LR + +L  WPID LPYDDP ICLFTYFRRGTVLC DS++  W+YI+ +G+C++IK ++ +  +         + E L  Q D ND                                NG    YIQL +L+   +FGLE +AFE +G  + VTLVSDGAE VAI ++FF ++M   Y   LR E+QPFP  + L  K +NF  W+ +++
Sbjct:  131 NPLDQISGGKSSGETPKKSTFALKFAVADFSKKLLDNEGMNISTFSEDNEEQPDL----------------TSTSNFVSDY-----------SQKYSMKILTPISKLIRAIKTINLLLKATTTSAEQTKKNEKKYLTFTDIQ-SDMESKTRISALKDLTFNVSDFRALKEKTLNIEAAKILKTHKSLRTPHQIRSVVLALTETVEAFSEFPISMQEALVCHGWYEKYNPKQVIIRQGHAAQNFYFIISGKTMVSVARKNNSSGESYGETVAFLKKGNSFGELALMYGGKRSASVICINNVELLSVTREDFIEIFMNLATNTEPEHIKFLRNVTILEGWPIDALPYDDPRICLFTYFRRGTVLCRDSSNLEWIYIICTGSCKVIKGLKQSPGKLYKLRYNPLKIEGLVKQNDKND--------------------------------NGSKMIYIQLNVLNSKDIFGLESVAFELLGDKSSVTLVSDGAECVAINKSFFCQNMPESYLRKLRYEIQPFPEEQVLAEKFQNFSDWSSFQK 608          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Planmine SMEST
Match: SMESG000069771.1 (SMESG000069771.1)

HSP 1 Score: 407.142 bits (1045), Expect = 5.188e-134
Identity = 224/513 (43.66%), Postives = 312/513 (60.82%), Query Frame = 3
Query:  405 NKLNVVDKGPQEKNADKK-VYKLQIGVADFAKKVKDNEGMGISTFSXXXXXXXXXXXXXXXXXXRKRKIMKSSLSTLRTDHYVKMLAIATTKRKEFLLKQRTPIEKFLHGIRIAMLLMKTCRTSSQQTERNNKKFLTFADYQVAEVDKKS------NGMFDISKFKAQKESILSTDAIEIMRINPKQRSIEMVHSARLAINATVEAFSEFPLNMQTSLIERGWYEKFEAKRIIIRQGHSALNFYFIISGITTVSVARTNKATGETYSETVAFLKKGNSFGELALMFGGKRSATVSCKTDVELLAVSREDFIDIFMSTSSNEEPDHIRLLRGLPLLSQWPIDELPYDDPSICLFTYFRRGTVLCHDSNSGSWVYIVKSGTCRIIKFIQLNSQE---------QKEKLKHQRDSNDYFTFLTQSFXXXXXXXXXXEIPPPEIRPSKEFNGK--YYIQLKILSVGSVFGLEPMAFEFVGGTTGVTLVSDGAELVAIERNFFQKHMSRQYQSWLRKE 1889
            N L+ +  G       KK  + L+  VADF+KK+ DNEGM ISTFS + E +                   +S S   +D+            +++ +K  TPI K +  I+   LL+K   TS++QT++N KK+LTF D Q ++++ K+      +  F++S F+A KE  L+ +A +I++ +   R+   + S  LA+  TVEAFSEFP++MQ +L+  GWYEK+  K++IIRQGH+A NFYFIISG T VSVAR N ++GE+Y ETVAFLKKGNSFGELALM+GGKRSA+V C  +VELL+V+REDFI+IFM+ ++N EP+HI+ LR + +L  WPID LPYDDP ICLFTYFRRGTVLC DS++  W+YI+ +G+C++IK ++ +  +         + E L  Q D ND                                NG    YIQL +L+   +FGLE +AFE +G  + VTLVSDGAE VAI ++FF ++M   Y   LR E
Sbjct:  131 NPLDQISGGKSSGETPKKSTFALKFAVADFSKKLLDNEGMNISTFSEDNEEQPDL----------------TSTSNFVSDY-----------SQKYSMKILTPISKLIRAIKTINLLLKATTTSAEQTKKNEKKYLTFTDIQ-SDMESKTRISALKDLTFNVSDFRALKEKTLNIEAAKILKTHKSLRTPHQIRSVVLALTETVEAFSEFPISMQEALVCHGWYEKYNPKQVIIRQGHAAQNFYFIISGKTMVSVARKNNSSGESYGETVAFLKKGNSFGELALMYGGKRSASVICINNVELLSVTREDFIEIFMNLATNTEPEHIKFLRNVTILEGWPIDALPYDDPRICLFTYFRRGTVLCRDSSNLEWIYIICTGSCKVIKGLKQSPGKLYKLRYNPLKIEGLVKQNDKND--------------------------------NGSKMIYIQLNVLNSKDIFGLESVAFELLGDKSSVTLVSDGAECVAINKSFFCQNMPESYLRKLRYE 583          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Planmine SMEST
Match: SMESG000046966.1 (SMESG000046966.1)

HSP 1 Score: 169.474 bits (428), Expect = 1.362e-44
Identity = 130/483 (26.92%), Postives = 233/483 (48.24%), Query Frame = 3
Query:  654 MLAIATTKRKEFLLKQRTPIEKFLHGIRIAMLLMKTCRTSSQQTERNNKKFL----TFADYQVAEVDKKSNGMFDISKFKAQKESILSTDAIEIMRINPKQRSIEMVHSARLAINATVEAFSEFPLNMQTSLIERGWYEKFEAKRIIIRQGHSALNFYFIISGITTVSVARTNKATGETYSETVAFLKKGNSFGELALMFGGKRSATVSCKTDVELLAVSREDFIDIFMSTSS-NEEPDHIRLLRGLPLLSQWPIDELPYDDPSICLFTYFRRGTVLCHDSNSGSWVYIVKSGTCRIIKFIQ--LNSQEQKEK------LKHQRDSNDYFTFLTQSFX----XXXXXXXXXEIPPPEIRPSKEF-----------------NGKYYIQLKI----LSVGSVFGLEPMAFEF-----VGGTTGVTLVSDGAELVAIERNFFQKHMSRQYQSWLRKELQPFPT----IENLKGKLKNFYQWADYK 1961
            +  +  +K+ E  +K++  I +F   I++ +  ++      + T R  +++L    TF++  V +    +   F+   FKA KE  L+ +  +I+ ++PKQR+ E + +    ++A + AF+E+P++++  L    ++ K + +R+IIRQGH A  FYFIISG   V++  +N   G+    TV  L KG SFGELAL+    R+A+V  K+ ++LLA+ R DF  IFM  S  N+ P+H+  ++ +P+ S    D+L    P   L  +++   V+  +     WVYIVKSG+C ++K +Q  + S+  +E       +K +    D + F+         ++          P  ++P   F                 N + YI + I    L    ++GL  + F             V LVS+ AE+V + + F  +  +      +R+ L  +P+    +EN K ++    +W  YK
Sbjct:  135 LFGMILSKKTEAAIKKKA-ISRFTWAIKMIIAWLRYLNHIIKITHRQQQQYLYSIDTFSETDVFDSTDSNKLRFNKHHFKASKEIELTPEMKKILTMHPKQRTEEQILTVMYGLSA-LSAFNEYPVHLKKKLCTVAYFRKIDPRRVIIRQGHVAEYFYFIISGTAIVTIT-SNDDYGQV--RTVNSLSKGCSFGELALLHHSTRTASVVSKSSMQLLAIERNDFFYIFMYMSEFNKYPEHVSFIKDIPIFSHLDFDQL-VKQPEASLCHFYKNLIVISANDIESEWVYIVKSGSCTVLKELQVPIESKLTRENTLTLNDIKCKLQCFDQYHFIPMPLNGGDGNTKSLTRYMWRSPTMLKPGDYFYLKNETDSNKTSLNQKENSRNYISVFIKVADLIAKDIYGLSSVIFTSEDKVRTENMASVALVSNRAEMVLVSKKFLVQKANDDLIKDIRQGLTQYPSEKIFLENYKIRI----EWEKYK 607          
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Planmine SMEST
Match: SMESG000016927.1 (SMESG000016927.1)

HSP 1 Score: 64.3142 bits (155), Expect = 1.989e-10
Identity = 49/183 (26.78%), Postives = 86/183 (46.99%), Query Frame = 3
Query: 1059 KFEAKRIIIRQGHSALNFYFIISGITTVSVARTNKATGETYSETVAFLKKGNSFGELALMFGGKRSATVSCKTDVELLAVSREDFIDIFMSTSSNEEPDHIRLLRGLPLLSQWPIDELPYDDPSICL-FTYFRRGTVLCHDSNSGSWVYIVKSGTCRIIKFIQLNSQEQKEKLKHQRDSNDYF 1604
            KF A  III++G      Y +  G   VSV++      E  +ETV        FGELA+++   R+ATV+  TD +L A+ R  F  I M T   +  +++  L+ +P+     ++E      S  L  T++  G  +      G   +I+ SG  ++ +  + +  ++KE+   Q    ++F
Sbjct:  128 KFAANSIIIKEGEVGSLVYVMEDG--KVSVSKEGHHLREMKNETV--------FGELAILYNCTRTATVTAITDCKLWAIDRHSFQSIMMRTGLLKYEENLNFLKSVPIFKD--LEESTLGKISGVLEETHYANGDYIIRQGTKGDTFFIISSGKVQVTRKNKPDDTKEKEQFIRQMQRGEWF 298          
The following BLAST results are available for this feature:
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CNBD26.757e-1724.14cyclic nucleotide binding domain containing 2 [Sou... [more]
CNBD29.004e-1724.14cyclic nucleotide binding domain containing 2 [Sou... [more]
CNBD29.020e-1724.14cyclic nucleotide binding domain containing 2 [Sou... [more]
PRKAR1A1.485e-933.04protein kinase cAMP-dependent type I regulatory su... [more]
PRKAR1A2.361e-933.04protein kinase cAMP-dependent type I regulatory su... [more]
back to top
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
kin-22.847e-1030.06cAMP-dependent protein kinase regulatory subunit ... [more]
kin-23.029e-1030.06cAMP-dependent protein kinase regulatory subunit ... [more]
kin-23.356e-1030.06cAMP-dependent protein kinase regulatory subunit ... [more]
back to top
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pka-R11.380e-1030.56gene:FBgn0259243 transcript:FBtr0302639[more]
Pka-R12.119e-1030.17gene:FBgn0259243 transcript:FBtr0300533[more]
Pka-R12.119e-1030.17gene:FBgn0259243 transcript:FBtr0300529[more]
Pka-R12.173e-1030.56gene:FBgn0259243 transcript:FBtr0302638[more]
Pka-R12.179e-1030.56gene:FBgn0259243 transcript:FBtr0302640[more]
back to top
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prkar1ab6.727e-932.14protein kinase, cAMP-dependent, regulatory, type I... [more]
prkg27.906e-923.16protein kinase cGMP-dependent 2 [Source:ZFIN;Acc:Z... [more]
prkar1b1.088e-836.67protein kinase, cAMP-dependent, regulatory, type I... [more]
prkar1b1.088e-836.67protein kinase, cAMP-dependent, regulatory, type I... [more]
prkar1aa1.388e-831.25protein kinase, cAMP-dependent, regulatory, type I... [more]
back to top
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
bmp42.550e-1727.10bone morphogenetic protein 4 [Source:Xenbase;Acc:X... [more]
adarb11.169e-836.67adenosine deaminase, RNA-specific, B1 [Source:Xenb... [more]
adarb11.275e-836.67adenosine deaminase, RNA-specific, B1 [Source:Xenb... [more]
adarb11.817e-836.67adenosine deaminase, RNA-specific, B1 [Source:Xenb... [more]
tnpo26.294e-824.28transportin 2 [Source:Xenbase;Acc:XB-GENE-968452][more]
back to top
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cnbd23.569e-1625.00cyclic nucleotide binding domain containing 2 [Sou... [more]
Cnbd21.115e-1523.48cyclic nucleotide binding domain containing 2 [Sou... [more]
Cnbd22.344e-1525.00cyclic nucleotide binding domain containing 2 [Sou... [more]
Prkar1b2.945e-937.21protein kinase, cAMP dependent regulatory, type I ... [more]
Prkar1b5.138e-937.21protein kinase, cAMP dependent regulatory, type I ... [more]
back to top
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q95JR6|CNBD2_MACFA2.240e-1623.47Cyclic nucleotide-binding domain-containing protei... [more]
sp|Q96M20|CNBD2_HUMAN4.332e-1624.14Cyclic nucleotide-binding domain-containing protei... [more]
sp|Q9D5U8|CNBD2_MOUSE2.496e-1525.00Cyclic nucleotide-binding domain-containing protei... [more]
sp|P31320|KAPR_BLAEM2.681e-1028.37cAMP-dependent protein kinase regulatory subunit O... [more]
sp|Q8MLZ3|PDE5_DICDI7.514e-1029.14cGMP-dependent 3',5'-cGMP phosphodiesterase A OS=D... [more]
back to top
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267GLV41.100e-14342.47Cyclic nucleotide-binding domain-containing protei... [more]
A0A267GJ562.025e-14342.47Cyclic nucleotide-binding domain-containing protei... [more]
A0A267FBU34.963e-14242.31Cyclic nucleotide-binding domain-containing protei... [more]
A0A4Z2DPW91.258e-10546.68Cyclic nucleotide-binding domain-containing protei... [more]
A0A5K4FDU75.613e-10543.91Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
back to top
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000002114.25.467e-1025.77cGMP-dependent protein kinase 2-like [Source:NCBI ... [more]
prkar1b1.006e-836.67protein kinase cAMP-dependent type I regulatory su... [more]
prkar1ab2.163e-831.25cAMP-dependent protein kinase type I-alpha regulat... [more]
prkar1aa4.045e-832.14cAMP-dependent protein kinase type I-alpha regulat... [more]
prkg21.116e-722.51protein kinase cGMP-dependent 2 [Source:NCBI gene;... [more]
back to top
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000005682.13.667e-2323.95pep scaffold:Pmarinus_7.0:GL476331:764222:769958:1... [more]
ENSPMAT00000005026.11.916e-743.14pep scaffold:Pmarinus_7.0:GL484567:1893:8879:-1 ge... [more]
ENSPMAT00000001198.14.844e-727.33pep scaffold:Pmarinus_7.0:GL480445:10050:25657:1 g... [more]
back to top
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
BCY12.223e-727.74Regulatory subunit of the cyclic AMP-dependent pro... [more]
back to top
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO379721.331e-5755.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO481241.191e-5435.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO497483.664e-3238.99Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO329323.811e-2436.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO329401.113e-1735.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000001298.21.967e-926.75cGMP-dependent protein kinase 2 [Source:NCBI gene;... [more]
ENSORLT00000001302.22.397e-925.71cGMP-dependent protein kinase 2 [Source:NCBI gene;... [more]
prkar1b7.577e-936.67protein kinase cAMP-dependent type I regulatory su... [more]
prkar1b8.317e-936.67protein kinase cAMP-dependent type I regulatory su... [more]
prkar1ab1.656e-829.46protein kinase cAMP-dependent type I regulatory su... [more]
back to top
BLAST of cAMP-dependent protein kinase type I-alpha regulatory subunit vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000078298.10.000e+0100.00SMESG000078298.1[more]
SMESG000069771.14.275e-14243.31SMESG000069771.1[more]
SMESG000069771.15.188e-13443.66SMESG000069771.1[more]
SMESG000046966.11.362e-4426.92SMESG000046966.1[more]
SMESG000016927.11.989e-1026.78SMESG000016927.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027940 ID=SMED30027940|Name=cAMP-dependent protein kinase type I-alpha regulatory subunit|organism=Schmidtea mediterranea sexual|type=transcript|length=2047bp
GAAAAACTATCTGATTACCTTTTTTTTCAGAAAATGAAACATTTAATTTT
CAAATGCTAAACAGATTGTACGATCAAAATGGCAAAAGATTAGATCATGA
AAAAATCAAAATCAAAAACCAAGAACGTTGGAAACATATTTTCTCGAGTT
TGGCACTTAACAACGATACGCAATACGATTGTCATTTCACAACGATTGAA
GACTACATAAAACGCAAGAGGAAAATTAATGTCAAACAACGACATAGTGA
ACAAATATGTAAATCTGATCAAGAAAAAGAGAATAAAATCACCCCATTCC
AAATTCCTGATTTTGTAATTGAAGCAACTGTCGATGAAAATGAAACCCAA
ACAAATACTGACAATTCTAGTCAAACACCCATTTCAAGTGAAATCCAATC
AGAAAATAAATTAAATGTTGTTGATAAAGGTCCACAAGAAAAGAACGCTG
ATAAAAAAGTGTATAAATTACAAATTGGTGTAGCTGACTTTGCAAAAAAA
GTGAAAGATAACGAAGGAATGGGCATAAGTACATTTTCTAATGAGCAGGA
AACGGAAGATGGTGAAAACGAAGAAAATGAAAATTCATTGAATAGAAAAC
GTAAAATTATGAAATCATCATTGTCTACTTTAAGAACAGATCACTATGTA
AAGATGTTGGCTATTGCCACGACGAAAAGAAAGGAATTTTTATTAAAACA
AAGAACGCCAATAGAAAAATTTTTACATGGCATAAGAATAGCAATGTTAC
TCATGAAAACGTGCCGAACATCGAGTCAACAAACTGAAAGAAATAATAAA
AAATTTTTAACCTTTGCTGATTATCAAGTTGCTGAAGTTGATAAAAAATC
AAATGGGATGTTTGACATTTCTAAATTTAAGGCACAAAAAGAGTCAATTC
TCAGTACAGATGCGATAGAAATAATGAGAATTAACCCGAAGCAGCGTTCA
ATTGAAATGGTTCACAGTGCACGTTTGGCTATTAATGCCACTGTTGAAGC
CTTCAGTGAGTTTCCATTGAACATGCAGACATCACTTATTGAAAGAGGCT
GGTATGAAAAATTCGAAGCTAAAAGAATAATTATCCGCCAGGGACATTCA
GCTCTTAATTTCTATTTTATAATTTCTGGAATTACAACTGTAAGCGTTGC
CAGAACAAATAAAGCGACAGGAGAAACATATTCAGAAACAGTAGCGTTTT
TGAAAAAAGGAAATAGTTTTGGAGAATTAGCTCTCATGTTTGGAGGAAAA
CGAAGTGCAACTGTTTCGTGCAAAACTGATGTTGAATTATTGGCCGTATC
TAGGGAGGACTTCATTGATATATTTATGAGCACATCAAGTAATGAAGAGC
CAGACCATATTCGACTTTTAAGAGGTTTGCCTTTATTAAGTCAATGGCCA
ATTGATGAGCTACCATATGATGATCCATCAATCTGTTTATTTACGTATTT
CCGACGAGGAACTGTTCTTTGTCATGACAGCAATTCTGGAAGTTGGGTTT
ACATTGTAAAATCGGGCACATGTAGAATTATCAAATTTATTCAGCTGAAT
TCTCAAGAACAAAAAGAGAAACTGAAACATCAACGAGATTCAAATGATTA
CTTCACTTTTCTTACACAAAGTTTTACTCATTCAACTAAAAGTCATTCAA
AACATGAGATCCCACCTCCAGAAATTAGGCCATCTAAGGAATTTAATGGA
AAATATTATATCCAATTAAAAATACTCAGTGTCGGTTCAGTTTTTGGATT
AGAACCTATGGCATTTGAATTTGTTGGAGGAACTACTGGTGTAACTCTTG
TCAGTGACGGTGCTGAATTGGTAGCCATAGAAAGAAACTTTTTTCAAAAG
CATATGTCTAGGCAATATCAGTCATGGCTAAGGAAAGAATTACAACCATT
TCCAACCATTGAAAATTTAAAGGGAAAGTTAAAAAATTTTTATCAATGGG
CAGATTATAAAGAGTCAATGATTCGAGCTATTATATTTGATAAATTAAAT
TATTAATCAAGAAAGTTTCCCAAATGAATAAAAGAAATGTATACCAC
back to top

protein sequence of SMED30027940-orf-1

>SMED30027940-orf-1 ID=SMED30027940-orf-1|Name=SMED30027940-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=651bp
MLNRLYDQNGKRLDHEKIKIKNQERWKHIFSSLALNNDTQYDCHFTTIED
YIKRKRKINVKQRHSEQICKSDQEKENKITPFQIPDFVIEATVDENETQT
NTDNSSQTPISSEIQSENKLNVVDKGPQEKNADKKVYKLQIGVADFAKKV
KDNEGMGISTFSNEQETEDGENEENENSLNRKRKIMKSSLSTLRTDHYVK
MLAIATTKRKEFLLKQRTPIEKFLHGIRIAMLLMKTCRTSSQQTERNNKK
FLTFADYQVAEVDKKSNGMFDISKFKAQKESILSTDAIEIMRINPKQRSI
EMVHSARLAINATVEAFSEFPLNMQTSLIERGWYEKFEAKRIIIRQGHSA
LNFYFIISGITTVSVARTNKATGETYSETVAFLKKGNSFGELALMFGGKR
SATVSCKTDVELLAVSREDFIDIFMSTSSNEEPDHIRLLRGLPLLSQWPI
DELPYDDPSICLFTYFRRGTVLCHDSNSGSWVYIVKSGTCRIIKFIQLNS
QEQKEKLKHQRDSNDYFTFLTQSFTHSTKSHSKHEIPPPEIRPSKEFNGK
YYIQLKILSVGSVFGLEPMAFEFVGGTTGVTLVSDGAELVAIERNFFQKH
MSRQYQSWLRKELQPFPTIENLKGKLKNFYQWADYKESMIRAIIFDKLNY
*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0001772immunological synapse
GO:0005737cytoplasm
GO:0005886plasma membrane
GO:0005930axoneme
GO:0016020membrane
GO:0031588nucleotide-activated protein kinase complex
GO:0032991macromolecular complex
GO:0044853plasma membrane raft
GO:0005952cAMP-dependent protein kinase complex
Vocabulary: molecular function
TermDefinition
GO:0004862cAMP-dependent protein kinase inhibitor activity
GO:0019904protein domain specific binding
GO:0031625ubiquitin protein ligase binding
GO:0034236protein kinase A catalytic subunit binding
GO:0000166nucleotide binding
GO:0008603cAMP-dependent protein kinase regulator activity
GO:0030552cAMP binding
Vocabulary: biological process
TermDefinition
GO:0046007negative regulation of activated T cell proliferation
GO:2000480negative regulation of cAMP-dependent protein kinase activity
GO:0001932regulation of protein phosphorylation
GO:0045859regulation of protein kinase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000018Category 4 cell
PLANA:0000034epidermis
PLANA:0000420parapharyngeal region
Vocabulary: INTERPRO
TermDefinition
IPR000595cNMP-bd_dom
IPR014710RmlC-like_jellyroll
IPR018488cNMP-bd_CS
IPR018490cNMP-bd-like
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000595Cyclic nucleotide-binding domainSMARTSM00100cnmp_10coord: 316..439
e-value: 4.0E-12
score: 56.3
IPR000595Cyclic nucleotide-binding domainPFAMPF00027cNMP_bindingcoord: 335..426
e-value: 2.8E-17
score: 62.5
IPR000595Cyclic nucleotide-binding domainPROSITEPS50042CNMP_BINDING_3coord: 316..441
score: 22.825
IPR000595Cyclic nucleotide-binding domainCDDcd00038CAP_EDcoord: 316..425
e-value: 1.54189E-21
score: 88.1517
IPR014710RmlC-like jelly roll foldGENE3DG3DSA:2.60.120.10coord: 285..429
e-value: 1.8E-28
score: 100.9
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 157..183
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 96..127
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 96..122
NoneNo IPR availablePANTHERPTHR23011UNCHARACTERIZEDcoord: 534..647
NoneNo IPR availablePANTHERPTHR23011:SF31coord: 263..540
NoneNo IPR availablePANTHERPTHR23011:SF31coord: 534..647
NoneNo IPR availablePANTHERPTHR23011UNCHARACTERIZEDcoord: 263..540
IPR018488Cyclic nucleotide-binding, conserved sitePROSITEPS00889CNMP_BINDING_2coord: 389..406
IPR018490Cyclic nucleotide-binding-likeSUPERFAMILYSSF51206cAMP-binding domain-likecoord: 434..603
IPR018490Cyclic nucleotide-binding-likeSUPERFAMILYSSF51206cAMP-binding domain-likecoord: 280..426