D-3-phosphoglycerate dehydrogenase

Overview
NameD-3-phosphoglycerate dehydrogenase
Smed IDSMED30027938
Length (bp)2029
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of D-3-phosphoglycerate dehydrogenase (SMED30027938) t-SNE clustered cells

Violin plots show distribution of expression levels for D-3-phosphoglycerate dehydrogenase (SMED30027938) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of D-3-phosphoglycerate dehydrogenase (SMED30027938) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for D-3-phosphoglycerate dehydrogenase (SMED30027938) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027938

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pigment cellSMED30027938SMESG000048075.1 SmedASXL_009596SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
parenchymal cellSMED30027938SMESG000048075.1 dd_Smed_v4_6254_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of D-3-phosphoglycerate dehydrogenase vs. Ensembl Human
Match: PHGDH (phosphoglycerate dehydrogenase [Source:HGNC Symbol;Acc:HGNC:8923])

HSP 1 Score: 343.199 bits (879), Expect = 4.254e-111
Identity = 168/321 (52.34%), Postives = 224/321 (69.78%), Query Frame = 1
Query:  127 LARILSTDGLDRNGVQALRDFGFDVVE-QKFSKSELIQQLINFDAIIVRSATTIDAEIIRAVTSNDGSRLKVIARAGTGVDNIDVEVATEKGLLVINTPAANTISAAEHTVALMCSLSRQIPQAHSNMKQGKWDRKLYMGTELLHKTLAIIGLGKIGKEVALRAQAFGMTTIGFDPIIGNEEAKSFNVDWMELNEIWPIADYISVHVPLIPQTENLINLKTIEKCKPSVKFINCARGGIINEDDLLKSLEMNLCSGAALDVFTEEPPTFNNLIKHPKLIVTPHLGASTVEAQFRVSMEIAENLISITKGESIPGSVNGHAI 1086
            L ++L +D LD    + L+D G  VVE Q  SK ELI +L + + +IVRSAT + A++I     N   +L+V+ RAGTGVDN+D+E AT KG+LV+NTP  N++SAAE T  ++  L+RQIPQA ++MK GKW+RK +MGTEL  KTL I+GLG+IG+EVA R Q+FGM TIG+DPII  E + SF V  + L EIWP+ D+I+VH PL+P T  L+N  T  +CK  V+ +NCARGGI++E  LL++L+   C+GAALDVFTEEPP    L+ H  +I  PHLGAST EAQ R   EIA   + + KG+S+ G VN  A+
Sbjct:    6 LRKVLISDSLDPCCRKILQDGGLQVVEKQNLSKEELIAELQDCEGLIVRSATKVTADVI-----NAAEKLQVVGRAGTGVDNVDLEAATRKGILVMNTPNGNSLSAAELTCGMIMCLARQIPQATASMKDGKWERKKFMGTELNGKTLGILGLGRIGREVATRMQSFGMKTIGYDPIISPEVSASFGVQQLPLEEIWPLCDFITVHTPLLPSTTGLLNDNTFAQCKKGVRVVNCARGGIVDEGALLRALQSGQCAGAALDVFTEEPPRDRALVDHENVISCPHLGASTKEAQSRCGEEIAVQFVDMVKGKSLTGVVNAQAL 321          
BLAST of D-3-phosphoglycerate dehydrogenase vs. Ensembl Human
Match: PHGDH (phosphoglycerate dehydrogenase [Source:HGNC Symbol;Acc:HGNC:8923])

HSP 1 Score: 343.584 bits (880), Expect = 5.906e-110
Identity = 168/321 (52.34%), Postives = 224/321 (69.78%), Query Frame = 1
Query:  127 LARILSTDGLDRNGVQALRDFGFDVVE-QKFSKSELIQQLINFDAIIVRSATTIDAEIIRAVTSNDGSRLKVIARAGTGVDNIDVEVATEKGLLVINTPAANTISAAEHTVALMCSLSRQIPQAHSNMKQGKWDRKLYMGTELLHKTLAIIGLGKIGKEVALRAQAFGMTTIGFDPIIGNEEAKSFNVDWMELNEIWPIADYISVHVPLIPQTENLINLKTIEKCKPSVKFINCARGGIINEDDLLKSLEMNLCSGAALDVFTEEPPTFNNLIKHPKLIVTPHLGASTVEAQFRVSMEIAENLISITKGESIPGSVNGHAI 1086
            L ++L +D LD    + L+D G  VVE Q  SK ELI +L + + +IVRSAT + A++I     N   +L+V+ RAGTGVDN+D+E AT KG+LV+NTP  N++SAAE T  ++  L+RQIPQA ++MK GKW+RK +MGTEL  KTL I+GLG+IG+EVA R Q+FGM TIG+DPII  E + SF V  + L EIWP+ D+I+VH PL+P T  L+N  T  +CK  V+ +NCARGGI++E  LL++L+   C+GAALDVFTEEPP    L+ H  +I  PHLGAST EAQ R   EIA   + + KG+S+ G VN  A+
Sbjct:    6 LRKVLISDSLDPCCRKILQDGGLQVVEKQNLSKEELIAELQDCEGLIVRSATKVTADVI-----NAAEKLQVVGRAGTGVDNVDLEAATRKGILVMNTPNGNSLSAAELTCGMIMCLARQIPQATASMKDGKWERKKFMGTELNGKTLGILGLGRIGREVATRMQSFGMKTIGYDPIISPEVSASFGVQQLPLEEIWPLCDFITVHTPLLPSTTGLLNDNTFAQCKKGVRVVNCARGGIVDEGALLRALQSGQCAGAALDVFTEEPPRDRALVDHENVISCPHLGASTKEAQSRCGEEIAVQFVDMVKGKSLTGVVNAQAL 321          
BLAST of D-3-phosphoglycerate dehydrogenase vs. Ensembl Human
Match: PHGDH (phosphoglycerate dehydrogenase [Source:HGNC Symbol;Acc:HGNC:8923])

HSP 1 Score: 343.584 bits (880), Expect = 7.279e-110
Identity = 168/321 (52.34%), Postives = 224/321 (69.78%), Query Frame = 1
Query:  127 LARILSTDGLDRNGVQALRDFGFDVVE-QKFSKSELIQQLINFDAIIVRSATTIDAEIIRAVTSNDGSRLKVIARAGTGVDNIDVEVATEKGLLVINTPAANTISAAEHTVALMCSLSRQIPQAHSNMKQGKWDRKLYMGTELLHKTLAIIGLGKIGKEVALRAQAFGMTTIGFDPIIGNEEAKSFNVDWMELNEIWPIADYISVHVPLIPQTENLINLKTIEKCKPSVKFINCARGGIINEDDLLKSLEMNLCSGAALDVFTEEPPTFNNLIKHPKLIVTPHLGASTVEAQFRVSMEIAENLISITKGESIPGSVNGHAI 1086
            L ++L +D LD    + L+D G  VVE Q  SK ELI +L + + +IVRSAT + A++I     N   +L+V+ RAGTGVDN+D+E AT KG+LV+NTP  N++SAAE T  ++  L+RQIPQA ++MK GKW+RK +MGTEL  KTL I+GLG+IG+EVA R Q+FGM TIG+DPII  E + SF V  + L EIWP+ D+I+VH PL+P T  L+N  T  +CK  V+ +NCARGGI++E  LL++L+   C+GAALDVFTEEPP    L+ H  +I  PHLGAST EAQ R   EIA   + + KG+S+ G VN  A+
Sbjct:    6 LRKVLISDSLDPCCRKILQDGGLQVVEKQNLSKEELIAELQDCEGLIVRSATKVTADVI-----NAAEKLQVVGRAGTGVDNVDLEAATRKGILVMNTPNGNSLSAAELTCGMIMCLARQIPQATASMKDGKWERKKFMGTELNGKTLGILGLGRIGREVATRMQSFGMKTIGYDPIISPEVSASFGVQQLPLEEIWPLCDFITVHTPLLPSTTGLLNDNTFAQCKKGVRVVNCARGGIVDEGALLRALQSGQCAGAALDVFTEEPPRDRALVDHENVISCPHLGASTKEAQSRCGEEIAVQFVDMVKGKSLTGVVNAQAL 321          
BLAST of D-3-phosphoglycerate dehydrogenase vs. Ensembl Human
Match: PHGDH (phosphoglycerate dehydrogenase [Source:HGNC Symbol;Acc:HGNC:8923])

HSP 1 Score: 343.584 bits (880), Expect = 8.706e-110
Identity = 168/321 (52.34%), Postives = 224/321 (69.78%), Query Frame = 1
Query:  127 LARILSTDGLDRNGVQALRDFGFDVVE-QKFSKSELIQQLINFDAIIVRSATTIDAEIIRAVTSNDGSRLKVIARAGTGVDNIDVEVATEKGLLVINTPAANTISAAEHTVALMCSLSRQIPQAHSNMKQGKWDRKLYMGTELLHKTLAIIGLGKIGKEVALRAQAFGMTTIGFDPIIGNEEAKSFNVDWMELNEIWPIADYISVHVPLIPQTENLINLKTIEKCKPSVKFINCARGGIINEDDLLKSLEMNLCSGAALDVFTEEPPTFNNLIKHPKLIVTPHLGASTVEAQFRVSMEIAENLISITKGESIPGSVNGHAI 1086
            L ++L +D LD    + L+D G  VVE Q  SK ELI +L + + +IVRSAT + A++I     N   +L+V+ RAGTGVDN+D+E AT KG+LV+NTP  N++SAAE T  ++  L+RQIPQA ++MK GKW+RK +MGTEL  KTL I+GLG+IG+EVA R Q+FGM TIG+DPII  E + SF V  + L EIWP+ D+I+VH PL+P T  L+N  T  +CK  V+ +NCARGGI++E  LL++L+   C+GAALDVFTEEPP    L+ H  +I  PHLGAST EAQ R   EIA   + + KG+S+ G VN  A+
Sbjct:    6 LRKVLISDSLDPCCRKILQDGGLQVVEKQNLSKEELIAELQDCEGLIVRSATKVTADVI-----NAAEKLQVVGRAGTGVDNVDLEAATRKGILVMNTPNGNSLSAAELTCGMIMCLARQIPQATASMKDGKWERKKFMGTELNGKTLGILGLGRIGREVATRMQSFGMKTIGYDPIISPEVSASFGVQQLPLEEIWPLCDFITVHTPLLPSTTGLLNDNTFAQCKKGVRVVNCARGGIVDEGALLRALQSGQCAGAALDVFTEEPPRDRALVDHENVISCPHLGASTKEAQSRCGEEIAVQFVDMVKGKSLTGVVNAQAL 321          
BLAST of D-3-phosphoglycerate dehydrogenase vs. Ensembl Human
Match: PHGDH (phosphoglycerate dehydrogenase [Source:HGNC Symbol;Acc:HGNC:8923])

HSP 1 Score: 343.584 bits (880), Expect = 8.706e-110
Identity = 168/321 (52.34%), Postives = 224/321 (69.78%), Query Frame = 1
Query:  127 LARILSTDGLDRNGVQALRDFGFDVVE-QKFSKSELIQQLINFDAIIVRSATTIDAEIIRAVTSNDGSRLKVIARAGTGVDNIDVEVATEKGLLVINTPAANTISAAEHTVALMCSLSRQIPQAHSNMKQGKWDRKLYMGTELLHKTLAIIGLGKIGKEVALRAQAFGMTTIGFDPIIGNEEAKSFNVDWMELNEIWPIADYISVHVPLIPQTENLINLKTIEKCKPSVKFINCARGGIINEDDLLKSLEMNLCSGAALDVFTEEPPTFNNLIKHPKLIVTPHLGASTVEAQFRVSMEIAENLISITKGESIPGSVNGHAI 1086
            L ++L +D LD    + L+D G  VVE Q  SK ELI +L + + +IVRSAT + A++I     N   +L+V+ RAGTGVDN+D+E AT KG+LV+NTP  N++SAAE T  ++  L+RQIPQA ++MK GKW+RK +MGTEL  KTL I+GLG+IG+EVA R Q+FGM TIG+DPII  E + SF V  + L EIWP+ D+I+VH PL+P T  L+N  T  +CK  V+ +NCARGGI++E  LL++L+   C+GAALDVFTEEPP    L+ H  +I  PHLGAST EAQ R   EIA   + + KG+S+ G VN  A+
Sbjct:    6 LRKVLISDSLDPCCRKILQDGGLQVVEKQNLSKEELIAELQDCEGLIVRSATKVTADVI-----NAAEKLQVVGRAGTGVDNVDLEAATRKGILVMNTPNGNSLSAAELTCGMIMCLARQIPQATASMKDGKWERKKFMGTELNGKTLGILGLGRIGREVATRMQSFGMKTIGYDPIISPEVSASFGVQQLPLEEIWPLCDFITVHTPLLPSTTGLLNDNTFAQCKKGVRVVNCARGGIVDEGALLRALQSGQCAGAALDVFTEEPPRDRALVDHENVISCPHLGASTKEAQSRCGEEIAVQFVDMVKGKSLTGVVNAQAL 321          
BLAST of D-3-phosphoglycerate dehydrogenase vs. Ensembl Celegans
Match: C31C9.2 (pep chromosome:WBcel235:II:13636929:13638480:-1 gene:WBGene00007836.1 transcript:C31C9.2.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C31C9.2)

HSP 1 Score: 337.421 bits (864), Expect = 9.235e-111
Identity = 166/307 (54.07%), Postives = 221/307 (71.99%), Query Frame = 1
Query:  133 RILSTDGLDRNGVQALRDFGFDV-VEQKFSKSELIQQLINFDAIIVRSATTIDAEIIRAVTSNDGSRLKVIARAGTGVDNIDVEVATEKGLLVINTPAANTISAAEHTVALMCSLSRQIPQAHSNMKQGKWDRKLYMGTELLHKTLAIIGLGKIGKEVALRAQAFGMTTIGFDPIIGNEEAKSFNVDWMELNEIWPIADYISVHVPLIPQTENLINLKTIEKCKPSVKFINCARGGIINEDDLLKSLEMNLCSGAALDVFTEEPPTFNNLIKHPKLIVTPHLGASTVEAQFRVSMEIAENLISITKG 1050
            ++L  D +++  V  L+  G +V V+ K +K EL+  L   DA+IVRSAT I AE++ A       +LK++ RAGTGVDNIDV  A+   +LV+NTP AN+ SAAE T  L+ SLSR +PQA ++MK GKW RK +MG E+  +TLA++GLG+IG EVA+R QAFGM  IGFDP++  E+A++ N++ + L +IWP ADYI+VHVPLI QTENLIN +T+ KCK  V+ IN ARGGI+NE DL++SL      GAA DVF +EPPTF  LI HP +I TPHLGAST++AQ RV+ EIA+N++   KG
Sbjct:    7 KVLIADDIEQECVDILKQNGIEVTVKTKQTKDELLVTLPQHDAVIVRSATKITAELLAA----SAGKLKLVGRAGTGVDNIDVPAASANKILVMNTPQANSRSAAELTCTLILSLSRHVPQAAASMKAGKWARKDFMGEEVYGRTLAVLGLGRIGSEVAVRLQAFGMKVIGFDPMVTKEQAEAKNIELLSLEQIWPQADYITVHVPLIKQTENLINKETLAKCKKGVRIINVARGGIVNEVDLVESLNAGHAKGAAFDVFEQEPPTFRELIDHPLVIATPHLGASTIDAQLRVASEIADNIVQYNKG 309          
BLAST of D-3-phosphoglycerate dehydrogenase vs. Ensembl Celegans
Match: ctbp-1 (C-terminal-binding protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q20595])

HSP 1 Score: 121.709 bits (304), Expect = 1.337e-28
Identity = 77/226 (34.07%), Postives = 127/226 (56.19%), Query Frame = 1
Query:  331 LKVIARAGTGVDNIDVEVATEKGLLVINTPAANTISAAEHTVALMCSLSRQI---PQAHSNMKQ---GKWDRKLYMGTELLHKT-LAIIGLGKIGKEVALRAQAFGMTTIGFDPII--GNEEAKSFNVDWMELNEIWPIADYISVHVPLIPQTENLINLKTIEKCKPSVKFINCARGGIINEDDLLKSLEMNLCSGAALDVFTE---EPPTFNNLIKHPKLIVTPH 972
            LKV+ R G G+DNIDV+ ATE G+ V + P       A+ T++L+  L R+     +++S  ++       R+  +G++ +  + L I+G G++G  V LRA+AFG+  I +DP +  G+++A  F   +  ++E    +D IS+H  L  +T  +IN  ++ +CK  V  +N +  G+INE+DL  +L+     GAALDV      +P   N L+  P +I TPH
Sbjct:  122 LKVVFRIGYGIDNIDVKAATELGIAVCHAPGDYVEDVADSTLSLILDLFRRTYWHAKSYSETRKTIGADQVRENAVGSKKVRGSVLGILGCGRVGTAVGLRARAFGLHIIFYDPFVREGHDKALGFERVYT-MDEFMSRSDCISLHCNLGDETRGIINADSLRQCKSGVYIVNTSHAGLINENDLAAALKNGHVKGAALDVHDSVRFDPNCLNPLVGCPNIINTPH 346          
BLAST of D-3-phosphoglycerate dehydrogenase vs. Ensembl Celegans
Match: ctbp-1 (C-terminal-binding protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q20595])

HSP 1 Score: 120.939 bits (302), Expect = 3.417e-28
Identity = 77/226 (34.07%), Postives = 127/226 (56.19%), Query Frame = 1
Query:  331 LKVIARAGTGVDNIDVEVATEKGLLVINTPAANTISAAEHTVALMCSLSRQI---PQAHSNMKQ---GKWDRKLYMGTELLHKT-LAIIGLGKIGKEVALRAQAFGMTTIGFDPII--GNEEAKSFNVDWMELNEIWPIADYISVHVPLIPQTENLINLKTIEKCKPSVKFINCARGGIINEDDLLKSLEMNLCSGAALDVFTE---EPPTFNNLIKHPKLIVTPH 972
            LKV+ R G G+DNIDV+ ATE G+ V + P       A+ T++L+  L R+     +++S  ++       R+  +G++ +  + L I+G G++G  V LRA+AFG+  I +DP +  G+++A  F   +  ++E    +D IS+H  L  +T  +IN  ++ +CK  V  +N +  G+INE+DL  +L+     GAALDV      +P   N L+  P +I TPH
Sbjct:  243 LKVVFRIGYGIDNIDVKAATELGIAVCHAPGDYVEDVADSTLSLILDLFRRTYWHAKSYSETRKTIGADQVRENAVGSKKVRGSVLGILGCGRVGTAVGLRARAFGLHIIFYDPFVREGHDKALGFERVYT-MDEFMSRSDCISLHCNLGDETRGIINADSLRQCKSGVYIVNTSHAGLINENDLAAALKNGHVKGAALDVHDSVRFDPNCLNPLVGCPNIINTPH 467          
BLAST of D-3-phosphoglycerate dehydrogenase vs. Ensembl Fly
Match: CG6287 (gene:FBgn0032350 transcript:FBtr0080222)

HSP 1 Score: 318.931 bits (816), Expect = 2.100e-103
Identity = 165/326 (50.61%), Postives = 218/326 (66.87%), Query Frame = 1
Query:  133 RILSTDGLDRNGVQALRDFGFDVVEQ-KFSKSELIQQLINFDAIIVRSATTIDAEIIRAVTSNDGSRLKVIARAGTGVDNIDVEVATEKGLLVINTPAANTISAAEHTVALMCSLSRQIPQAHSNMKQGKWDRKLYMGTELLHKTLAIIGLGKIGKEVALRAQAFGMTTIGFDPIIGNEEAKSFNVDWMELNEIWPIADYISVHVPLIPQTENLINLKTIEKCKPSVKFINCARGGIINEDDLLKSLEMNLCSGAALDVFTEEPP---TFNNLIKHPKLIVTPHLGASTVEAQFRVSMEIAENLISI----TKGESIPGSVNGHAI 1086
            ++L  D +D++ V+ L   G  V  + K    EL Q++ NFDA IVRS T I AE++ A     GS LKV+ RAG GVDNIDV  AT + ++V+NTP  N+ISA E T  L+ SL+R +  A  +MK+G+WDRKLY GTEL  KTLA++GLG+IG+EVA+R + +GM  IG+DPI    EAK+  ++ M L EIWP+ADYI+VH PLIP T NLI+ +T+ KCK  VK +N ARGGII+E  +L  LE    +GAA DV+ EEPP       LI HPK++ TPHLGAST EAQ RV++E+AE  I++     K  S  G +N  A+
Sbjct:    7 KVLVCDAVDKSCVELLEQHGIKVTYKLKLPVEELCQEVKNFDAAIVRSDTKITAEVLAA---GSGS-LKVVGRAGAGVDNIDVPAATAQNVVVLNTPGGNSISACELTCILIGSLARPVVPAGQSMKEGRWDRKLYAGTELYGKTLAVLGLGRIGREVAIRMKTWGMRIIGYDPITTEAEAKAAGIEKMTLEEIWPLADYITVHTPLIPATRNLISAETLAKCKQGVKVVNVARGGIIDEQAVLDGLESGKVAGAAFDVYPEEPPKSAVTKALISHPKVVATPHLGASTSEAQVRVAVEVAEQFIALNGTSPKYTSYAGVINKEAL 328          
BLAST of D-3-phosphoglycerate dehydrogenase vs. Ensembl Fly
Match: CtBP (gene:FBgn0020496 transcript:FBtr0334513)

HSP 1 Score: 124.405 bits (311), Expect = 1.538e-30
Identity = 83/253 (32.81%), Postives = 132/253 (52.17%), Query Frame = 1
Query:  331 LKVIARAGTGVDNIDVEVATEKGLLVINTPAANTISAAEHTVALMCSLSRQIPQAHSNMKQGKWDRKLYMGTELLHK-----------TLAIIGLGKIGKEVALRAQAFGMTTIGFDPIIGNEEAKSFNVDWM-ELNEIWPIADYISVHVPLIPQTENLINLKTIEKCKPSVKFINCARGGIINEDDLLKSLEMNLCSGAALDVFTEEPPTFNNLIKH-PKLIVTPHLG----ASTVEAQFRVSMEIAENLIS 1038
            L++I R G+G DNIDV+ A E G+ V N P       A+ T+ L+ +L R+     + +++GK     + G E + +           TL ++GLG+IG  VALRA+AFG   I +DP + +   KS  +  +  L ++   +D +S+H  L     +LIN  TI++ +P    +N ARGG+++++ L  +L+      AALDV   EP  +N  +K  P LI TPH      AS  E +   + EI   ++ 
Sbjct:   92 LRIIVRIGSGTDNIDVKAAGELGIAVCNVPGYGVEEVADTTMCLILNLYRRTYWLANMVREGKK----FTGPEQVREAAHGCARIRGDTLGLVGLGRIGSAVALRAKAFGFNVIFYDPYLPDGIDKSLGLTRVYTLQDLLFQSDCVSLHCTLNEHNHHLINEFTIKQMRPGAFLVNTARGGLVDDETLALALKQGRIRAAALDVHENEP--YNGALKDAPNLICTPHAAFFSDASATELREMAATEIRRAIVG 338          
BLAST of D-3-phosphoglycerate dehydrogenase vs. Ensembl Fly
Match: CG31674 (gene:FBgn0051674 transcript:FBtr0339563)

HSP 1 Score: 123.25 bits (308), Expect = 1.715e-30
Identity = 75/291 (25.77%), Postives = 147/291 (50.52%), Query Frame = 1
Query:  205 EQKFSKSELIQQLINFDAIIVRSATTIDAEIIRAVTSNDGSRLKVIARAGTGVDNIDVEVATEKGLLVINTPAANTISAAEHTVALMCSLSRQIPQAHSNMKQGKWDR---KLYMGTELLHKTLAIIGLGKIGKEVALRAQAFGMTTIGFDPI--IGNEEAKSFNVDWMELNEIWPIADYISVHVPLIPQTENLINLKTIEKCKPSVKFINCARGGIINEDDLLKSLEMNLCSGAALDVFTEEP-PTFNNLIKHPKLIVTPHLGASTVEAQFRVSMEIAENLISITKGESI 1059
            E   ++ E+++++    A+I      ++AEI+ A     G +LK ++   +G++N+DV    ++G+ + +TPA  T++ A+ TV L+ + +R+  +    +   KWD+      +G ++   T+   G G IG+ VA R   F +  + +     +  +  + FN   ++   +   +D++ +  PL  +T  L N     K K +   +N  RG I+N+DDL ++L+ N    A LDV   EP P+ + L+    ++VTPH+G +T   +   +   + N++    GE +
Sbjct:   36 EPPKNRPEILEKIRGAHAVIWGGRDILNAEILDAA----GPQLKAVSTMSSGINNVDVPELKKRGIPLGSTPAMLTVAVADLTVGLLIAAARRFQEGRRKIDSDKWDKDHLNWMLGQDIRDSTVGFYGFGGIGQAVAKRLMGFDIKRMLYTTRNRVSQDIEERFNAKKVDFETLLAESDFLIIASPLTKETLGLFNATVFNKMKETAVLVNVGRGKIVNQDDLYEALKSNRIFAAGLDVMDPEPLPSNDKLLTLDNVVVTPHVGYATRRTRVDAANLASRNVLKGLAGEPM 322          
BLAST of D-3-phosphoglycerate dehydrogenase vs. Ensembl Fly
Match: CG31674 (gene:FBgn0051674 transcript:FBtr0081423)

HSP 1 Score: 123.25 bits (308), Expect = 1.715e-30
Identity = 75/291 (25.77%), Postives = 147/291 (50.52%), Query Frame = 1
Query:  205 EQKFSKSELIQQLINFDAIIVRSATTIDAEIIRAVTSNDGSRLKVIARAGTGVDNIDVEVATEKGLLVINTPAANTISAAEHTVALMCSLSRQIPQAHSNMKQGKWDR---KLYMGTELLHKTLAIIGLGKIGKEVALRAQAFGMTTIGFDPI--IGNEEAKSFNVDWMELNEIWPIADYISVHVPLIPQTENLINLKTIEKCKPSVKFINCARGGIINEDDLLKSLEMNLCSGAALDVFTEEP-PTFNNLIKHPKLIVTPHLGASTVEAQFRVSMEIAENLISITKGESI 1059
            E   ++ E+++++    A+I      ++AEI+ A     G +LK ++   +G++N+DV    ++G+ + +TPA  T++ A+ TV L+ + +R+  +    +   KWD+      +G ++   T+   G G IG+ VA R   F +  + +     +  +  + FN   ++   +   +D++ +  PL  +T  L N     K K +   +N  RG I+N+DDL ++L+ N    A LDV   EP P+ + L+    ++VTPH+G +T   +   +   + N++    GE +
Sbjct:   36 EPPKNRPEILEKIRGAHAVIWGGRDILNAEILDAA----GPQLKAVSTMSSGINNVDVPELKKRGIPLGSTPAMLTVAVADLTVGLLIAAARRFQEGRRKIDSDKWDKDHLNWMLGQDIRDSTVGFYGFGGIGQAVAKRLMGFDIKRMLYTTRNRVSQDIEERFNAKKVDFETLLAESDFLIIASPLTKETLGLFNATVFNKMKETAVLVNVGRGKIVNQDDLYEALKSNRIFAAGLDVMDPEPLPSNDKLLTLDNVVVTPHVGYATRRTRVDAANLASRNVLKGLAGEPM 322          
BLAST of D-3-phosphoglycerate dehydrogenase vs. Ensembl Fly
Match: CtBP (gene:FBgn0020496 transcript:FBtr0334516)

HSP 1 Score: 124.02 bits (310), Expect = 2.308e-30
Identity = 83/253 (32.81%), Postives = 132/253 (52.17%), Query Frame = 1
Query:  331 LKVIARAGTGVDNIDVEVATEKGLLVINTPAANTISAAEHTVALMCSLSRQIPQAHSNMKQGKWDRKLYMGTELLHK-----------TLAIIGLGKIGKEVALRAQAFGMTTIGFDPIIGNEEAKSFNVDWM-ELNEIWPIADYISVHVPLIPQTENLINLKTIEKCKPSVKFINCARGGIINEDDLLKSLEMNLCSGAALDVFTEEPPTFNNLIKH-PKLIVTPHLG----ASTVEAQFRVSMEIAENLIS 1038
            L++I R G+G DNIDV+ A E G+ V N P       A+ T+ L+ +L R+     + +++GK     + G E + +           TL ++GLG+IG  VALRA+AFG   I +DP + +   KS  +  +  L ++   +D +S+H  L     +LIN  TI++ +P    +N ARGG+++++ L  +L+      AALDV   EP  +N  +K  P LI TPH      AS  E +   + EI   ++ 
Sbjct:   92 LRIIVRIGSGTDNIDVKAAGELGIAVCNVPGYGVEEVADTTMCLILNLYRRTYWLANMVREGKK----FTGPEQVREAAHGCARIRGDTLGLVGLGRIGSAVALRAKAFGFNVIFYDPYLPDGIDKSLGLTRVYTLQDLLFQSDCVSLHCTLNEHNHHLINEFTIKQMRPGAFLVNTARGGLVDDETLALALKQGRIRAAALDVHENEP--YNGALKDAPNLICTPHAAFFSDASATELREMAATEIRRAIVG 338          
BLAST of D-3-phosphoglycerate dehydrogenase vs. Ensembl Zebrafish
Match: phgdh (phosphoglycerate dehydrogenase [Source:ZFIN;Acc:ZDB-GENE-030131-647])

HSP 1 Score: 341.273 bits (874), Expect = 3.876e-109
Identity = 165/326 (50.61%), Postives = 225/326 (69.02%), Query Frame = 1
Query:  112 MNEFKLARILSTDGLDRNGVQALRDFGFDVVE-QKFSKSELIQQLINFDAIIVRSATTIDAEIIRAVTSNDGSRLKVIARAGTGVDNIDVEVATEKGLLVINTPAANTISAAEHTVALMCSLSRQIPQAHSNMKQGKWDRKLYMGTELLHKTLAIIGLGKIGKEVALRAQAFGMTTIGFDPIIGNEEAKSFNVDWMELNEIWPIADYISVHVPLIPQTENLINLKTIEKCKPSVKFINCARGGIINEDDLLKSLEMNLCSGAALDVFTEEPPTFNNLIKHPKLIVTPHLGASTVEAQFRVSMEIAENLISITKGESIPGSVNGHAI 1086
            M    + R+L ++ +D      L++ G +V E Q+ +K ELI ++ N+D +IVRSAT + A++I     N GS LK+I RAGTGVDN+DV+ AT++G++V+NTP+ NT+SAAE T AL+ SLSR IPQA  +MK GKWDRK +MG+EL  K L I+GLG+IGKEVA R Q+FGM TIG+DPI   E + S+ V+ M L+++WP  DYI+VH PL+  T  L+N  +  KCK  VK +NCARGGII+E  LL++LE   C GA LDVF EEPP    L+ HP +I  PHLGAST EAQ R   +IA  ++ +  G+++ G+VN   +
Sbjct:    1 MAPISVKRVLISESVDPCCKSVLQENGIEVTEKQQMTKEELIAEIRNYDGLIVRSATKVTADVI-----NAGSSLKIIGRAGTGVDNVDVDAATKRGIIVMNTPSGNTLSAAELTCALVMSLSRHIPQAVISMKDGKWDRKKFMGSELYGKVLGIVGLGRIGKEVATRMQSFGMKTIGYDPITPPEVSASWGVEQMTLDQLWPQCDYITVHTPLMASTTGLLNDASFAKCKKGVKVVNCARGGIIDEAALLRALESGQCGGAGLDVFVEEPPRERALVNHPNVISCPHLGASTKEAQARCGKDIALQIVDMATGKALVGAVNAQVL 321          
BLAST of D-3-phosphoglycerate dehydrogenase vs. Ensembl Zebrafish
Match: grhprb (glyoxylate reductase/hydroxypyruvate reductase b [Source:ZFIN;Acc:ZDB-GENE-040426-1847])

HSP 1 Score: 145.591 bits (366), Expect = 5.276e-38
Identity = 95/322 (29.50%), Postives = 172/322 (53.42%), Query Frame = 1
Query:  127 LARILSTDGLDRNGVQALRDFG---FDVVEQ--KFSKSELIQQLINFDAIIVRSATTIDAEIIRAVTSNDGSRLKVIARAGTGVDNIDVEVATEKGLLVINTPAANTISAAEHTVALMCSLSRQIPQAHSNMKQGKWD--RKLYM-GTELLHKTLAIIGLGKIGKEVALRAQAFGMTTIGFDPIIGNEE-AKSFNVDWMELNEIWPIADYISVHVPLIPQTENLINLKTIEKCKPSVKFINCARGGIINEDDLLKSLEMNLCSGAALDVFTEEP-PTFNNLIKHPKLIVTPHLGASTVEAQFRVSMEIAENLISITKGESIP 1062
            L ++  T  +  +G+  LR  G   F++ +      + EL+ ++   D I+      IDA+++       G  LKV++    G D++ +E   ++G+ V  TP   T + AE TVAL+ + SR++ +A    K G W   R +++ G EL + T+ I+GLG+IG  +A R + F +    +  +    E A   N +++ L+E+   +D++++   L P+T  + N     K K +  FIN +RGG++N++DL ++L   L +GA LDV T EP PT + L      ++ PH+ +++   +  +S   A NL++  +GE++P
Sbjct:   29 LPKVYVTRRIPPDGLDILRKSGQVQFELWDSDDPVPRVELLNKVKGCDGILCVLTEKIDAQLLDVA----GPNLKVLSTMSVGYDHLSLEELKKRGIRVGYTPEVLTDAVAELTVALLLATSRRLIEATHEAKTGGWGTWRTMWLCGHELANSTVGILGLGRIGVAIAERLKPFKVKKFIYTDVEPRTELANMINAEYVSLDELAKQSDFLAICCALTPETHGICNWNLFSKMKKNAIFINTSRGGVVNQEDLYEALSTGLIAGAGLDVTTPEPLPTHHPLYTLKNCVILPHIASASYTTRNAMSALAANNLLAGLRGEAMP 346          
BLAST of D-3-phosphoglycerate dehydrogenase vs. Ensembl Zebrafish
Match: grhprb (glyoxylate reductase/hydroxypyruvate reductase b [Source:ZFIN;Acc:ZDB-GENE-040426-1847])

HSP 1 Score: 137.502 bits (345), Expect = 4.664e-35
Identity = 95/332 (28.61%), Postives = 172/332 (51.81%), Query Frame = 1
Query:  127 LARILSTDGLDRNGVQALRDFG---FDVVEQ--KFSKSELIQQLINFDAIIVRSATTIDAEIIRAVTSNDGSRLKVIARAGTGVDNIDVEVATE----------KGLLVINTPAANTISAAEHTVALMCSLSRQIPQAHSNMKQGKWD--RKLYM-GTELLHKTLAIIGLGKIGKEVALRAQAFGMTTIGFDPIIGNEE-AKSFNVDWMELNEIWPIADYISVHVPLIPQTENLINLKTIEKCKPSVKFINCARGGIINEDDLLKSLEMNLCSGAALDVFTEEP-PTFNNLIKHPKLIVTPHLGASTVEAQFRVSMEIAENLISITKGESIP 1062
            L ++  T  +  +G+  LR  G   F++ +      + EL+ ++   D I+      IDA+++       G  LKV++    G D++ +E   +          +G+ V  TP   T + AE TVAL+ + SR++ +A    K G W   R +++ G EL + T+ I+GLG+IG  +A R + F +    +  +    E A   N +++ L+E+   +D++++   L P+T  + N     K K +  FIN +RGG++N++DL ++L   L +GA LDV T EP PT + L      ++ PH+ +++   +  +S   A NL++  +GE++P
Sbjct:   29 LPKVYVTRRIPPDGLDILRKSGQVQFELWDSDDPVPRVELLNKVKGCDGILCVLTEKIDAQLLDVA----GPNLKVLSTMSVGYDHLSLEELKKSLLIWACIFCRGIRVGYTPEVLTDAVAELTVALLLATSRRLIEATHEAKTGGWGTWRTMWLCGHELANSTVGILGLGRIGVAIAERLKPFKVKKFIYTDVEPRTELANMINAEYVSLDELAKQSDFLAICCALTPETHGICNWNLFSKMKKNAIFINTSRGGVVNQEDLYEALSTGLIAGAGLDVTTPEPLPTHHPLYTLKNCVILPHIASASYTTRNAMSALAANNLLAGLRGEAMP 356          
BLAST of D-3-phosphoglycerate dehydrogenase vs. Ensembl Zebrafish
Match: grhprb (glyoxylate reductase/hydroxypyruvate reductase b [Source:ZFIN;Acc:ZDB-GENE-040426-1847])

HSP 1 Score: 137.502 bits (345), Expect = 4.664e-35
Identity = 95/332 (28.61%), Postives = 172/332 (51.81%), Query Frame = 1
Query:  127 LARILSTDGLDRNGVQALRDFG---FDVVEQ--KFSKSELIQQLINFDAIIVRSATTIDAEIIRAVTSNDGSRLKVIARAGTGVDNIDVEVATE----------KGLLVINTPAANTISAAEHTVALMCSLSRQIPQAHSNMKQGKWD--RKLYM-GTELLHKTLAIIGLGKIGKEVALRAQAFGMTTIGFDPIIGNEE-AKSFNVDWMELNEIWPIADYISVHVPLIPQTENLINLKTIEKCKPSVKFINCARGGIINEDDLLKSLEMNLCSGAALDVFTEEP-PTFNNLIKHPKLIVTPHLGASTVEAQFRVSMEIAENLISITKGESIP 1062
            L ++  T  +  +G+  LR  G   F++ +      + EL+ ++   D I+      IDA+++       G  LKV++    G D++ +E   +          +G+ V  TP   T + AE TVAL+ + SR++ +A    K G W   R +++ G EL + T+ I+GLG+IG  +A R + F +    +  +    E A   N +++ L+E+   +D++++   L P+T  + N     K K +  FIN +RGG++N++DL ++L   L +GA LDV T EP PT + L      ++ PH+ +++   +  +S   A NL++  +GE++P
Sbjct:   29 LPKVYVTRRIPPDGLDILRKSGQVQFELWDSDDPVPRVELLNKVKGCDGILCVLTEKIDAQLLDVA----GPNLKVLSTMSVGYDHLSLEELKKSLLIWACIFCRGIRVGYTPEVLTDAVAELTVALLLATSRRLIEATHEAKTGGWGTWRTMWLCGHELANSTVGILGLGRIGVAIAERLKPFKVKKFIYTDVEPRTELANMINAEYVSLDELAKQSDFLAICCALTPETHGICNWNLFSKMKKNAIFINTSRGGVVNQEDLYEALSTGLIAGAGLDVTTPEPLPTHHPLYTLKNCVILPHIASASYTTRNAMSALAANNLLAGLRGEAMP 356          
BLAST of D-3-phosphoglycerate dehydrogenase vs. Ensembl Zebrafish
Match: grhpra (glyoxylate reductase/hydroxypyruvate reductase a [Source:ZFIN;Acc:ZDB-GENE-040724-230])

HSP 1 Score: 136.346 bits (342), Expect = 6.626e-35
Identity = 89/326 (27.30%), Postives = 170/326 (52.15%), Query Frame = 1
Query:  112 MNEFKLARILSTDGLDRNGVQALR-----DFGFDVVEQKFSKSELIQQLINFDAIIVRSATTIDAEIIRAVTSNDGSRLKVIARAGTGVDNIDVEVATEKGLLVINTPAANTISAAEHTVALMCSLSRQIPQAHSNMKQGKWD--RKLYM-GTELLHKTLAIIGLGKIGKEVALRAQAFGMTTIGFDPIIGNEEAKSFNVDWMELNEIWPIADYISVHVPLIPQTENLINLKTIEKCKPSVKFINCARGGIINEDDLLKSLEMNLCSGAALDVFTEEP-PTFNNLIKHPKLIVTPHLGASTVEAQFRVSMEIAENLISITKGESIP 1062
            M+  ++ ++  T  + + G++ L+     D      ++   ++EL++ +     +I   +  ID E++ A     G  LKVI+    G D++ ++   ++G+ V  TP   T + AE TVAL+ + +R++P+    +K G W   + L++ G  L   T+ +IGLG+IG  +A R + FG+  + +       EA+  + +++ L+ +   +D++ V   L P T+ L +     K K +  FIN +RG ++N++DL ++L     + A LDV + EP PT + L+     +V PH+G++T   +  +S   A NL++   G  +P
Sbjct:    1 MSAHQMLKVFVTRRIPQEGMKILQKASMCDLSLWDSDEPVPRAELLKGVAGAHGLICLLSDKIDTEVLDAA----GPNLKVISTLSVGFDHLAIDEIKKRGIRVGYTPDVLTDATAELTVALLLATARRLPEGVEEVKNGGWSTWKPLWLCGYGLSGSTVGVIGLGRIGLAIARRLKPFGVKKLLYTGRKPKPEAEEVDGEYVPLDTLVRESDFVVVSCSLTPDTQGLCDKTFFGKMKKTSVFINSSRGAVVNQEDLFEALSSGQIAAAGLDVTSPEPLPTNHPLLTLKNCVVLPHIGSATYSTRGVMSELTANNLLAGLTGSEMP 322          
BLAST of D-3-phosphoglycerate dehydrogenase vs. Ensembl Xenopus
Match: phgdh (major histocompatibility complex class I antigen 100036854 [Source:Xenbase;Acc:XB-GENE-5894693])

HSP 1 Score: 335.88 bits (860), Expect = 5.556e-108
Identity = 169/327 (51.68%), Postives = 222/327 (67.89%), Query Frame = 1
Query:  112 MNEFKLARILSTDGLDRNGVQALR-DFGFDVVEQK-FSKSELIQQLINFDAIIVRSATTIDAEIIRAVTSNDGSRLKVIARAGTGVDNIDVEVATEKGLLVINTPAANTISAAEHTVALMCSLSRQIPQAHSNMKQGKWDRKLYMGTELLHKTLAIIGLGKIGKEVALRAQAFGMTTIGFDPIIGNEEAKSFNVDWMELNEIWPIADYISVHVPLIPQTENLINLKTIEKCKPSVKFINCARGGIINEDDLLKSLEMNLCSGAALDVFTEEPPTFNNLIKHPKLIVTPHLGASTVEAQFRVSMEIAENLISITKGESIPGSVNGHAI 1086
            M+   + R+L +D L     Q LR   G +V E    +  +L+ Q+ ++D +IVRSAT + AE++ A     GSRLK++ RAGTGVDN+DVE AT+KG++V+NTP  N+ISAAE T  L+ SLSRQIPQA  +M+ GKWDRK +MG+EL  KT+ I+GLG+IGKEVA+R Q+F M TIG+DPII  E    F V+  +L EIW   DYI+VH PL+P T  LIN     KCK  VK INCARGGII+E  LL++L+   C GA LDVF EEPP    L++HP +I  PHLGAST EAQ R   EIA+ ++ + K  ++ G+VN  A+
Sbjct:    1 MSLSDIRRVLISDSLAPACAQTLRTQGGIEVTESPGLTHQQLLGQIQDYDGLIVRSATKVTAEVLTA-----GSRLKLVGRAGTGVDNVDVECATKKGIIVMNTPTGNSISAAELTCGLILSLSRQIPQAAESMRAGKWDRKKFMGSELYGKTVGILGLGRIGKEVAIRMQSFQMRTIGYDPIIPPEVTAQFGVEQFQLEEIWEQCDYITVHTPLLPSTTGLINDAAFAKCKRGVKVINCARGGIIDEAALLRALQSGQCGGAGLDVFVEEPPRDRALVEHPLVISLPHLGASTEEAQNRCGEEIAQQIVDLVKDRALVGAVNAPAL 322          
BLAST of D-3-phosphoglycerate dehydrogenase vs. Ensembl Xenopus
Match: phgdh (major histocompatibility complex class I antigen 100036854 [Source:Xenbase;Acc:XB-GENE-5894693])

HSP 1 Score: 337.035 bits (863), Expect = 1.012e-107
Identity = 169/327 (51.68%), Postives = 222/327 (67.89%), Query Frame = 1
Query:  112 MNEFKLARILSTDGLDRNGVQALR-DFGFDVVEQK-FSKSELIQQLINFDAIIVRSATTIDAEIIRAVTSNDGSRLKVIARAGTGVDNIDVEVATEKGLLVINTPAANTISAAEHTVALMCSLSRQIPQAHSNMKQGKWDRKLYMGTELLHKTLAIIGLGKIGKEVALRAQAFGMTTIGFDPIIGNEEAKSFNVDWMELNEIWPIADYISVHVPLIPQTENLINLKTIEKCKPSVKFINCARGGIINEDDLLKSLEMNLCSGAALDVFTEEPPTFNNLIKHPKLIVTPHLGASTVEAQFRVSMEIAENLISITKGESIPGSVNGHAI 1086
            M+   + R+L +D L     Q LR   G +V E    +  +L+ Q+ ++D +IVRSAT + AE++ A     GSRLK++ RAGTGVDN+DVE AT+KG++V+NTP  N+ISAAE T  L+ SLSRQIPQA  +M+ GKWDRK +MG+EL  KT+ I+GLG+IGKEVA+R Q+F M TIG+DPII  E    F V+  +L EIW   DYI+VH PL+P T  LIN     KCK  VK INCARGGII+E  LL++L+   C GA LDVF EEPP    L++HP +I  PHLGAST EAQ R   EIA+ ++ + K  ++ G+VN  A+
Sbjct:    1 MSLSDIRRVLISDSLAPACAQTLRTQGGIEVTESPGLTHQQLLGQIQDYDGLIVRSATKVTAEVLTA-----GSRLKLVGRAGTGVDNVDVECATKKGIIVMNTPTGNSISAAELTCGLILSLSRQIPQAAESMRAGKWDRKKFMGSELYGKTVGILGLGRIGKEVAIRMQSFQMRTIGYDPIIPPEVTAQFGVEQFQLEEIWEQCDYITVHTPLLPSTTGLINDAAFAKCKRGVKVINCARGGIIDEAALLRALQSGQCGGAGLDVFVEEPPRDRALVEHPLVISLPHLGASTEEAQNRCGEEIAQQIVDLVKDRALVGAVNAPAL 322          
BLAST of D-3-phosphoglycerate dehydrogenase vs. Ensembl Xenopus
Match: phgdh (major histocompatibility complex class I antigen 100036854 [Source:Xenbase;Acc:XB-GENE-5894693])

HSP 1 Score: 335.88 bits (860), Expect = 1.339e-107
Identity = 169/327 (51.68%), Postives = 222/327 (67.89%), Query Frame = 1
Query:  112 MNEFKLARILSTDGLDRNGVQALR-DFGFDVVEQK-FSKSELIQQLINFDAIIVRSATTIDAEIIRAVTSNDGSRLKVIARAGTGVDNIDVEVATEKGLLVINTPAANTISAAEHTVALMCSLSRQIPQAHSNMKQGKWDRKLYMGTELLHKTLAIIGLGKIGKEVALRAQAFGMTTIGFDPIIGNEEAKSFNVDWMELNEIWPIADYISVHVPLIPQTENLINLKTIEKCKPSVKFINCARGGIINEDDLLKSLEMNLCSGAALDVFTEEPPTFNNLIKHPKLIVTPHLGASTVEAQFRVSMEIAENLISITKGESIPGSVNGHAI 1086
            M+   + R+L +D L     Q LR   G +V E    +  +L+ Q+ ++D +IVRSAT + AE++ A     GSRLK++ RAGTGVDN+DVE AT+KG++V+NTP  N+ISAAE T  L+ SLSRQIPQA  +M+ GKWDRK +MG+EL  KT+ I+GLG+IGKEVA+R Q+F M TIG+DPII  E    F V+  +L EIW   DYI+VH PL+P T  LIN     KCK  VK INCARGGII+E  LL++L+   C GA LDVF EEPP    L++HP +I  PHLGAST EAQ R   EIA+ ++ + K  ++ G+VN  A+
Sbjct:   28 MSLSDIRRVLISDSLAPACAQTLRTQGGIEVTESPGLTHQQLLGQIQDYDGLIVRSATKVTAEVLTA-----GSRLKLVGRAGTGVDNVDVECATKKGIIVMNTPTGNSISAAELTCGLILSLSRQIPQAAESMRAGKWDRKKFMGSELYGKTVGILGLGRIGKEVAIRMQSFQMRTIGYDPIIPPEVTAQFGVEQFQLEEIWEQCDYITVHTPLLPSTTGLINDAAFAKCKRGVKVINCARGGIIDEAALLRALQSGQCGGAGLDVFVEEPPRDRALVEHPLVISLPHLGASTEEAQNRCGEEIAQQIVDLVKDRALVGAVNAPAL 349          
BLAST of D-3-phosphoglycerate dehydrogenase vs. Ensembl Xenopus
Match: phgdh (major histocompatibility complex class I antigen 100036854 [Source:Xenbase;Acc:XB-GENE-5894693])

HSP 1 Score: 323.168 bits (827), Expect = 2.089e-103
Identity = 156/280 (55.71%), Postives = 200/280 (71.43%), Query Frame = 1
Query:  247 NFDAIIVRSATTIDAEIIRAVTSNDGSRLKVIARAGTGVDNIDVEVATEKGLLVINTPAANTISAAEHTVALMCSLSRQIPQAHSNMKQGKWDRKLYMGTELLHKTLAIIGLGKIGKEVALRAQAFGMTTIGFDPIIGNEEAKSFNVDWMELNEIWPIADYISVHVPLIPQTENLINLKTIEKCKPSVKFINCARGGIINEDDLLKSLEMNLCSGAALDVFTEEPPTFNNLIKHPKLIVTPHLGASTVEAQFRVSMEIAENLISITKGESIPGSVNGHAI 1086
            ++D +IVRSAT + AE++ A     GSRLK++ RAGTGVDN+DVE AT+KG++V+NTP  N+ISAAE T  L+ SLSRQIPQA  +M+ GKWDRK +MG+EL  KT+ I+GLG+IGKEVA+R Q+F M TIG+DPII  E    F V+  +L EIW   DYI+VH PL+P T  LIN     KCK  VK INCARGGII+E  LL++L+   C GA LDVF EEPP    L++HP +I  PHLGAST EAQ R   EIA+ ++ + K  ++ G+VN  A+
Sbjct:   17 DYDGLIVRSATKVTAEVLTA-----GSRLKLVGRAGTGVDNVDVECATKKGIIVMNTPTGNSISAAELTCGLILSLSRQIPQAAESMRAGKWDRKKFMGSELYGKTVGILGLGRIGKEVAIRMQSFQMRTIGYDPIIPPEVTAQFGVEQFQLEEIWEQCDYITVHTPLLPSTTGLINDAAFAKCKRGVKVINCARGGIIDEAALLRALQSGQCGGAGLDVFVEEPPRDRALVEHPLVISLPHLGASTEEAQNRCGEEIAQQIVDLVKDRALVGAVNAPAL 291          
BLAST of D-3-phosphoglycerate dehydrogenase vs. Ensembl Xenopus
Match: phgdh (major histocompatibility complex class I antigen 100036854 [Source:Xenbase;Acc:XB-GENE-5894693])

HSP 1 Score: 323.553 bits (828), Expect = 4.012e-103
Identity = 166/329 (50.46%), Postives = 220/329 (66.87%), Query Frame = 1
Query:  112 MNEFKLARILSTDGLDRNGVQALR-DFGFDVVEQK-FSKSELIQQLINFDAIIVRSATTIDAEIIRAVTSNDGSRLKVIARAGTGVDNIDVEVATEKGLLVINTPAANTISAAEHTVALMCSLSRQIPQAHSNMKQGKWDRKLYMGTELLHKTLAIIGLGKIGKEVALRAQAFGMTTIGFDPIIGNEEAKSFNVDWMELNEIWPIADYISVHVPLIPQTEN--LINLKTIEKCKPSVKFINCARGGIINEDDLLKSLEMNLCSGAALDVFTEEPPTFNNLIKHPKLIVTPHLGASTVEAQFRVSMEIAENLISITKGESIPGSVNGHAI 1086
            M+   + R+L +D L     Q LR   G +V E    +  +L+ Q+ ++D +IVRSAT + AE++ A     GSRLK++ RAGTGVDN+DVE AT+KG++V+NTP  N+ISAAE T  L+ SLSRQIPQA  +M+ GKWDRK +MG+EL  KT+ I+GLG+IGKEVA+R Q+F M TIG+DPII  E    F V+  +L EIW   DYI+VH PL+P T    L+       CK  VK INCARGGII+E  LL++L+   C GA LDVF EEPP    L++HP +I  PHLGAST EAQ R   EIA+ ++ + K  ++ G+VN  A+
Sbjct:    1 MSLSDIRRVLISDSLAPACAQTLRTQGGIEVTESPGLTHQQLLGQIQDYDGLIVRSATKVTAEVLTA-----GSRLKLVGRAGTGVDNVDVECATKKGIIVMNTPTGNSISAAELTCGLILSLSRQIPQAAESMRAGKWDRKKFMGSELYGKTVGILGLGRIGKEVAIRMQSFQMRTIGYDPIIPPEVTAQFGVEQFQLEEIWEQCDYITVHTPLLPSTTGTLLLFCPNFILCKRGVKVINCARGGIIDEAALLRALQSGQCGGAGLDVFVEEPPRDRALVEHPLVISLPHLGASTEEAQNRCGEEIAQQIVDLVKDRALVGAVNAPAL 324          
BLAST of D-3-phosphoglycerate dehydrogenase vs. Ensembl Mouse
Match: Phgdh (3-phosphoglycerate dehydrogenase [Source:MGI Symbol;Acc:MGI:1355330])

HSP 1 Score: 346.28 bits (887), Expect = 5.405e-111
Identity = 169/321 (52.65%), Postives = 224/321 (69.78%), Query Frame = 1
Query:  127 LARILSTDGLDRNGVQALRDFGFDVVE-QKFSKSELIQQLINFDAIIVRSATTIDAEIIRAVTSNDGSRLKVIARAGTGVDNIDVEVATEKGLLVINTPAANTISAAEHTVALMCSLSRQIPQAHSNMKQGKWDRKLYMGTELLHKTLAIIGLGKIGKEVALRAQAFGMTTIGFDPIIGNEEAKSFNVDWMELNEIWPIADYISVHVPLIPQTENLINLKTIEKCKPSVKFINCARGGIINEDDLLKSLEMNLCSGAALDVFTEEPPTFNNLIKHPKLIVTPHLGASTVEAQFRVSMEIAENLISITKGESIPGSVNGHAI 1086
            L ++L +D LD    + L+D G  VVE Q  SK ELI +L + + +IVRSAT + A++I     N   +L+V+ RAGTGVDN+D+E AT KG+LV+NTP  N++SAAE T  ++  L+RQIPQA ++MK GKWDRK +MGTEL  KTL I+GLG+IG+EVA R Q+FGM T+G+DPII  E A SF V  + L EIWP+ D+I+VH PL+P T  L+N  T  +CK  V+ +NCARGGI++E  LL++L+   C+GAALDVFTEEPP    L+ H  +I  PHLGAST EAQ R   EIA   + + KG+S+ G VN  A+
Sbjct:    6 LRKVLISDSLDPCCRKILQDGGLQVVEKQNLSKEELIAELQDCEGLIVRSATKVTADVI-----NAAEKLQVVGRAGTGVDNVDLEAATRKGILVMNTPNGNSLSAAELTCGMIMCLARQIPQATASMKDGKWDRKKFMGTELNGKTLGILGLGRIGREVATRMQSFGMKTVGYDPIISPEVAASFGVQQLPLEEIWPLCDFITVHTPLLPSTTGLLNDSTFAQCKKGVRVVNCARGGIVDEGALLRALQSGQCAGAALDVFTEEPPRDRALVDHENVISCPHLGASTKEAQSRCGEEIAVQFVDMVKGKSLTGVVNAQAL 321          
BLAST of D-3-phosphoglycerate dehydrogenase vs. Ensembl Mouse
Match: Phgdh (3-phosphoglycerate dehydrogenase [Source:MGI Symbol;Acc:MGI:1355330])

HSP 1 Score: 167.933 bits (424), Expect = 2.150e-48
Identity = 80/139 (57.55%), Postives = 107/139 (76.98%), Query Frame = 1
Query:  244 INFD--AIIVRSATTIDAEIIRAVTSNDGSRLKVIARAGTGVDNIDVEVATEKGLLVINTPAANTISAAEHTVALMCSLSRQIPQAHSNMKQGKWDRKLYMGTELLHKTLAIIGLGKIGKEVALRAQAFGMTTIGFDPI 654
            ++FD   +IVRSAT + A++I     N   +L+V+ RAGTGVDN+D+E AT KG+LV+NTP  N++SAAE T  ++  L+RQIPQA ++MK GKWDRK +MGTEL  KTL I+GLG+IG+EVA R Q+FGM T+G+DPI
Sbjct:   16 LSFDCEGLIVRSATKVTADVI-----NAAEKLQVVGRAGTGVDNVDLEAATRKGILVMNTPNGNSLSAAELTCGMIMCLARQIPQATASMKDGKWDRKKFMGTELNGKTLGILGLGRIGREVATRMQSFGMKTVGYDPI 149          
BLAST of D-3-phosphoglycerate dehydrogenase vs. Ensembl Mouse
Match: Grhpr (glyoxylate reductase/hydroxypyruvate reductase [Source:MGI Symbol;Acc:MGI:1923488])

HSP 1 Score: 141.739 bits (356), Expect = 8.868e-37
Identity = 95/329 (28.88%), Postives = 171/329 (51.98%), Query Frame = 1
Query:  112 MNEFKLARILSTDGLDRNGVQALRDFGFDVVEQ-----KFSKSELIQQLINFDAIIVRSATTIDAEIIRAVTSNDGSRLKVIARAGTGVDNIDVEVATEKGLLVINTPAANTISAAEHTVALMCSLSRQIPQAHSNMKQGKWDR--KLYM-GTELLHKTLAIIGLGKIGKEVALRAQAFGMTTI---GFDPIIGNEEAKSFNVDWMELNEIWPIADYISVHVPLIPQTENLINLKTIEKCKPSVKFINCARGGIINEDDLLKSLEMNLCSGAALDVFTEEP-PTFNNLIKHPKLIVTPHLGASTVEAQFRVSMEIAENLISITKGESIP 1062
            M   +L ++  T  L   G  AL       VEQ        + +L Q ++    ++ R +  +D +++ A     G+ L+VI+    GVD++ ++   ++G+ V  TP   T + AE  V+L+ +  R++P+A   +K G W     L+M G  L   T+ I+GLG+IG+ +A R + FG+      G  P    +EA  F  +++ + ++   +D+I V   L P T  L +    +K K +  FIN +RG ++N++DL ++L     + A LDV T EP P  + L+     ++ PH+G++T + +  +S+  A NL++  +GE++P
Sbjct:    1 MKPARLMKVFVTGPLPAEGRAALAQAADCEVEQWNSDDPIPRKDLEQGVVGAHGLLCRLSDRVDKKLLDAA----GANLRVISTLSVGVDHLALDEIKKRGIRVGYTPGVLTDATAELAVSLLLTTCRRLPEAIEEVKNGGWSSWSPLWMCGYGLSQSTVGIVGLGRIGQAIARRLKPFGVQRFLYTGRQPR--PQEAAEFQAEFVPIAQLAAESDFIVVSCSLTPDTMGLCSKDFFQKMKNTAIFINISRGDVVNQEDLYQALASGQIAAAGLDVTTPEPLPPSHPLLTLKNCVILPHIGSATYKTRNTMSLLAANNLLAGLRGEAMP 323          
BLAST of D-3-phosphoglycerate dehydrogenase vs. Ensembl Mouse
Match: Ctbp1 (C-terminal binding protein 1 [Source:MGI Symbol;Acc:MGI:1201685])

HSP 1 Score: 128.257 bits (321), Expect = 9.226e-32
Identity = 81/257 (31.52%), Postives = 139/257 (54.09%), Query Frame = 1
Query:  331 LKVIARAGTGVDNIDVEVATEKGLLVINTPAANTISAAEHTVALMCSLSRQIPQAHSNMKQG------KWDRKLYMGTELLH-KTLAIIGLGKIGKEVALRAQAFGMTTIGFDPIIGNEEAKSFNVDWME-LNEIWPIADYISVHVPLIPQTENLINLKTIEKCKPSVKFINCARGGIINEDDLLKSLEMNLCSGAALDVFTEEPPTFNN--LIKHPKLIVTPHLGASTVEAQFRVSMEIAENLISITKGESIPGSV 1071
            L++I R G+G DNID++ A + G+ V N PAA+    A+ T+  + +L R+    H  +++G      +  R++  G   +  +TL IIGLG++G+ VALRA+AFG   + +DP + +   ++  +  +  L ++   +D +++H  L     +LIN  T+++ +     +N ARGG+++E  L ++L+     GAALDV   EP +F+   L   P LI TPH    + +A   +  E A  +     G  IP S+
Sbjct:   18 LRIIVRIGSGFDNIDIKSAGDLGIAVCNVPAASVEETADSTLCHILNLYRRTTWLHQALREGTRVQSVEQIREVASGAARIRGETLGIIGLGRVGQAVALRAKAFGFNVLFYDPYLSDGIERALGLQRVSTLQDLLFHSDCVTLHCGLNEHNHHLINDFTVKQMRQGAFLVNTARGGLVDEKALAQALKEGRIRGAALDVHESEPFSFSQGPLKDAPNLICTPHAAWYSEQASIEMREEAAREIRRAITGR-IPDSL 273          
BLAST of D-3-phosphoglycerate dehydrogenase vs. Ensembl Mouse
Match: Ctbp1 (C-terminal binding protein 1 [Source:MGI Symbol;Acc:MGI:1201685])

HSP 1 Score: 127.487 bits (319), Expect = 5.299e-31
Identity = 81/257 (31.52%), Postives = 139/257 (54.09%), Query Frame = 1
Query:  331 LKVIARAGTGVDNIDVEVATEKGLLVINTPAANTISAAEHTVALMCSLSRQIPQAHSNMKQG------KWDRKLYMGTELLH-KTLAIIGLGKIGKEVALRAQAFGMTTIGFDPIIGNEEAKSFNVDWME-LNEIWPIADYISVHVPLIPQTENLINLKTIEKCKPSVKFINCARGGIINEDDLLKSLEMNLCSGAALDVFTEEPPTFNN--LIKHPKLIVTPHLGASTVEAQFRVSMEIAENLISITKGESIPGSV 1071
            L++I R G+G DNID++ A + G+ V N PAA+    A+ T+  + +L R+    H  +++G      +  R++  G   +  +TL IIGLG++G+ VALRA+AFG   + +DP + +   ++  +  +  L ++   +D +++H  L     +LIN  T+++ +     +N ARGG+++E  L ++L+     GAALDV   EP +F+   L   P LI TPH    + +A   +  E A  +     G  IP S+
Sbjct:   81 LRIIVRIGSGFDNIDIKSAGDLGIAVCNVPAASVEETADSTLCHILNLYRRTTWLHQALREGTRVQSVEQIREVASGAARIRGETLGIIGLGRVGQAVALRAKAFGFNVLFYDPYLSDGIERALGLQRVSTLQDLLFHSDCVTLHCGLNEHNHHLINDFTVKQMRQGAFLVNTARGGLVDEKALAQALKEGRIRGAALDVHESEPFSFSQGPLKDAPNLICTPHAAWYSEQASIEMREEAAREIRRAITGR-IPDSL 336          
BLAST of D-3-phosphoglycerate dehydrogenase vs. UniProt/SwissProt
Match: sp|O08651|SERA_RAT (D-3-phosphoglycerate dehydrogenase OS=Rattus norvegicus OX=10116 GN=Phgdh PE=1 SV=3)

HSP 1 Score: 348.591 bits (893), Expect = 5.071e-111
Identity = 171/321 (53.27%), Postives = 224/321 (69.78%), Query Frame = 1
Query:  127 LARILSTDGLDRNGVQALRDFGFDVVE-QKFSKSELIQQLINFDAIIVRSATTIDAEIIRAVTSNDGSRLKVIARAGTGVDNIDVEVATEKGLLVINTPAANTISAAEHTVALMCSLSRQIPQAHSNMKQGKWDRKLYMGTELLHKTLAIIGLGKIGKEVALRAQAFGMTTIGFDPIIGNEEAKSFNVDWMELNEIWPIADYISVHVPLIPQTENLINLKTIEKCKPSVKFINCARGGIINEDDLLKSLEMNLCSGAALDVFTEEPPTFNNLIKHPKLIVTPHLGASTVEAQFRVSMEIAENLISITKGESIPGSVNGHAI 1086
            L +IL +D LD    + L+D G  VVE Q  SK ELI +L + + +IVRSAT + A++I     N   +L+V+ RAGTGVDN+D+E AT KG+LV+NTP  N++SAAE T  ++  L+RQIPQA ++MK GKWDRK +MGTEL  KTL I+GLG+IG+EVA R QAFGM T+G+DPII  E A SF V  + L EIWP+ D+I+VH PL+P T  L+N  T  +CK  V+ +NCARGGI++E  LL++L+   C+GAALDVFTEEPP    L+ H  +I  PHLGAST EAQ R   EIA   + + KG+S+ G VN  A+
Sbjct:    6 LRKILISDSLDPCCRKILQDGGLQVVEKQNLSKEELIAELQDCEGLIVRSATKVTADVI-----NAAEKLQVVGRAGTGVDNVDLEAATRKGVLVMNTPNGNSLSAAELTCGMLMCLARQIPQATASMKDGKWDRKKFMGTELNGKTLGILGLGRIGREVAARMQAFGMKTVGYDPIISPEVAASFGVQQLPLEEIWPLCDFITVHTPLLPSTTGLLNDSTFAQCKKGVRVVNCARGGIVDEGALLRALQSGQCAGAALDVFTEEPPRDRALVDHENVISCPHLGASTKEAQSRCGEEIAVQFVDMVKGKSLTGVVNAQAL 321          
BLAST of D-3-phosphoglycerate dehydrogenase vs. UniProt/SwissProt
Match: sp|Q61753|SERA_MOUSE (D-3-phosphoglycerate dehydrogenase OS=Mus musculus OX=10090 GN=Phgdh PE=1 SV=3)

HSP 1 Score: 346.28 bits (887), Expect = 3.781e-110
Identity = 169/321 (52.65%), Postives = 224/321 (69.78%), Query Frame = 1
Query:  127 LARILSTDGLDRNGVQALRDFGFDVVE-QKFSKSELIQQLINFDAIIVRSATTIDAEIIRAVTSNDGSRLKVIARAGTGVDNIDVEVATEKGLLVINTPAANTISAAEHTVALMCSLSRQIPQAHSNMKQGKWDRKLYMGTELLHKTLAIIGLGKIGKEVALRAQAFGMTTIGFDPIIGNEEAKSFNVDWMELNEIWPIADYISVHVPLIPQTENLINLKTIEKCKPSVKFINCARGGIINEDDLLKSLEMNLCSGAALDVFTEEPPTFNNLIKHPKLIVTPHLGASTVEAQFRVSMEIAENLISITKGESIPGSVNGHAI 1086
            L ++L +D LD    + L+D G  VVE Q  SK ELI +L + + +IVRSAT + A++I     N   +L+V+ RAGTGVDN+D+E AT KG+LV+NTP  N++SAAE T  ++  L+RQIPQA ++MK GKWDRK +MGTEL  KTL I+GLG+IG+EVA R Q+FGM T+G+DPII  E A SF V  + L EIWP+ D+I+VH PL+P T  L+N  T  +CK  V+ +NCARGGI++E  LL++L+   C+GAALDVFTEEPP    L+ H  +I  PHLGAST EAQ R   EIA   + + KG+S+ G VN  A+
Sbjct:    6 LRKVLISDSLDPCCRKILQDGGLQVVEKQNLSKEELIAELQDCEGLIVRSATKVTADVI-----NAAEKLQVVGRAGTGVDNVDLEAATRKGILVMNTPNGNSLSAAELTCGMIMCLARQIPQATASMKDGKWDRKKFMGTELNGKTLGILGLGRIGREVATRMQSFGMKTVGYDPIISPEVAASFGVQQLPLEEIWPLCDFITVHTPLLPSTTGLLNDSTFAQCKKGVRVVNCARGGIVDEGALLRALQSGQCAGAALDVFTEEPPRDRALVDHENVISCPHLGASTKEAQSRCGEEIAVQFVDMVKGKSLTGVVNAQAL 321          
BLAST of D-3-phosphoglycerate dehydrogenase vs. UniProt/SwissProt
Match: sp|O43175|SERA_HUMAN (D-3-phosphoglycerate dehydrogenase OS=Homo sapiens OX=9606 GN=PHGDH PE=1 SV=4)

HSP 1 Score: 343.584 bits (880), Expect = 4.181e-109
Identity = 168/321 (52.34%), Postives = 224/321 (69.78%), Query Frame = 1
Query:  127 LARILSTDGLDRNGVQALRDFGFDVVE-QKFSKSELIQQLINFDAIIVRSATTIDAEIIRAVTSNDGSRLKVIARAGTGVDNIDVEVATEKGLLVINTPAANTISAAEHTVALMCSLSRQIPQAHSNMKQGKWDRKLYMGTELLHKTLAIIGLGKIGKEVALRAQAFGMTTIGFDPIIGNEEAKSFNVDWMELNEIWPIADYISVHVPLIPQTENLINLKTIEKCKPSVKFINCARGGIINEDDLLKSLEMNLCSGAALDVFTEEPPTFNNLIKHPKLIVTPHLGASTVEAQFRVSMEIAENLISITKGESIPGSVNGHAI 1086
            L ++L +D LD    + L+D G  VVE Q  SK ELI +L + + +IVRSAT + A++I     N   +L+V+ RAGTGVDN+D+E AT KG+LV+NTP  N++SAAE T  ++  L+RQIPQA ++MK GKW+RK +MGTEL  KTL I+GLG+IG+EVA R Q+FGM TIG+DPII  E + SF V  + L EIWP+ D+I+VH PL+P T  L+N  T  +CK  V+ +NCARGGI++E  LL++L+   C+GAALDVFTEEPP    L+ H  +I  PHLGAST EAQ R   EIA   + + KG+S+ G VN  A+
Sbjct:    6 LRKVLISDSLDPCCRKILQDGGLQVVEKQNLSKEELIAELQDCEGLIVRSATKVTADVI-----NAAEKLQVVGRAGTGVDNVDLEAATRKGILVMNTPNGNSLSAAELTCGMIMCLARQIPQATASMKDGKWERKKFMGTELNGKTLGILGLGRIGREVATRMQSFGMKTIGYDPIISPEVSASFGVQQLPLEEIWPLCDFITVHTPLLPSTTGLLNDNTFAQCKKGVRVVNCARGGIVDEGALLRALQSGQCAGAALDVFTEEPPRDRALVDHENVISCPHLGASTKEAQSRCGEEIAVQFVDMVKGKSLTGVVNAQAL 321          
BLAST of D-3-phosphoglycerate dehydrogenase vs. UniProt/SwissProt
Match: sp|Q60HD7|SERA_MACFA (D-3-phosphoglycerate dehydrogenase OS=Macaca fascicularis OX=9541 GN=PHGDH PE=2 SV=4)

HSP 1 Score: 343.199 bits (879), Expect = 5.121e-109
Identity = 168/321 (52.34%), Postives = 224/321 (69.78%), Query Frame = 1
Query:  127 LARILSTDGLDRNGVQALRDFGFDVVE-QKFSKSELIQQLINFDAIIVRSATTIDAEIIRAVTSNDGSRLKVIARAGTGVDNIDVEVATEKGLLVINTPAANTISAAEHTVALMCSLSRQIPQAHSNMKQGKWDRKLYMGTELLHKTLAIIGLGKIGKEVALRAQAFGMTTIGFDPIIGNEEAKSFNVDWMELNEIWPIADYISVHVPLIPQTENLINLKTIEKCKPSVKFINCARGGIINEDDLLKSLEMNLCSGAALDVFTEEPPTFNNLIKHPKLIVTPHLGASTVEAQFRVSMEIAENLISITKGESIPGSVNGHAI 1086
            L ++L +D LD    + L+D G  VVE Q  SK ELI +L + + +IVRSAT + A++I     N   +L+V+ RAGTGVDN+D+E AT KG+LV+NTP  N++SAAE T  ++  L+RQIPQA ++MK GKW+RK +MGTEL  KTL I+GLG+IG+EVA R Q+FGM TIG+DPII  E + SF V  + L EIWP+ D+I+VH PL+P T  L+N  T  +CK  V+ +NCARGGI++E  LL++L+   C+GAALDVFTEEPP    L+ H  +I  PHLGAST EAQ R   EIA   + + KG+S+ G VN  A+
Sbjct:    6 LRKVLISDSLDPCCRKILQDGGLQVVEKQNLSKEELIAELQDCEGLIVRSATKVTADVI-----NAAEKLQVVGRAGTGVDNVDLEAATRKGVLVMNTPNGNSLSAAELTCGMIMCLARQIPQATASMKDGKWERKKFMGTELNGKTLGILGLGRIGREVATRMQSFGMKTIGYDPIISPEVSASFGVQQLPLEEIWPLCDFITVHTPLLPSTTGLLNDNTFAQCKKGVRVVNCARGGIVDEGALLRALQSGQCAGAALDVFTEEPPRDRALVDHENVISCPHLGASTKEAQSRCGEEIAVQFVDMVKGKSLAGVVNAQAL 321          
BLAST of D-3-phosphoglycerate dehydrogenase vs. UniProt/SwissProt
Match: sp|A5A6P1|SERA_PANTR (D-3-phosphoglycerate dehydrogenase OS=Pan troglodytes OX=9598 GN=PHGDH PE=2 SV=1)

HSP 1 Score: 342.813 bits (878), Expect = 6.408e-109
Identity = 168/321 (52.34%), Postives = 224/321 (69.78%), Query Frame = 1
Query:  127 LARILSTDGLDRNGVQALRDFGFDVVE-QKFSKSELIQQLINFDAIIVRSATTIDAEIIRAVTSNDGSRLKVIARAGTGVDNIDVEVATEKGLLVINTPAANTISAAEHTVALMCSLSRQIPQAHSNMKQGKWDRKLYMGTELLHKTLAIIGLGKIGKEVALRAQAFGMTTIGFDPIIGNEEAKSFNVDWMELNEIWPIADYISVHVPLIPQTENLINLKTIEKCKPSVKFINCARGGIINEDDLLKSLEMNLCSGAALDVFTEEPPTFNNLIKHPKLIVTPHLGASTVEAQFRVSMEIAENLISITKGESIPGSVNGHAI 1086
            L ++L +D LD    + L+D G  VVE Q  SK ELI +L + + +IVRSAT + A++I     N   +L+V+ RAGTGVDN+D+E AT KG+LV+NTP  N++SAAE T  ++  L+RQIPQA ++MK GKW+RK +MGTEL  KTL I+GLG+IG+EVA R Q+FGM TIG+DPII  E + SF V  + L EIWP+ D+I+VH PL+P T  L+N  T  +CK  V+ +NCARGGI++E  LL++L+   C+GAALDVFTEEPP    L+ H  +I  PHLGAST EAQ R   EIA   + + KG+S+ G VN  A+
Sbjct:    6 LRKVLISDSLDPCCRKILQDGGLQVVEKQNLSKEELIAELQDCEGLIVRSATKVTADVI-----NAAEKLQVVGRAGTGVDNVDLEAATRKGILVMNTPNGNSLSAAELTCGMIMCLARQIPQATASMKDGKWERKKFMGTELNGKTLGILGLGRIGREVATRMQSFGMKTIGYDPIISPEVSASFGVQQLPLEEIWPLCDFITVHTPLLPSTTGLLNDNTFAQCKKGVRVVNCARGGIVDEGALLRALQSGQCAGAALDVFTEEPPRDRALVDHENVISCPHLGASTKEAQSRCGEEIAVQFVDMVKGKSLTGVVNAQAL 321          
BLAST of D-3-phosphoglycerate dehydrogenase vs. TrEMBL
Match: V4AA63 (D-3-phosphoglycerate dehydrogenase OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_200644 PE=3 SV=1)

HSP 1 Score: 389.808 bits (1000), Expect = 1.216e-124
Identity = 186/321 (57.94%), Postives = 241/321 (75.08%), Query Frame = 1
Query:  127 LARILSTDGLDRNGVQALRDFGFDVVEQ-KFSKSELIQQLINFDAIIVRSATTIDAEIIRAVTSNDGSRLKVIARAGTGVDNIDVEVATEKGLLVINTPAANTISAAEHTVALMCSLSRQIPQAHSNMKQGKWDRKLYMGTELLHKTLAIIGLGKIGKEVALRAQAFGMTTIGFDPIIGNEEAKSFNVDWMELNEIWPIADYISVHVPLIPQTENLINLKTIEKCKPSVKFINCARGGIINEDDLLKSLEMNLCSGAALDVFTEEPPTFNNLIKHPKLIVTPHLGASTVEAQFRVSMEIAENLISITKGESIPGSVNGHAI 1086
            L ++L +D +D   V  L+  G +VV+  K SK ELI ++  +D +IVRSAT + A++I A      S LK+I RAGTGVDNID   AT++G++V+NTP  NT+SAAEHT AL+ ++SR+IP A  +MK+GKWDRK YMG EL  KTLAIIGLG+IGKEVALR Q+FGMTTIGFDPIIG + +  F+V+WM+L E+WP+ADYI+VH PLIPQT+NLIN +   KCK  VK INCARGGII+E+ L ++LE   C GA LDVF +EPPT   LIKHPK+I TPHLGAST EAQ RV++EIAE  + +++G  + G++N  A+
Sbjct:    5 LKKVLISDEIDEKCVNILKKKGVEVVKNTKLSKEELIAEIPKYDGLIVRSATKVTADVISAA-----SNLKIIGRAGTGVDNIDCNAATQRGIIVMNTPGGNTLSAAEHTCALIVTMSREIPNAAQSMKEGKWDRKKYMGNELNGKTLAIIGLGRIGKEVALRMQSFGMTTIGFDPIIGGDVSSEFDVEWMKLEELWPLADYITVHTPLIPQTKNLINDEVFSKCKKGVKVINCARGGIIDEEGLFRNLETGQCGGAGLDVFVQEPPTDFKLIKHPKVIATPHLGASTYEAQSRVAVEIAEQFLDLSEGLKLFGAINAPAL 320          
BLAST of D-3-phosphoglycerate dehydrogenase vs. TrEMBL
Match: A0A2R5L6U8 (D-3-phosphoglycerate dehydrogenase OS=Ornithodoros turicata OX=34597 PE=3 SV=1)

HSP 1 Score: 380.178 bits (975), Expect = 5.791e-121
Identity = 215/478 (44.98%), Postives = 303/478 (63.39%), Query Frame = 1
Query:  121 FKLARILSTDGLDRNGVQALRDFGFDV-VEQKFSKSELIQQLINFDAIIVRSATTIDAEIIRAVTSNDGSRLKVIARAGTGVDNIDVEVATEKGLLVINTPAANTISAAEHTVALMCSLSRQIPQAHSNMKQGKWDRKLYMGTELLHKTLAIIGLGKIGKEVALRAQAFGMTTIGFDPIIGNEEAKSFNVDWMELNEIWPIADYISVHVPLIPQTENLINLKTIEKCKPSVKFINCARGGIINEDDLLKSLEMNLCSGAALDVFTEEPPTFNNLIKHPKLIVTPHLGASTVEAQFRVSMEIAENLISITKGESIPGSVNGHAIEMS----NXXXXXXXXXXXTKISPILKNYDIVELSYKDNYEFCSNRAIENFIKSYLAMEILKLRNVG-SSINLINSMKMALGKNLTIVLRKMEEIDSCLLP---KLAVKVGKD--VMVVTLMKERLFLTKFNEIEIFPPVFIGSRGHLLIVSDDA 1521
              + ++L +D +D + V+ L + G  V ++  F+K++L++++ N+DA+IVRSAT + +++I A     G +LKVI RAGTGVDNID   AT +G+LVIN P  NT+SAAE T A++ +LSR+IP A S++K GKWDRK++MG EL  KTLAI+GLG+IGKEVA R Q+FGM TIGFDPI+  E ++ F V+ M L+ +WP+ADYI+VH PLIPQT++LIN  T+ KCK  VK IN ARGGI++EDDLL +LE   C GA LDVF EEPP  + LI HPK++ TPHLGA+T EAQ RV+ EIAE  + +T G+S+PG VN  A+  +    N     L   L    S ++   + ++L         + +A   F+ +  A+ +LK   +G S+ N IN   +A    + + L+K EE  SC L     L +K G     +V ++  +RLFL   +    F P  + S   L  V  D+
Sbjct:    3 LSIKKVLISDAVDASCVEILENNGIQVTLKTDFTKAQLLKEIENYDALIVRSATKVTSDVIEA-----GQKLKVIGRAGTGVDNIDCNAATRQGVLVINAPGGNTVSAAELTCAMVITLSREIPAATSSLKAGKWDRKMFMGNELYGKTLAIVGLGRIGKEVATRMQSFGMKTIGFDPIVPAEVSQEFGVESMTLDRLWPLADYITVHTPLIPQTKHLINKDTLGKCKKGVKIINVARGGIVHEDDLLAALESGHCGGAGLDVFVEEPPKNHALIGHPKVVCTPHLGANTREAQLRVAQEIAEQFVDLTIGQSVPGVVNAPALAQTQVPENKPWADLCVALGKVASALVGPSNGLQLELTTRGAALAGKA--KFLCTAAAIGVLK--QLGRSNANFINVSALAPEAKIEM-LQKHEEKPSCCLSGEVSLDIKCGTTTHTLVGSVAGDRLFLCSIDG-AAFEPRQVLSGALLFGVGQDS 469          
BLAST of D-3-phosphoglycerate dehydrogenase vs. TrEMBL
Match: B7P3M8 (D-3-phosphoglycerate dehydrogenase (Fragment) OS=Ixodes scapularis OX=6945 GN=8024121 PE=3 SV=1)

HSP 1 Score: 375.941 bits (964), Expect = 6.007e-120
Identity = 178/327 (54.43%), Postives = 239/327 (73.09%), Query Frame = 1
Query:  121 FKLARILSTDGLDRNGVQALRDFGFDV-VEQKFSKSELIQQLINFDAIIVRSATTIDAEIIRAVTSNDGSRLKVIARAGTGVDNIDVEVATEKGLLVINTPAANTISAAEHTVALMCSLSRQIPQAHSNMKQGKWDRKLYMGTELLHKTLAIIGLGKIGKEVALRAQAFGMTTIGFDPIIGNEEAKSFNVDWMELNEIWPIADYISVHVPLIPQTENLINLKTIEKCKPSVKFINCARGGIINEDDLLKSLEMNLCSGAALDVFTEEPPTFNNLIKHPKLIVTPHLGASTVEAQFRVSMEIAENLISITKGESIPGSVNGHAIEMSN 1098
              + ++L +D +D + V+ L + G  V ++  F+K EL+Q +  +DA+IVRSAT + +++I+A     G  LKVI RAGTGVDNID + AT +G+LVIN P  NT+SAAE T A++ +LSR+IP A  ++K GKWDRK +MG EL  KTLAI+GLG+IGKEVALR Q+FGM TIGFDPI+  E ++ F V+ M L+EIWP+ADYI+VH PLIPQT++LI   +++KCK  VK IN ARGGI+NEDDLL +LE   C GA LDVF EEPP    LI HPK++ TPHLGA+T EAQ RV+ EIAE  + +++G+S+PG VN  ++  + 
Sbjct:    3 LAIKKVLISDAVDASCVKILENNGVQVTLKTDFTKPELLQAIEGYDALIVRSATKVTSDVIKA-----GQALKVIGRAGTGVDNIDCDAATRQGILVINAPGGNTLSAAELTCAMIVTLSREIPAATMSLKAGKWDRKTFMGNELYGKTLAIVGLGRIGKEVALRMQSFGMKTIGFDPIVPKEVSREFGVESMSLDEIWPLADYITVHTPLIPQTKDLIGKASLQKCKKGVKIINVARGGIVNEDDLLAALESGHCGGAGLDVFLEEPPKNTQLIAHPKVVCTPHLGANTKEAQLRVAQEIAEQFVDLSQGKSVPGVVNAPSLSQTQ 324          
BLAST of D-3-phosphoglycerate dehydrogenase vs. TrEMBL
Match: A0A4D5S7F6 (D-3-phosphoglycerate dehydrogenase (Fragment) OS=Ixodes scapularis OX=6945 PE=3 SV=1)

HSP 1 Score: 375.555 bits (963), Expect = 1.716e-119
Identity = 178/327 (54.43%), Postives = 239/327 (73.09%), Query Frame = 1
Query:  121 FKLARILSTDGLDRNGVQALRDFGFDV-VEQKFSKSELIQQLINFDAIIVRSATTIDAEIIRAVTSNDGSRLKVIARAGTGVDNIDVEVATEKGLLVINTPAANTISAAEHTVALMCSLSRQIPQAHSNMKQGKWDRKLYMGTELLHKTLAIIGLGKIGKEVALRAQAFGMTTIGFDPIIGNEEAKSFNVDWMELNEIWPIADYISVHVPLIPQTENLINLKTIEKCKPSVKFINCARGGIINEDDLLKSLEMNLCSGAALDVFTEEPPTFNNLIKHPKLIVTPHLGASTVEAQFRVSMEIAENLISITKGESIPGSVNGHAIEMSN 1098
              + ++L +D +D + V+ L + G  V ++  F+K EL+Q +  +DA+IVRSAT + +++I+A     G  LKVI RAGTGVDNID + AT +G+LVIN P  NT+SAAE T A++ +LSR+IP A  ++K GKWDRK +MG EL  KTLAI+GLG+IGKEVALR Q+FGM TIGFDPI+  E ++ F V+ M L+EIWP+ADYI+VH PLIPQT++LI   +++KCK  VK IN ARGGI+NEDDLL +LE   C GA LDVF EEPP    LI HPK++ TPHLGA+T EAQ RV+ EIAE  + +++G+S+PG VN  ++  + 
Sbjct:   24 LTIKKVLISDAVDASCVKILENNGVQVTLKTDFTKPELLQAIEGYDALIVRSATKVTSDVIKA-----GQALKVIGRAGTGVDNIDCDAATRQGILVINAPGGNTLSAAELTCAMIVTLSREIPAATMSLKAGKWDRKTFMGNELYGKTLAIVGLGRIGKEVALRMQSFGMKTIGFDPIVPKEVSQEFGVESMSLDEIWPLADYITVHTPLIPQTKDLIGKASLQKCKKGVKIINVARGGIVNEDDLLAALESGHCGGAGLDVFLEEPPKNTQLIAHPKVVCTPHLGANTKEAQLRVAQEIAEQFVDLSQGKSVPGVVNAPSLSQTQ 345          
BLAST of D-3-phosphoglycerate dehydrogenase vs. TrEMBL
Match: A0A131Y3N1 (D-3-phosphoglycerate dehydrogenase OS=Ixodes ricinus OX=34613 PE=2 SV=1)

HSP 1 Score: 376.711 bits (966), Expect = 1.806e-119
Identity = 178/327 (54.43%), Postives = 240/327 (73.39%), Query Frame = 1
Query:  121 FKLARILSTDGLDRNGVQALRDFGFDV-VEQKFSKSELIQQLINFDAIIVRSATTIDAEIIRAVTSNDGSRLKVIARAGTGVDNIDVEVATEKGLLVINTPAANTISAAEHTVALMCSLSRQIPQAHSNMKQGKWDRKLYMGTELLHKTLAIIGLGKIGKEVALRAQAFGMTTIGFDPIIGNEEAKSFNVDWMELNEIWPIADYISVHVPLIPQTENLINLKTIEKCKPSVKFINCARGGIINEDDLLKSLEMNLCSGAALDVFTEEPPTFNNLIKHPKLIVTPHLGASTVEAQFRVSMEIAENLISITKGESIPGSVNGHAIEMSN 1098
              + ++L +D +D + V+ L + G  V ++  F+K EL+Q +  +DA+IVRSAT + +++I+A     G  LKVI RAGTGVDNID + AT +G+LVIN P  NT+SAAE T A++ +LSR+IP A  ++K GKWDRK +MG EL  KTLAI+GLG+IGKEVALR Q+FGM TIGFDPI+  E ++ F V+ M L+EIWP+ADYI+VH PLIPQT++LI   +++KCK  VK IN ARGGI+NEDDLL +LE   C GA LDVF EEPP    LI HPK++ TPHLGA+T EAQ RV+ EIAE  +++++G+S+PG VN  ++  + 
Sbjct:    3 LTIKKVLISDAVDASCVKILENNGVQVTLKTDFTKPELLQAIEGYDALIVRSATKVTSDVIKA-----GQALKVIGRAGTGVDNIDCDAATRQGILVINAPGGNTLSAAELTCAMIVTLSREIPAATMSLKAGKWDRKTFMGNELYGKTLAIVGLGRIGKEVALRMQSFGMKTIGFDPIVPKEVSREFGVESMSLDEIWPLADYITVHTPLIPQTKDLIGKASLQKCKKGVKIINVARGGIVNEDDLLAALESGHCGGAGLDVFLEEPPKNTQLIAHPKVVCTPHLGANTKEAQLRVAQEIAEQFVALSQGKSVPGVVNAPSLSQTQ 324          
BLAST of D-3-phosphoglycerate dehydrogenase vs. Ensembl Cavefish
Match: phgdh (phosphoglycerate dehydrogenase [Source:NCBI gene;Acc:103042539])

HSP 1 Score: 335.495 bits (859), Expect = 5.979e-107
Identity = 165/327 (50.46%), Postives = 221/327 (67.58%), Query Frame = 1
Query:  109 KMNEFKLARILSTDGLDRNGVQALRDFGFDVVE-QKFSKSELIQQLINFDAIIVRSATTIDAEIIRAVTSNDGSRLKVIARAGTGVDNIDVEVATEKGLLVINTPAANTISAAEHTVALMCSLSRQIPQAHSNMKQGKWDRKLYMGTELLHKTLAIIGLGKIGKEVALRAQAFGMTTIGFDPIIGNEEAKSFNVDWMELNEIWPIADYISVHVPLIPQTENLINLKTIEKCKPSVKFINCARGGIINEDDLLKSLEMNLCSGAALDVFTEEPPTFNNLIKHPKLIVTPHLGASTVEAQFRVSMEIAENLISITKGESIPGSVNGHAI 1086
            +M    + R+L ++ +D      L++ G +V E Q  SK ELI Q+ ++D ++VRSAT + A+II +        LKVI RAGTGVDN+DV+ AT+KG++V+NTP+ NTISAAE T  L+ SLSR +PQA  +MK   WDRK +MG EL  KTL I+GLG+IGKEVA R Q+FG+ TIG+DPI   E + S+ V+ M L E+WP  DYI+VH PL+P T  L+N  +  KCK  VK +NCARGGII+E  LL++LE   C GA LDVF EEPP    L+KHP +I  PHLGAST EAQ R   +IA  ++ + K +++ G+VN   +
Sbjct:   12 EMAPVSIRRVLISESVDPCCRAILQENGIEVTEKQNMSKDELISQIKDYDGLVVRSATKVTADIIASA-----GNLKVIGRAGTGVDNVDVDAATKKGIIVMNTPSGNTISAAELTCTLLMSLSRHVPQAAMSMKAENWDRKKFMGAELYGKTLGIVGLGRIGKEVATRMQSFGVRTIGYDPITPTEVSASWGVEQMSLEELWPQCDYITVHTPLMPSTTGLLNDDSFAKCKKGVKVVNCARGGIIDEAALLRALESGQCGGAGLDVFVEEPPKNWPLVKHPNVICCPHLGASTKEAQARCGQDIALQIVDMVKCKALVGAVNAQVL 333          
BLAST of D-3-phosphoglycerate dehydrogenase vs. Ensembl Cavefish
Match: grhprb (glyoxylate reductase/hydroxypyruvate reductase b [Source:ZFIN;Acc:ZDB-GENE-040426-1847])

HSP 1 Score: 138.658 bits (348), Expect = 1.057e-35
Identity = 85/286 (29.72%), Postives = 156/286 (54.55%), Query Frame = 1
Query:  220 KSELIQQLINFDAIIVRSATTIDAEIIRAVTSNDGSRLKVIARAGTGVDNIDVEVATEKGLLVINTPAANTISAAEHTVALMCSLSRQIPQAHSNMKQGKWD--RKLYM-GTELLHKTLAIIGLGKIGKEVALRAQAFGMTTIGFDPIIGNEE-AKSFNVDWMELNEIWPIADYISVHVPLIPQTENLINLKTIEKCKPSVKFINCARGGIINEDDLLKSLEMNLCSGAALDVFTEEP-PTFNNLIKHPKLIVTPHLGASTVEAQFRVSMEIAENLISITKGESIP 1062
            + EL++++   D ++      IDAE++ A     G  LKV++    G D++ ++   ++G+ +  TP   T + AE TVAL+ + SR++ +A    K G W   R L++ G EL   T+ I+GLG+IG  +A R + F +    +  +    E A+    +++ ++E+   +D+++    L P+T+ + N K   K K +  FIN +RGG++N++DL ++L     +GA LDV   EP PT + L      ++ PH+ +++   +  +S   A NL++  +GE +P
Sbjct:   54 RQELLKKVRGCDGLLCVLTEKIDAEVLDAA----GPNLKVLSTMSVGFDHLSLDELKKRGIRIGYTPEVLTDAVAELTVALLLATSRRLIEATHEAKTGGWGTWRTLWLCGHELADSTVGILGLGRIGVAIAERLKPFKVKKFIYTDVEPRPELAEMIQAEYVSMDELARRSDFLAACCALTPETQGICNKKLFSKMKSTSIFINTSRGGVVNQEDLYEALSTGRIAGAGLDVTVPEPLPTNHPLFTLKNCVILPHIASASYTTRNAMSALAANNLLAGLRGEPMP 335          
BLAST of D-3-phosphoglycerate dehydrogenase vs. Ensembl Cavefish
Match: grhpra (glyoxylate and hydroxypyruvate reductase [Source:NCBI gene;Acc:103046658])

HSP 1 Score: 134.035 bits (336), Expect = 2.864e-34
Identity = 82/289 (28.37%), Postives = 155/289 (53.63%), Query Frame = 1
Query:  205 EQKFSKSELIQQLINFDAIIVRSATTIDAEIIRAVTSNDGSRLKVIARAGTGVDNIDVEVATEKGLLVINTPAANTISAAEHTVALMCSLSRQIPQAHSNMKQGKWD--RKLYM-GTELLHKTLAIIGLGKIGKEVALRAQAFGMTTIGFDPIIGNEEAKSFNVDWMELNEIWPIADYISVHVPLIPQTENLINLKTIEKCKPSVKFINCARGGIINEDDLLKSLEMNLCSGAALDVFTEEP-PTFNNLIKHPKLIVTPHLGASTVEAQFRVSMEIAENLISITKGESI 1059
            ++   ++EL++ +     ++   +  ID E++ A     G  LKVI+    G D++ ++   ++G+ V  TP   T + AE TVAL+ + +R++P+    +K G W   + L++ G  L   T+ +IGLG+IG  +A R   FG+  + +       +A+  + +++ L+ +   +D++ V   L P T+ L N     K K +  FIN +RG ++N++DL ++L     + A LDV T EP PT + L+     +V PH+G++T   +  ++   A NL++   G+++
Sbjct:   37 DEPVPRAELLKGVEGAHGLLCLLSDRIDTEVLDAA----GPNLKVISTLSVGFDHLAIDEVKKRGIRVGYTPDVLTDATAELTVALLLATARRLPEGIQEVKSGGWSTWKPLWLCGYGLSGSTVGVIGLGRIGLAIARRLMPFGVKRLLYSGRQPKPQAQEVDGEYVPLDTLLSESDFVVVSCALTPDTQGLCNKAFFSKMKKTAVFINTSRGAVVNQEDLFEALSTGQIAAAGLDVTTPEPLPTDHPLLTLNNCVVLPHIGSATYSTRGIMAQLSANNLLAGLSGDAM 321          
BLAST of D-3-phosphoglycerate dehydrogenase vs. Ensembl Cavefish
Match: ctbp1 (C-terminal-binding protein 1 [Source:NCBI gene;Acc:103035478])

HSP 1 Score: 136.732 bits (343), Expect = 3.268e-34
Identity = 88/257 (34.24%), Postives = 138/257 (53.70%), Query Frame = 1
Query:  331 LKVIARAGTGVDNIDVEVATEKGLLVINTPAANTISAAEHTVALMCSLSRQIPQAHSNMKQGKWD------RKLYMGTELLH-KTLAIIGLGKIGKEVALRAQAFGMTTIGFDPIIGNEEAKSFNVDWME-LNEIWPIADYISVHVPLIPQTENLINLKTIEKCKPSVKFINCARGGIINEDDLLKSLEMNLCSGAALDVFTEEPPTFNN--LIKHPKLIVTPHLGASTVEAQFRVSMEIAENLISITKGESIPGSV 1071
            L+VI R G+G DN+DV+ A E G+ V N PAA+    A+ ++ L+ +L R++   H  +++G         R++  G   +  +TL IIGLG++G+ VALRA+AFG   I +DP +     +S  +  M  L ++   +D +S+H  L     +LIN  TI++ +     +N ARGG+++E  L ++L+     GAALDV   EP +F+   L   P LI TPH    + +A      E A  +     G  IP S+
Sbjct:   98 LRVIVRIGSGFDNVDVKAAAELGIAVCNVPAASVEETADTSMCLILNLYRRVTWMHQALREGTRASSVEQIREVAGGAARIRGETLGIIGLGRVGQAVALRAKAFGFGVIFYDPYLPEGVERSLGLQRMATLQDLLIHSDCVSLHCSLNEHNHHLINDFTIKQMRQGAFLVNTARGGLVDEKALAQALKEGRIRGAALDVHETEPFSFSQGPLKDAPNLICTPHTSWYSEQASIEAREEAAREVRRAITGR-IPDSL 353          
BLAST of D-3-phosphoglycerate dehydrogenase vs. Ensembl Cavefish
Match: ctbp1 (C-terminal-binding protein 1 [Source:NCBI gene;Acc:103035478])

HSP 1 Score: 136.732 bits (343), Expect = 3.268e-34
Identity = 88/257 (34.24%), Postives = 138/257 (53.70%), Query Frame = 1
Query:  331 LKVIARAGTGVDNIDVEVATEKGLLVINTPAANTISAAEHTVALMCSLSRQIPQAHSNMKQGKWD------RKLYMGTELLH-KTLAIIGLGKIGKEVALRAQAFGMTTIGFDPIIGNEEAKSFNVDWME-LNEIWPIADYISVHVPLIPQTENLINLKTIEKCKPSVKFINCARGGIINEDDLLKSLEMNLCSGAALDVFTEEPPTFNN--LIKHPKLIVTPHLGASTVEAQFRVSMEIAENLISITKGESIPGSV 1071
            L+VI R G+G DN+DV+ A E G+ V N PAA+    A+ ++ L+ +L R++   H  +++G         R++  G   +  +TL IIGLG++G+ VALRA+AFG   I +DP +     +S  +  M  L ++   +D +S+H  L     +LIN  TI++ +     +N ARGG+++E  L ++L+     GAALDV   EP +F+   L   P LI TPH    + +A      E A  +     G  IP S+
Sbjct:   98 LRVIVRIGSGFDNVDVKAAAELGIAVCNVPAASVEETADTSMCLILNLYRRVTWMHQALREGTRASSVEQIREVAGGAARIRGETLGIIGLGRVGQAVALRAKAFGFGVIFYDPYLPEGVERSLGLQRMATLQDLLIHSDCVSLHCSLNEHNHHLINDFTIKQMRQGAFLVNTARGGLVDEKALAQALKEGRIRGAALDVHETEPFSFSQGPLKDAPNLICTPHTSWYSEQASIEAREEAAREVRRAITGR-IPDSL 353          
BLAST of D-3-phosphoglycerate dehydrogenase vs. Ensembl Sea Lamprey
Match: phgdh (phosphoglycerate dehydrogenase [Source:ZFIN;Acc:ZDB-GENE-030131-647])

HSP 1 Score: 337.421 bits (864), Expect = 3.415e-110
Identity = 156/300 (52.00%), Postives = 220/300 (73.33%), Query Frame = 1
Query:  178 LRDFGFDVVEQ-KFSKSELIQQLINFDAIIVRSATTIDAEIIRAVTSNDGSRLKVIARAGTGVDNIDVEVATEKGLLVINTPAANTISAAEHTVALMCSLSRQIPQAHSNMKQGKWDRKLYMGTELLHKTLAIIGLGKIGKEVALRAQAFGMTTIGFDPIIGNEEAKSFNVDWMELNEIWPIADYISVHVPLIPQTENLINLKTIEKCKPSVKFINCARGGIINEDDLLKSLEMNLCSGAALDVFTEEPPTFNNLIKHPKLIVTPHLGASTVEAQFRVSMEIAENLISITKGESIPGSVN 1074
            LRD G +V E+   S +EL++ + ++DA+IVRSAT + AE++ A     G RL ++ RAGTGVDN+DVE AT +G++V+NTP  NT+SAAE T  ++  L+R IPQA ++M +GKW+RK +MGTELL KTL I+GLG+IG+EVALR QAFGMTTIG+DPII  E + +F V+ + L ++WP  D+I+VH PL+P T  L+N  +  +CK  V+ +NCARGGII+ED L ++LE   C GA LDVF +EP T   LI+HP+++  PHLGAST EAQ R   E+A+ ++ + +G+++ G+VN
Sbjct:   21 LRDGGLEVDERLGMSPAELVECIKDYDALIVRSATKVTAEVLHA-----GERLLLVGRAGTGVDNVDVEAATRRGVIVMNTPGGNTMSAAELTCGMLLCLARFIPQAMASMHEGKWERKKFMGTELLGKTLGIVGLGRIGREVALRMQAFGMTTIGYDPIIPAEVSAAFGVEQLSLEQLWPKCDFITVHTPLMPSTTGLLNDASFARCKRGVRVVNCARGGIIDEDALQRALESGQCGGAGLDVFIQEPKTNIALIRHPRVVCGPHLGASTHEAQSRCGEELAQQVVELVQGKALVGAVN 315          
BLAST of D-3-phosphoglycerate dehydrogenase vs. Ensembl Sea Lamprey
Match: grhpra (glyoxylate reductase/hydroxypyruvate reductase a [Source:ZFIN;Acc:ZDB-GENE-040724-230])

HSP 1 Score: 129.798 bits (325), Expect = 1.670e-33
Identity = 83/292 (28.42%), Postives = 153/292 (52.40%), Query Frame = 1
Query:  205 EQKFSKSELIQQLINFDAIIVRSATTIDAEIIRAVTSNDGSRLKVIARAGTGVDNIDVEVATEKGLLVINTPAANTISAAEHTVALMCSLSRQIPQAHSNMKQGKWD--RKLYM-GTELLHKTLAIIGLGKIGKEVALRAQAFGMTTI---GFDPIIGNEEAKSFNVDWMELNEIWPIADYISVHVPLIPQTENLINLKTIEKCKPSVKFINCARGGIINEDDLLKSLEMNLCSGAALDVFTEEP-PTFNNLIKHPKLIVTPHLGASTVEAQFRVSMEIAENLISITKGESI 1059
            + +  + EL++++     +       +DA ++ A     G  LKVI+    G D++ ++   ++G+ V  TP   T + AE TV L+ + SR++ +A + +K G W   + ++M G  L   T+ ++GLG+IG  V  R + FG+  +   G +P    E  +  +  ++ L  +   AD++ V   L   T  L   +   + K S  FIN +RG I+N+DDL  +L     + A LDV T EP PT + L+     ++ PH+G++ ++ + ++++  AENL++  +GE +
Sbjct:   29 DDQIPQEELLRRVPGIHGLYCLLTDRVDAAVLDAA----GPSLKVISTMSVGFDHLSLDECKKRGIRVGYTPDVLTDATAELTVGLLLATSRRLVEAAAEVKSGGWGTWKPMWMCGQGLSGSTVGVVGLGRIGMAVCERLKPFGVRRVLYTGRNPKPDAE--RRLDAQFLPLQGLLREADFVVVSCALTDATRGLFGREAFARMKRSAVFINVSRGLIVNQDDLYDALTSGEIAAAGLDVTTPEPLPTDHPLLSLSNCVIMPHIGSAAIDTRSKMAVMTAENLLAGLRGEPM 314          
BLAST of D-3-phosphoglycerate dehydrogenase vs. Ensembl Yeast
Match: SER3 (3-phosphoglycerate dehydrogenase and alpha-ketoglutarate reductase; 3PG dehydrogenase that catalyzes the first step in serine and glycine biosynthesis; also functions as an alpha-ketoglutarate reductase, converting alpha-ketoglutarate to D-2-hydroxyglutarate (D-2HG); localizes to the cytoplasm; SER3 has a paralog, SER33, that arose from the whole genome duplication [Source:SGD;Acc:S000000883])

HSP 1 Score: 150.214 bits (378), Expect = 1.204e-39
Identity = 99/332 (29.82%), Postives = 179/332 (53.92%), Query Frame = 1
Query:  133 RILSTDGLDRNGVQALRDFGFDVVEQKFS--KSELIQQLINFDAIIVRSATTIDAEIIRAVTSNDGSRLKVIARAGTGVDNIDVEVATEKGLLVINTPAANTISAAEHTVALMCSLSRQIPQAHSNMKQGKWDRKLYMGTELLHKTLAIIGLGKIGKEVALRAQAFGMTTIGFD--PIIGNEEAKSFNVDWMELNEIWPIADYISVHVPLIPQTENLINLKTIEKCKPSVKFINCARGGIINEDDLLKSLEMNLCSGAALDVFTEEPP-----TFNN--------LIKHPKLIVTPHLGASTVEAQFRVSMEIAENLIS-ITKGESIPGSVN 1074
            +IL  + +++  +    + G+ V   K S  + ELI+++ +  AI +RS T + + +++         L  I     G + +D++ AT +G+ V N+P +N+ S AE  +A + SL+RQ+      +  G W++      E+  KTL IIG G IG ++++ A+A G+  + +D   I+    A+  +     L+E+   +D++++HVP  P+TE +++       K     IN +RG +++   L+++++ N  +GAALDV+  EP      +FN+        L+  P +I+TPH+G ST EAQ  + +E+A  L   I +G S+ GSVN
Sbjct:   60 KILLLENVNQTAITIFEEQGYQVEFYKSSLPEEELIEKIKDVHAIGIRSKTRLTSNVLQ-----HAKNLVCIGCFCIGTNQVDLDYATSRGIAVFNSPFSNSRSVAELVIAEIISLARQLGDRSIELHTGTWNKVAARCWEVRGKTLGIIGYGHIGSQLSVLAEAMGLHVLYYDIVTIMALGTARQVST----LDELLNKSDFVTLHVPATPETEKMLSAPQFAAMKDGAYVINASRGTVVDIPSLIQAVKANKIAGAALDVYPHEPAKNGEGSFNDELNSWTSELVSLPNIILTPHIGGSTEEAQSSIGIEVATALSKYINEGNSV-GSVN 381          
BLAST of D-3-phosphoglycerate dehydrogenase vs. Ensembl Yeast
Match: SER33 (3-phosphoglycerate dehydrogenase and alpha-ketoglutarate reductase; 3PG dehydrogenase that catalyzes the first step in serine and glycine biosynthesis; also functions as an alpha-ketoglutarate reductase, converting alpha-ketoglutarate to D-2-hydroxyglutarate (D-2HG); localizes to the cytoplasm; SER33 has a paralog, SER3, that arose from the whole genome duplication [Source:SGD;Acc:S000001336])

HSP 1 Score: 149.828 bits (377), Expect = 1.988e-39
Identity = 100/331 (30.21%), Postives = 177/331 (53.47%), Query Frame = 1
Query:  136 ILSTDGLDRNGVQALRDFGFDVVEQKFS--KSELIQQLINFDAIIVRSATTIDAEIIRAVTSNDGSRLKVIARAGTGVDNIDVEVATEKGLLVINTPAANTISAAEHTVALMCSLSRQIPQAHSNMKQGKWDRKLYMGTELLHKTLAIIGLGKIGKEVALRAQAFGMTTIGFD--PIIGNEEAKSFNVDWMELNEIWPIADYISVHVPLIPQTENLINLKTIEKCKPSVKFINCARGGIINEDDLLKSLEMNLCSGAALDVFTEEPP-----TFNN--------LIKHPKLIVTPHLGASTVEAQFRVSMEIAENLIS-ITKGESIPGSVN 1074
            IL  + ++   ++  +D G+ V   K S  + ELI+++ +  AI +RS T +  +I++         L  I     G + +D++ A  KG+ V N+P +N+ S AE  +  + SL+RQ+      +  G W++      E+  KTL IIG G IG ++++ A+A G+  + +D   I+    A+  +     L+E+   +D++++HVP  P+TE +++       K     IN +RG +++   L+++++ N  +GAALDV+  EP      +FN+        L+  P +I+TPH+G ST EAQ  + +E+A  L   I +G S+ GSVN
Sbjct:   61 ILLLENVNATAIKIFKDQGYQVEFHKSSLPEDELIEKIKDVHAIGIRSKTRLTEKILQ-----HARNLVCIGCFCIGTNQVDLKYAASKGIAVFNSPFSNSRSVAELVIGEIISLARQLGDRSIELHTGTWNKVAARCWEVRGKTLGIIGYGHIGSQLSVLAEAMGLHVLYYDIVTIMALGTARQVST----LDELLNKSDFVTLHVPATPETEKMLSAPQFAAMKDGAYVINASRGTVVDIPSLIQAVKANKIAGAALDVYPHEPAKNGEGSFNDELNSWTSELVSLPNIILTPHIGGSTEEAQSSIGIEVATALSKYINEGNSV-GSVN 381          
BLAST of D-3-phosphoglycerate dehydrogenase vs. Ensembl Yeast
Match: GOR1 (Glyoxylate reductase; null mutation results in increased biomass after diauxic shift; the authentic, non-tagged protein is detected in highly purified mitochondria in high-throughput studies; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000005218])

HSP 1 Score: 106.686 bits (265), Expect = 1.493e-25
Identity = 79/281 (28.11%), Postives = 132/281 (46.98%), Query Frame = 1
Query:  205 EQKFSKSELIQ-QLINFDAIIVRSATTIDAEIIRAVTSNDGSRLKVIARAGTGVDNIDVEVATEKGLLVINTPAANTISAAEHTVALMCSLSRQIPQAHSNMKQGKWDRK-----LYMGTELLHKTLAIIGLGKIGKEVALRAQAFGMTTIGFDPIIGNEEAKSFNVDWMELNEIWPIADYISVHVPLIPQTENLINLKTIEKCKPSVKFINCARGGIINEDDLLKSLEMNLCSGAALDVFTEEPPTFNNLIKHPKLIVTPHLGASTVEAQFRVSMEIAEN 1029
            E K  +++L Q Q+I   A  V++    D E+  A+ S+    +  +   G G D IDVE   ++ + V N P   + + A+  V L+    R     +  + +G W           G +   KT+ I+GLG+IG+ +  R + FG     +         +    +++   E    +D +SV+VPL   T +LIN +TIEK K  V  +N ARG +I+E  +  +L       A LDVF  EP     L+   +++  PH+G  +VE + ++   + EN
Sbjct:   44 EVKDPQNKLSQVQVITRTARSVKNTGRFDEELALALPSS----VVAVCHTGAGYDQIDVEPFKKRHIQVANVPDLVSNATADTHVFLLLGALRNFGIGNRRLIEGNWPEAGPACGSPFGYDPEGKTVGILGLGRIGRCILERLKPFGFENFIYHNRHQLPSEEEHGCEYVGFEEFLKRSDIVSVNVPLNHNTHHLINAETIEKMKDGVVIVNTARGAVIDEQAMTDALRSGKIRSAGLDVFEYEPKISKELLSMSQVLGLPHMGTHSVETRKKMEELVVEN 320          
BLAST of D-3-phosphoglycerate dehydrogenase vs. Ensembl Yeast
Match: FDH1 (NAD(+)-dependent formate dehydrogenase; may protect cells from exogenous formate [Source:SGD;Acc:S000005915])

HSP 1 Score: 85.1149 bits (209), Expect = 3.518e-18
Identity = 73/279 (26.16%), Postives = 126/279 (45.16%), Query Frame = 1
Query:  253 DAIIVRSATTIDAEIIRAVTSNDGSRLKVIARAGTGVDNIDVEVATEKGLLVINTPAANTISAAEHTVALMCSLSRQIPQAHSNMKQGKWDRKLYMGTE--LLHKTLAIIGLGKIGKEVALRAQAFG---MTTIGFDPIIG------NEEAKSFN-----VDWME-LNEIWPIADYISVHVPLIPQTENLINLKTIEKCKPSVKFINCARGGIINEDDLLKSLEMNLCSGAALDVFTEEPPTFNNLIK------HPKLIVTPHLGASTVEAQFRVSMEI 1020
            DA IV +     A I R   + +   LK+   AG G D++D+E A E+ + V     +N +S AEH +A +  L R     H     G+WD       E  L  K ++ +G G+IG  V  R  AF    +    +  +        NE +K FN     V  +E L ++   +D ++++ PL   +  L N K I   K     +N ARG I   +D+ ++++    +G   DV+ ++P   ++  +      H    +T H+  ++++AQ R +  +
Sbjct:   64 DAEIVITTPFFPAYISRNRIA-EAPNLKLCVTAGVGSDHVDLEAANERKITVTEVTGSNVVSVAEHVMATILVLIRNYNGGHQQAINGEWDIAGVAKNEYDLEDKIISTVGAGRIGYRVLERLVAFNPKKLLYYDYQELPAEAINRLNEASKLFNGRGDIVQRVEKLEDMVAQSDVVTINCPLHKDSRGLFNKKLISHMKDGAYLVNTARGAICVAEDVAEAVKSGKLAGYGGDVWDKQPAPKDHPWRTMDNKDHVGNAMTVHISGTSLDAQKRYAQGV 341          
BLAST of D-3-phosphoglycerate dehydrogenase vs. Ensembl Yeast
Match: YGL185C_mRNA (Putative protein with sequence similar to hydroxyacid dehydrogenases; green fluorescent protein (GFP)-fusion protein localizes to the cytoplasm [Source:SGD;Acc:S000003153])

HSP 1 Score: 70.4774 bits (171), Expect = 1.894e-13
Identity = 57/177 (32.20%), Postives = 87/177 (49.15%), Query Frame = 1
Query:  559 KTLAIIGLGKIGKEVALRAQ-AFGM----TTIGFDPIIGNEEAKSFNVDWMELNEIWPIADY----ISVHVPLIPQTENLINLKTIEKCKPSVKFINCARGGIINEDDLLKSLEMNLCSGAALDVFTEEPPTFNNLIKHPKLI-VTPHLGASTVEAQFRVSMEIA-ENLISITKGES 1056
            K   I+GLG IGK+VA + Q   GM         D  +   E+  F++    L+E      Y    I V +P  PQTE+LIN K +E C P +  +N  RG I++   +  +L     +   LDVF +EP     +    +L  +TPHLG++T +  F  S E+A   ++ +  GE+
Sbjct:  198 KKCLILGLGSIGKQVAYKLQYGLGMEIHYCKRSEDCTMSQNESWKFHL----LDETIYAKLYQFHAIVVTLPGTPQTEHLINRKFLEHCNPGLILVNLGRGKILDLRAVSDALVTGRINHLGLDVFNKEPEIDEKIRSSDRLTSITPHLGSATKDV-FEQSCELALTRILRVVSGEA 369          
BLAST of D-3-phosphoglycerate dehydrogenase vs. Ensembl Nematostella
Match: EDO37417 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFV8])

HSP 1 Score: 341.273 bits (874), Expect = 3.521e-110
Identity = 169/324 (52.16%), Postives = 225/324 (69.44%), Query Frame = 1
Query:  112 MNEFKLARILSTDGLDRNGVQALRDFGFDV-VEQKFSKSELIQQLINFDAIIVRSATTIDAEIIRAVTSNDGSRLKVIARAGTGVDNIDVEVATEKGLLVINTPAANTISAAEHTVALMCSLSRQIPQAHSNMKQGKWDRKLYMGTELLHKTLAIIGLGKIGKEVALRAQAFGMTTIGFDPIIGNEEAKSFNVDWMELNEIWPIADYISVHVPLIPQTENLINLKTIEKCKPSVKFINCARGGIINEDDLLKSLEMNLCSGAALDVFTEEPPTFN--NLIKHPKLIVTPHLGASTVEAQFRVSMEIAENLISITKGESIPGSVN 1074
            M   +L R+L +D +D      L   G  V V  K SK EL+ ++  +D +IVRSAT +  ++I+A     G  LK+I RAGTGVDNID   A+  G+LV+NTP  NT+SAAEHT AL+ SL+R IPQA ++ K+GKW+RK +MG EL  KTLAIIGLG+IG+EVALR Q++G+ TIG+DP++  ++A   N++WME  +IWP+ADYI+VHVPLIP T+ ++N KTI  CK  V  +N ARGGII+E+ LL+ LE     GA LDVF  EPPT +  +L+KHPK+I  PHLGAST EAQ RV+ EIA+  +    G+ + G VN
Sbjct:    1 MVSLELKRVLISDSVDSCCKTILERNGVTVDVNTKLSKEELVSEIPKYDGLIVRSATKVSEDVIKA-----GKNLKIIGRAGTGVDNIDTVAASLHGVLVMNTPGGNTLSAAEHTCALISSLARHIPQASASTKEGKWERKQFMGNELFGKTLAIIGLGRIGREVALRMQSYGVKTIGYDPLVSPQDAAESNIEWMETEKIWPLADYITVHVPLIPPTKGMLNDKTIGMCKKGVYILNVARGGIIDEEALLRGLESGHVGGAGLDVFVTEPPTGSSADLVKHPKVIACPHLGASTEEAQRRVAQEIADQFVDGMNGKPLIGLVN 319          
BLAST of D-3-phosphoglycerate dehydrogenase vs. Ensembl Nematostella
Match: EDO43023 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZX5])

HSP 1 Score: 132.88 bits (333), Expect = 9.132e-35
Identity = 87/259 (33.59%), Postives = 137/259 (52.90%), Query Frame = 1
Query:  316 NDGSRLKVIARAGTGVDNIDVEVATEKGLLVINTPAANTISAAEHTVALMCSLSRQIPQAHSNMKQGKWDRKLY--MGTELLHKTLAIIGLGKIGKEVALRAQAFGMTTI--GFDPIIGNEEAKSFNVDWMELNEIWPIADYISVHVPLIPQTENLINLKTIEKCKPSVKFINCARGGIINEDDLLKSLEMNLCSGAALDVFTEEP-PTFNNLIKHPKLIVTPHLGASTVEAQFRVSMEIA-ENLISITKGESIPGSVN 1074
            +D   LKVI+  G G D ID+  AT++G+ V NTP       A+  + L+ + +R I    +N ++  + + ++   GT +   TL I+GLG +G  VA+RA+ F M  +  G     G E          +L+E+   +D++ +   L  +T +LI    + + K S   IN ARGGI+N DDL  +L+  +  GAALDV   EP P  + L+  P +IVTPH+G  T+ A     ME+  ENL++    + +P  +N
Sbjct:   19 DDLPSLKVISSIGAGFDRIDIPAATKRGIRVGNTPGVVQDCTADMAIGLLLASARHIVTGDANTRKPGFTKSIFNCFGTRVTGSTLGIVGLGAVGSAVAMRAKGFKMRILYHGRTRKEGKERETGAE-HCSKLDELLKESDFVVLCCALTKETRHLITAAQLSQMKSSATLINVARGGIVNHDDLTTALQNGVICGAALDVTEPEPLPHGHPLLALPNVIVTPHIGTLTL-ATRSAMMEMGIENLLAGLGSKPLPYPLN 275          
BLAST of D-3-phosphoglycerate dehydrogenase vs. Ensembl Nematostella
Match: EDO32878 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STU2])

HSP 1 Score: 130.183 bits (326), Expect = 6.216e-34
Identity = 83/249 (33.33%), Postives = 133/249 (53.41%), Query Frame = 1
Query:  331 LKVIARAGTGVDNIDVEVATEKGLLVINTPAANTISAAEHTVALMCSLSRQIPQAHSNMKQGKWDRKL---YMGTELLHKTLAIIGLGKIGKEVALRAQAFGMTTIGFDPIIGNEEAKSFNVDWME-LNEIWPIADYISVHVPLIPQTENLINLKTIEKCKPSVKFINCARGGIINEDDLLKSLEMNLCSGAALDVFTEEP-PTFNNLIKHPKLIVTPHLGASTVEAQFRVSMEIAENLISITKGESIP 1062
            LKVI+  G G+DNID+E A  +G+LV NTP  +    A+   AL+ + +R + QA + M++  +       + GT +   TL IIGLG IG  VA RA+ F M  + ++     +      V +   L ++   +DY+ +   L P+T ++I    + + KPS   IN ARGG++N DDL  +L+  +  GAALD    EP P  + L+     IVTPH+ ++T+ A+         N+ +  +G+ +P
Sbjct:   13 LKVISNIGAGIDNIDLEAAKRRGILVGNTPGISD-CLADFAWALLMAAARNVIQADAMMRKPGFKIPSIINWHGTRVSGATLGIIGLGNIGLAVAKRAKGFDMRILYYNRTRKMKAESELGVHYCSGLKDLLKESDYVMLSCALTPETRHIIKSAELSQMKPSATLINVARGGLVNHDDLTTALQNGVIRGAALDATDPEPLPHDHPLLALSNAIVTPHIASATLHARRAYVKNALLNVNAGLRGDPLP 260          
BLAST of D-3-phosphoglycerate dehydrogenase vs. Ensembl Nematostella
Match: EDO47853 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RL06])

HSP 1 Score: 130.954 bits (328), Expect = 1.963e-33
Identity = 82/295 (27.80%), Postives = 152/295 (51.53%), Query Frame = 1
Query:  205 EQKFSKSELIQQLINFDAIIVRSATTIDAEIIRAVTSNDGSRLKVIARAGTGVDNIDVEVATEKGLLVINTPAANTISAAEHTVALMCSLSRQIPQAHSNMKQGKWD--RKLYM-GTELLHKTLAIIGLGKIGKEVALRAQAFGMTTIGFDPIIGNEEA-KSFNVDWMELNEIWPIADYISVHVPLIPQTENLINLKTIEKCKPSVKFINCARGGIINEDDLLKSLEMNLCSGAALDVFTEEP-PTFNNLIKHPKLIVTPHLGASTVEAQFRVSMEIAENLISITKGESIPGSVN 1074
            +    ++EL+++    D + V     +DAE++ A     G +L+V++    G D++  +    + + +  TP   T + A  TVAL+ + SR++ +A   +K G W   + ++M G  L   T+ I+GLG+IG  VA R   FG++ I +       E  K  N   ++ + ++  +D++     L  +T+ + N     K K +  F+N +RGG++N+DDL  +L+ N    A LDV   EP PT + L+  P  ++ PH+G++    +  ++   A NL++  +GE +P   +
Sbjct:   53 DDPIPRAELLKRAQGKDGLYVLLTEKVDAELLDAA----GPQLRVVSTMSVGYDHVTTKELKNRNIPLGYTPNVLTDATATLTVALLLATSRRLIEAVGEVKNGGWSTWKPMWMCGATLRGSTVGIVGLGRIGLAVAQRLLPFGVSKIVYSGWKATPEVEKQVNATHVDNDALFAKSDFVLGCTALTSETQGMFNKDAFSKMKSTAIFVNTSRGGVVNQDDLYDALKDNAIRAAGLDVTVPEPLPTDHKLLSLPNCVILPHIGSAEDATRTEMATLAARNLLAGLRGEKMPAQAD 343          
BLAST of D-3-phosphoglycerate dehydrogenase vs. Ensembl Nematostella
Match: EDO41804 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S382])

HSP 1 Score: 128.257 bits (321), Expect = 1.234e-32
Identity = 85/321 (26.48%), Postives = 167/321 (52.02%), Query Frame = 1
Query:  133 RILSTDGLDRNGVQALRD----FGFDVVEQKFSKSELIQQLINFDAIIVRSATTIDAEIIRAVTSNDGSRLKVIARAGTGVDNIDVEVATEKGLLVINTPAANTISAAEHTVALMCSLSRQIPQAHSNMKQGKWD--RKLYM-GTELLHKTLAIIGLGKIGKEVALRAQAFGMTTIGFDPIIGNEE-AKSFNVDWMELNEIWPIADYISVHVPLIPQTENLINLKTIEKCKPSVKFINCARGGIINEDDLLKSLEMNLCSGAALDVFTEEP-PTFNNLIKHPKLIVTPHLGASTVEAQFRVSMEIAENLISITKGESIPGS 1068
            ++L T  +    +Q L+D      +   ++   ++EL+ ++    AI       IDAE++ A     G +LKV+A    G D+++ +   ++GL +  TP   T + A   VAL+ ++SR+I +A +  K G W   + ++M G  L   T+ ++G G+IG  V  R   FG+    ++ I   E+ +K  +  +++ + ++  +D+I     L  +T+ + N +   K K +  F+N +RGG++N++DL ++L+     GA LDV   EP P  + L+     +V PH+G++    +  ++   + N+++  KG+ +P +
Sbjct:    4 QVLVTRRVPDEAIQLLKDANCQLDYWESDEPIPRNELLNRVKGKHAIFCLLTEKIDAEVLDAC----GPQLKVVATMSVGYDHVNTKEIEKRGLQLGFTPGVLTDATATLNVALLLAVSRRIVEAAAEAKNGGWGTWKPMWMTGATLKGSTVGVVGFGRIGIAVCERLAPFGVCKFLYNDIAPREDVSKHLDAKFVDKDTLYAESDFIIACTVLNEETKGMFNKQVFSKMKKNAIFVNASRGGVVNQEDLYEALKNGEIRGAGLDVTVPEPIPLDHPLLTLKNCVVLPHIGSAEDATRTEMATLTSRNILAGLKGDKLPAA 320          
BLAST of D-3-phosphoglycerate dehydrogenase vs. Ensembl Medaka
Match: phgdh (phosphoglycerate dehydrogenase [Source:NCBI gene;Acc:101158150])

HSP 1 Score: 334.724 bits (857), Expect = 4.393e-106
Identity = 165/327 (50.46%), Postives = 221/327 (67.58%), Query Frame = 1
Query:  109 KMNEFKLARILSTDGLDRNGVQALRDFGFDVVE-QKFSKSELIQQLINFDAIIVRSATTIDAEIIRAVTSNDGSRLKVIARAGTGVDNIDVEVATEKGLLVINTPAANTISAAEHTVALMCSLSRQIPQAHSNMKQGKWDRKLYMGTELLHKTLAIIGLGKIGKEVALRAQAFGMTTIGFDPIIGNEEAKSFNVDWMELNEIWPIADYISVHVPLIPQTENLINLKTIEKCKPSVKFINCARGGIINEDDLLKSLEMNLCSGAALDVFTEEPPTFNNLIKHPKLIVTPHLGASTVEAQFRVSMEIAENLISITKGESIPGSVNGHAI 1086
            KM    +  +L ++ +D      L + G  V E Q   K ELI ++  +D ++VRSAT + A+II A  +     LK+I RAGTGVDN+DV  AT KG++V+NTP+ NTISAAE T AL+ SLSR +PQA  +MK+G WDRK +MG+EL  K L I+GLG+IGKEVA R QAFGM T+G+DPI   E + S+ V+ M L ++WP+ DYI+VH PL+P T  L+N  T  KCK  VK +NCARGGII+E  LL++LE   C GA LDVF EEPP   +L+ HP +I  PHLGAST EAQ R   +IA+ ++ + KG+++ G+VN   +
Sbjct:   50 KMAPTSIKSVLISESVDPRCRAILEENGILVTEKQNMKKEELIAEIGLYDGLVVRSATKVTADIISAAHN-----LKIIGRAGTGVDNVDVNAATHKGIIVMNTPSGNTISAAELTCALLMSLSRNVPQAVMSMKEGNWDRKKFMGSELYGKVLGIVGLGRIGKEVATRMQAFGMKTVGYDPITPLEVSASWGVEQMSLEQLWPLCDYITVHTPLMPSTVGLLNDNTFAKCKKGVKVVNCARGGIIDEAALLRALESGQCGGAGLDVFNEEPPKNRSLVDHPNVISCPHLGASTKEAQARCGEDIAQQIVDMVKGKNLVGAVNAQVL 371          
BLAST of D-3-phosphoglycerate dehydrogenase vs. Ensembl Medaka
Match: phgdh (phosphoglycerate dehydrogenase [Source:NCBI gene;Acc:101158150])

HSP 1 Score: 329.331 bits (843), Expect = 6.233e-106
Identity = 163/322 (50.62%), Postives = 219/322 (68.01%), Query Frame = 1
Query:  112 MNEFKLARILSTDGLDRNGVQALRDFGFDVVE-QKFSKSELIQQLINFDAIIVRSATTIDAEIIRAVTSNDGSRLKVIARAGTGVDNIDVEVATEKGLLVINTPAANTISAAEHTVALMCSLSRQIPQAHSNMKQGKWDRKLYMGTELLHKTLAIIGLGKIGKEVALRAQAFGMTTIGFDPIIGNEEAKSFNVDWMELNEIWPIADYISVHVPLIPQTENLINLKTIEKCKPSVKFINCARGGIINEDDLLKSLEMNLCSGAALDVFTEEPPTFNNLIKHPKLIVTPHLGASTVEAQFRVSMEIAENLISITKGESIPGSVN 1074
            M    +  +L ++ +D      L + G  V E Q   K ELI ++  +D ++VRSAT + A+II A  +     LK+I RAGTGVDN+DV  AT KG++V+NTP+ NTISAAE T AL+ SLSR +PQA  +MK+G WDRK +MG+EL  K L I+GLG+IGKEVA R QAFGM T+G+DPI   E + S+ V+ M L ++WP+ DYI+VH PL+P T  L+N  T  KCK  VK +NCARGGII+E  LL++LE   C GA LDVF EEPP   +L+ HP +I  PHLGAST EAQ R   +IA+ ++ + KG+++ G+V+
Sbjct:    1 MAPTSIKSVLISESVDPRCRAILEENGILVTEKQNMKKEELIAEIGLYDGLVVRSATKVTADIISAAHN-----LKIIGRAGTGVDNVDVNAATHKGIIVMNTPSGNTISAAELTCALLMSLSRNVPQAVMSMKEGNWDRKKFMGSELYGKVLGIVGLGRIGKEVATRMQAFGMKTVGYDPITPLEVSASWGVEQMSLEQLWPLCDYITVHTPLMPSTVGLLNDNTFAKCKKGVKVVNCARGGIIDEAALLRALESGQCGGAGLDVFNEEPPKNRSLVDHPNVISCPHLGASTKEAQARCGEDIAQQIVDMVKGKNLVGAVS 317          
BLAST of D-3-phosphoglycerate dehydrogenase vs. Ensembl Medaka
Match: grhpra (glyoxylate reductase/hydroxypyruvate reductase [Source:NCBI gene;Acc:101154959])

HSP 1 Score: 137.117 bits (344), Expect = 2.311e-35
Identity = 88/290 (30.34%), Postives = 152/290 (52.41%), Query Frame = 1
Query:  205 EQKFSKSELIQQLINFDAIIVRSATTIDAEIIRAVTSNDGSRLKVIARAGTGVDNIDVEVATEKGLLVINTPAANTISAAEHTVALMCSLSRQIPQAHSNMKQGKWD--RKLYM-GTELLHKTLAIIGLGKIGKEVALRAQAFGMTTIGFDPIIGNEEAKSFNVDWMELNEIWPIADYISVHVPLIPQTENLINLKTIEKCKPSVKFINCARGGIINEDDLLKSLEMNLCSGAALDVFTEEP-PTFNNLIKHPKLIVTPHLGASTVEAQFRVSMEIAENLISITKGESIP 1062
            ++   +SEL++ +     ++   +  ID E++ A     G  LKVI+    G D++ +    ++G+ V  TP   T + AE TVAL+ + SR++P+    +K G W   + L++ G  L   T+ IIGLG+IG  +A R   FG+  + +        A   N +++ L+ +   +D+I V   L P+T+ L +     K K +  FIN +RG ++N++DL  +L     + A LDV T EP PT + L+     +V PH+G++T   +  +S   A+NL+   +G  +P
Sbjct:   38 DEPVPRSELLKGVQGAHGLLCLLSDKIDQEVLDAA----GPNLKVISTMSVGFDHLVLSEIKKRGIRVGYTPDVLTDATAELTVALLLATSRRLPEGVEEVKSGGWSSWKPLWLCGYGLSGSTVGIIGLGRIGMAIAQRLLPFGVKRLLYSGRTAKSYAAEVNGEFVPLDTLTSESDFIVVSCSLTPETQGLCDKAFFSKMKKNAIFINSSRGAVVNQEDLYDALSSGQIAAAGLDVTTPEPLPTNHPLLTLKNCVVLPHIGSATYSTRGVMSALAAQNLLGGLQGSDMP 323          
BLAST of D-3-phosphoglycerate dehydrogenase vs. Ensembl Medaka
Match: grhprb (glyoxylate reductase/hydroxypyruvate reductase [Source:NCBI gene;Acc:101163636])

HSP 1 Score: 133.65 bits (335), Expect = 8.848e-34
Identity = 92/322 (28.57%), Postives = 173/322 (53.73%), Query Frame = 1
Query:  127 LARILSTDGLDRNGVQALRDFG---FDVV---EQKFSKSELIQQLINFDAIIVRSATTIDAEIIRAVTSNDGSRLKVIARAGTGVDNIDVEVATEKGLLVINTPAANTISAAEHTVALMCSLSRQIPQAHSNMKQGKWD--RKLYM-GTELLHKTLAIIGLGKIGKEVALRAQAFGMTTIGFDPIIGNEE-AKSFNVDWMELNEIWPIADYISVHVPLIPQTENLINLKTIEKCKPSVKFINCARGGIINEDDLLKSLEMNLCSGAALDVFTEEP-PTFNNLIKHPKLIVTPHLGASTVEAQFRVSMEIAENLISITKGESI 1059
            L R+  T  +   G++ L++ G   F++    +    ++EL++++   D ++      IDAE++     + G  LKV++    G D++ ++   ++G+ V  TP   T + AE TVAL+ + SR++ +A    K G W   R L++ G EL + T+ I+GLG+IG  +A R   F +    +  +    E A++ N +++  +E+   +D+++V   L P+T+ + N +   K K +  FIN +RGG++N++DL ++L     +GA LDV   EP PT + L      ++ PH+ +++   +  +S   A NL+   +GE +
Sbjct:   36 LQRVYVTRQIPPEGLKILKESGQVQFELWGSDDVPVPRAELLKKVKGVDGLLCVLTEKIDAELL----DSAGPNLKVLSTMSVGFDHLSLDELKKRGIRVGYTPEVLTDAVAELTVALLLTTSRRLIEATHEAKTGGWGTWRTLWLCGHELANSTVGILGLGRIGVAIAERLAPFKVKKFIYTDVAPRPELARAINAEYVSFDELAKQSDFLAVCCALTPETKEICNKELFSKMKNTSIFINTSRGGVVNQEDLYEALAAGQIAGAGLDVTVPEPLPTNHPLFTLKNCVILPHIASASYTTRNAMSALAANNLLLGLRGEPM 353          
BLAST of D-3-phosphoglycerate dehydrogenase vs. Ensembl Medaka
Match: ctbp1 (C-terminal-binding protein 1 [Source:NCBI gene;Acc:101158706])

HSP 1 Score: 135.191 bits (339), Expect = 1.078e-33
Identity = 87/257 (33.85%), Postives = 139/257 (54.09%), Query Frame = 1
Query:  331 LKVIARAGTGVDNIDVEVATEKGLLVINTPAANTISAAEHTVALMCSLSRQIPQAHSNMKQGKWD------RKLYMGTELLH-KTLAIIGLGKIGKEVALRAQAFGMTTIGFDPIIGNEEAKSFNVDWME-LNEIWPIADYISVHVPLIPQTENLINLKTIEKCKPSVKFINCARGGIINEDDLLKSLEMNLCSGAALDVFTEEPPTFNN--LIKHPKLIVTPHLGASTVEAQFRVSMEIAENLISITKGESIPGSV 1071
            L+VI R G+G DN+DV+ A E G+ V N PAA+    A+ ++ L+ +L R++   H  +++G         R++  G   +  +TL IIGLG++G+ VALRA+AFG   I +DP + +   +S  +  M  L ++   +D +S+H  L     +LIN  TI++ +     +N +RGG+++E  L ++L+     GAALDV   EP +F+   L   P LI TPH    + +A      E A  +     G  IP S+
Sbjct:   99 LRVIVRIGSGFDNVDVKAAAELGIAVCNVPAASVEETADTSLCLILNLYRRVTWMHQALREGTRASSVEQIREVAGGAARIRGETLGIIGLGRVGQAVALRAKAFGFGVIFYDPYLPDGVERSLGLQRMATLQDLLIHSDCVSLHCSLNEHNHHLINDFTIKQMRQGAFLVNTSRGGLVDEKALAQALKEGRIRGAALDVHEAEPFSFSTGPLKDAPNLICTPHTAWYSEQASVEAREEAAREVRRAITGR-IPDSL 354          
BLAST of D-3-phosphoglycerate dehydrogenase vs. Planmine SMEST
Match: SMESG000048075.1 (SMESG000048075.1)

HSP 1 Score: 1028.85 bits (2659), Expect = 0.000e+0
Identity = 515/520 (99.04%), Postives = 517/520 (99.42%), Query Frame = 1
Query:  112 MNEFKLARILSTDGLDRNGVQALRDFGFDVVEQKFSKSELIQQLINFDAIIVRSATTIDAEIIRAVTSNDGSRLKVIARAGTGVDNIDVEVATEKGLLVINTPAANTISAAEHTVALMCSLSRQIPQAHSNMKQGKWDRKLYMGTELLHKTLAIIGLGKIGKEVALRAQAFGMTTIGFDPIIGNEEAKSFNVDWMELNEIWPIADYISVHVPLIPQTENLINLKTIEKCKPSVKFINCARGGIINEDDLLKSLEMNLCSGAALDVFTEEPPTFNNLIKHPKLIVTPHLGASTVEAQFRVSMEIAENLISITKGESIPGSVNGHAIEMSNXXXXXXXXXXXTKISPILKNYDIVELSYKDNYEFCSNRAIENFIKSYLAMEILKLRNVGSSINLINSMKMALGKNLTIVLRKMEEIDSCLLPKLAVKVGKDVMVVTLMKERLFLTKFNEIEIFPPVFIGSRGHLLIVSDDAKAHDILCQSNHNSDNSLINYSYQQENHFHIFIMKRLKEKIAEDVKLSLQI 1671
            MNEFKLARILSTDGLDRNGVQALRDFGFDVVEQKFSKSELIQQLINFDAIIVRSATTIDAEIIRAVTS DGSRLKVIARAGTGVDNIDVEVATEKGLLVINTPAANTISAAEHTVALMCSLSRQIPQAHSNMKQGKWDRKLYMGTELLHKTLAIIGLGKIGKEVALRAQAFGMTTIGFDPIIGNEEAKSFNVDWMELNEIWPIADYISVHVPLIPQTENLINLKTIEKCKPSVKFINCARGGIINEDDLLKSLEMNLCSGAALDVFTEEPPTFNNLIKHPKLIVTPHLGASTVEAQFRVSMEIAENLISITKGESIPGSVNGHAIE SNLKQIQLLKILLTKISPILKNYDIVELSYKDNYEFCSNRA+ENFIKSYLAMEILKLRNVGSSINLINSMKMALGKNLTIVLRKM+E DSCLLPKLAVKVGKDVMVVTLMKERLFLTKFNEIEIFPPVFIGSRGHLLIVSDDAKAHDILCQSNHNSDNSLINYSYQQENHFHIFIMKRLKEKIAEDVKLSLQI
Sbjct:    1 MNEFKLARILSTDGLDRNGVQALRDFGFDVVEQKFSKSELIQQLINFDAIIVRSATTIDAEIIRAVTSYDGSRLKVIARAGTGVDNIDVEVATEKGLLVINTPAANTISAAEHTVALMCSLSRQIPQAHSNMKQGKWDRKLYMGTELLHKTLAIIGLGKIGKEVALRAQAFGMTTIGFDPIIGNEEAKSFNVDWMELNEIWPIADYISVHVPLIPQTENLINLKTIEKCKPSVKFINCARGGIINEDDLLKSLEMNLCSGAALDVFTEEPPTFNNLIKHPKLIVTPHLGASTVEAQFRVSMEIAENLISITKGESIPGSVNGHAIETSNLKQIQLLKILLTKISPILKNYDIVELSYKDNYEFCSNRALENFIKSYLAMEILKLRNVGSSINLINSMKMALGKNLTIVLRKMDEKDSCLLPKLAVKVGKDVMVVTLMKERLFLTKFNEIEIFPPVFIGSRGHLLIVSDDAKAHDILCQSNHNSDNSLINYSYQQENHFHIFIMKRLKEKIAEDVKLSLQI 520          
BLAST of D-3-phosphoglycerate dehydrogenase vs. Planmine SMEST
Match: SMESG000039168.1 (SMESG000039168.1)

HSP 1 Score: 127.102 bits (318), Expect = 7.181e-31
Identity = 89/258 (34.50%), Postives = 130/258 (50.39%), Query Frame = 1
Query:  331 LKVIARAGTGVDNIDVEVATEKGLLVINTPAANTISAAEHTVALMCSLSRQIPQAHSNMKQGKWDRKLYMGTELLHK-----------TLAIIGLGKIGKEVALRAQAFGMTTIGFDPIIGNEEAKSFNVDWM-ELNEIWPIADYISVHVPLIPQTENLINLKTIEKCKPSVKFINCARGGIINEDDLLKSLEMNLCSGAALDVFTEEPPTF--NNLIKHPKLIVTPHLGASTVEAQFRVSMEIAENLISITKGESIP 1062
            LKVI R G+G DNID++ A E G+ V N P       A+ T+ ++ +L R+     + +K+GK       G E+L             TL IIG G++G  VA+RAQAFG     +DP + +   +S  ++ +  L ++   +D +S+H  L  QT+ LIN  T++  +P    +N ARGG+I+E  L   L+       ALDV   EP     ++L   P +IVTPH  A   EA FR   E A N +       IP
Sbjct:   80 LKVIVRIGSGYDNIDIKAAGELGIAVCNVPGYGVEETADSTLCMILNLYRRTYWLANIVKEGKR----IAGPEMLKDAAAGCARIRGDTLGIIGFGRVGTAVAMRAQAFGFRVCFYDPYVPDGVERSMGIERVYTLQDLLYQSDCVSLHCSLNDQTKKLINDHTLKMMRPGAFLVNTARGGLIDELALANHLKDGRIRAVALDVVENEPFVLADSHLRDAPNVIVTPH-SAYFSEASFRELREAAANEVRRAITTRIP 332          
BLAST of D-3-phosphoglycerate dehydrogenase vs. Planmine SMEST
Match: SMESG000039168.1 (SMESG000039168.1)

HSP 1 Score: 127.102 bits (318), Expect = 7.366e-31
Identity = 89/258 (34.50%), Postives = 130/258 (50.39%), Query Frame = 1
Query:  331 LKVIARAGTGVDNIDVEVATEKGLLVINTPAANTISAAEHTVALMCSLSRQIPQAHSNMKQGKWDRKLYMGTELLHK-----------TLAIIGLGKIGKEVALRAQAFGMTTIGFDPIIGNEEAKSFNVDWM-ELNEIWPIADYISVHVPLIPQTENLINLKTIEKCKPSVKFINCARGGIINEDDLLKSLEMNLCSGAALDVFTEEPPTF--NNLIKHPKLIVTPHLGASTVEAQFRVSMEIAENLISITKGESIP 1062
            LKVI R G+G DNID++ A E G+ V N P       A+ T+ ++ +L R+     + +K+GK       G E+L             TL IIG G++G  VA+RAQAFG     +DP + +   +S  ++ +  L ++   +D +S+H  L  QT+ LIN  T++  +P    +N ARGG+I+E  L   L+       ALDV   EP     ++L   P +IVTPH  A   EA FR   E A N +       IP
Sbjct:   79 LKVIVRIGSGYDNIDIKAAGELGIAVCNVPGYGVEETADSTLCMILNLYRRTYWLANIVKEGKR----IAGPEMLKDAAAGCARIRGDTLGIIGFGRVGTAVAMRAQAFGFRVCFYDPYVPDGVERSMGIERVYTLQDLLYQSDCVSLHCSLNDQTKKLINDHTLKMMRPGAFLVNTARGGLIDELALANHLKDGRIRAVALDVVENEPFVLADSHLRDAPNVIVTPH-SAYFSEASFRELREAAANEVRRAITTRIP 331          
BLAST of D-3-phosphoglycerate dehydrogenase vs. Planmine SMEST
Match: SMESG000004374.1 (SMESG000004374.1)

HSP 1 Score: 123.25 bits (308), Expect = 1.165e-30
Identity = 88/322 (27.33%), Postives = 159/322 (49.38%), Query Frame = 1
Query:  133 RILSTDGLDRNGVQALRDFGFDV----VEQKFSKSELIQQLINFDAIIVRSATTIDAEIIRAVTSNDGSRLKVIARAGTGVDNIDVEVATEKGLLVINTPAANTISAAEHTVALMCSLSRQIPQAHSNMKQGKWD--RKLYM-GTELLHKTLAIIGLGKIGKEVALRAQAFGM-TTIGFDPIIGNEEAK---SFNVDWMELNEIWPIADYISVHVPLIPQTENLINLKTIEKCKPSVKFINCARGGIINEDDLLKSLEMNLCSGAALDVFTEEP-PTFNNLIKHPKLIVTPHLGASTVEAQFRVSMEIAENLISITKGESIP 1062
            ++  T     + +++++  GF V     +++ +   +IQ   + D ++   +  ID   I     N    LK+I     G D+IDV  A +K + +  TP     + AE  + L+ ++SR++ +    +  G W   +  ++ G EL +  + ++G G IG+ +A R  AFG+ + I  D   G  E K   +  V  +   E+   +D++ V   L  +T ++ N     K K +   +N +RG +I++D LLK+L     +GA LDV   EP PT + L+K P  ++ PHLG++T E +  +     +NLI   +G+ +P
Sbjct:    2 KVFVTRKFPHDAIESIKKAGFTVDMWDSDEQVNYEYMIQHSEDVDGLLCTLSDKIDEHFI-----NSTKNLKLIVTMSVGFDHIDVTAAHQKNIKIGYTPGDLGDAIAELAIGLLLTVSRRLLEGIKAVSSGSWTTWKPFWLCGVELRNSVVGVVGFGNIGRGIAKRVNAFGVKSVIASDKPGGPTEVKIEPNVLVHIVSFYELLEKSDFVIVACNLNDKTRHMFNEAAFGKMKRNAILVNISRGPVIDQDALLKALTEKKIAGAGLDVCVPEPIPTDHPLLKLPNCVILPHLGSATFETRNEMCHVAIDNLIKGLQGKDMP 318          
BLAST of D-3-phosphoglycerate dehydrogenase vs. Planmine SMEST
Match: SMESG000004379.1 (SMESG000004379.1)

HSP 1 Score: 119.783 bits (299), Expect = 1.921e-29
Identity = 93/323 (28.79%), Postives = 158/323 (48.92%), Query Frame = 1
Query:  127 LARILSTDGLDRNGVQALRDFGFDV----VEQKFSKSELIQQLINFDAIIVRSATTIDAEIIRAVTSNDGSRLKVIARAGTGVDNIDVEVATEKGLLVINTPAANTISAAEHTVALMCSLSRQIPQAHSNMKQGKWD--RKLYM-GTELLHKTLAIIGLGKIGKEVALRAQAFGMTTI-------GFDPIIGNEEAKSFNVDWMELNEIWPIADYISVHVPLIPQTENLINLKTIEKCKPSVKFINCARGGIINEDDLLKSLEMNLCSGAALDVFTEEP-PTFNNLIKHPKLIVTPHLGASTVEAQFRVSMEIAENLISITKG 1050
            + ++  T       +Q ++D GF V      +    + +I +  + D II      I  E I     N    LKVI+    G D+I+   A ++ + +  TP   T + AE  + L+ S+SR++ +  ++++ G W   +  +M G  L    + I+GLG IGK +A R  +FG+  +         D +I   E+K   V+ +  +E+   +D+I V   L   T++L N K  +K K +   IN +RG ++N+D L K+L     +GA LDV   EP P  + L+K    I+ PH+G++T+E +  +     ENLI   +G
Sbjct:    1 MQKVFITRQFPNAALQLIKDAGFIVNMWDSSEPVEYNYMIDKSKDIDGIICTINDKISDEFI-----NSSKNLKVISTMSVGFDHINQSAAQKRNIRIGYTPEVLTDATAELAIGLLLSVSRRLIEGVNSVRGGTWGAWKPFWMCGYGLKDSVVGIVGLGSIGKAIAKRVNSFGVKKLLASGSEKPKDKLIVEIESKVL-VNKVCFDELIACSDFIIVSCSLNENTKDLFNEKAFDKMKKNAILINISRGPVVNQDSLCKALIEGKIAGAGLDVCYPEPLPIDHPLLKLTNCIILPHIGSATIETRNEMCKVAVENLIKGLQG 317          
The following BLAST results are available for this feature:
BLAST of D-3-phosphoglycerate dehydrogenase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PHGDH4.254e-11152.34phosphoglycerate dehydrogenase [Source:HGNC Symbol... [more]
PHGDH5.906e-11052.34phosphoglycerate dehydrogenase [Source:HGNC Symbol... [more]
PHGDH7.279e-11052.34phosphoglycerate dehydrogenase [Source:HGNC Symbol... [more]
PHGDH8.706e-11052.34phosphoglycerate dehydrogenase [Source:HGNC Symbol... [more]
PHGDH8.706e-11052.34phosphoglycerate dehydrogenase [Source:HGNC Symbol... [more]
back to top
BLAST of D-3-phosphoglycerate dehydrogenase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
C31C9.29.235e-11154.07pep chromosome:WBcel235:II:13636929:13638480:-1 ge... [more]
ctbp-11.337e-2834.07C-terminal-binding protein 1 [Source:UniProtKB/Sw... [more]
ctbp-13.417e-2834.07C-terminal-binding protein 1 [Source:UniProtKB/Sw... [more]
back to top
BLAST of D-3-phosphoglycerate dehydrogenase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG62872.100e-10350.61gene:FBgn0032350 transcript:FBtr0080222[more]
CtBP1.538e-3032.81gene:FBgn0020496 transcript:FBtr0334513[more]
CG316741.715e-3025.77gene:FBgn0051674 transcript:FBtr0339563[more]
CG316741.715e-3025.77gene:FBgn0051674 transcript:FBtr0081423[more]
CtBP2.308e-3032.81gene:FBgn0020496 transcript:FBtr0334516[more]
back to top
BLAST of D-3-phosphoglycerate dehydrogenase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
phgdh3.876e-10950.61phosphoglycerate dehydrogenase [Source:ZFIN;Acc:ZD... [more]
grhprb5.276e-3829.50glyoxylate reductase/hydroxypyruvate reductase b [... [more]
grhprb4.664e-3528.61glyoxylate reductase/hydroxypyruvate reductase b [... [more]
grhprb4.664e-3528.61glyoxylate reductase/hydroxypyruvate reductase b [... [more]
grhpra6.626e-3527.30glyoxylate reductase/hydroxypyruvate reductase a [... [more]
back to top
BLAST of D-3-phosphoglycerate dehydrogenase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
phgdh5.556e-10851.68major histocompatibility complex class I antigen ... [more]
phgdh1.012e-10751.68major histocompatibility complex class I antigen ... [more]
phgdh1.339e-10751.68major histocompatibility complex class I antigen ... [more]
phgdh2.089e-10355.71major histocompatibility complex class I antigen ... [more]
phgdh4.012e-10350.46major histocompatibility complex class I antigen ... [more]
back to top
BLAST of D-3-phosphoglycerate dehydrogenase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Phgdh5.405e-11152.653-phosphoglycerate dehydrogenase [Source:MGI Symbo... [more]
Phgdh2.150e-4857.553-phosphoglycerate dehydrogenase [Source:MGI Symbo... [more]
Grhpr8.868e-3728.88glyoxylate reductase/hydroxypyruvate reductase [So... [more]
Ctbp19.226e-3231.52C-terminal binding protein 1 [Source:MGI Symbol;Ac... [more]
Ctbp15.299e-3131.52C-terminal binding protein 1 [Source:MGI Symbol;Ac... [more]
back to top
BLAST of D-3-phosphoglycerate dehydrogenase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O08651|SERA_RAT5.071e-11153.27D-3-phosphoglycerate dehydrogenase OS=Rattus norve... [more]
sp|Q61753|SERA_MOUSE3.781e-11052.65D-3-phosphoglycerate dehydrogenase OS=Mus musculus... [more]
sp|O43175|SERA_HUMAN4.181e-10952.34D-3-phosphoglycerate dehydrogenase OS=Homo sapiens... [more]
sp|Q60HD7|SERA_MACFA5.121e-10952.34D-3-phosphoglycerate dehydrogenase OS=Macaca fasci... [more]
sp|A5A6P1|SERA_PANTR6.408e-10952.34D-3-phosphoglycerate dehydrogenase OS=Pan troglody... [more]
back to top
BLAST of D-3-phosphoglycerate dehydrogenase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
V4AA631.216e-12457.94D-3-phosphoglycerate dehydrogenase OS=Lottia gigan... [more]
A0A2R5L6U85.791e-12144.98D-3-phosphoglycerate dehydrogenase OS=Ornithodoros... [more]
B7P3M86.007e-12054.43D-3-phosphoglycerate dehydrogenase (Fragment) OS=I... [more]
A0A4D5S7F61.716e-11954.43D-3-phosphoglycerate dehydrogenase (Fragment) OS=I... [more]
A0A131Y3N11.806e-11954.43D-3-phosphoglycerate dehydrogenase OS=Ixodes ricin... [more]
back to top
BLAST of D-3-phosphoglycerate dehydrogenase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
phgdh5.979e-10750.46phosphoglycerate dehydrogenase [Source:NCBI gene;A... [more]
grhprb1.057e-3529.72glyoxylate reductase/hydroxypyruvate reductase b [... [more]
grhpra2.864e-3428.37glyoxylate and hydroxypyruvate reductase [Source:N... [more]
ctbp13.268e-3434.24C-terminal-binding protein 1 [Source:NCBI gene;Acc... [more]
ctbp13.268e-3434.24C-terminal-binding protein 1 [Source:NCBI gene;Acc... [more]
back to top
BLAST of D-3-phosphoglycerate dehydrogenase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
phgdh3.415e-11052.00phosphoglycerate dehydrogenase [Source:ZFIN;Acc:ZD... [more]
grhpra1.670e-3328.42glyoxylate reductase/hydroxypyruvate reductase a [... [more]
back to top
BLAST of D-3-phosphoglycerate dehydrogenase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
SER31.204e-3929.823-phosphoglycerate dehydrogenase and alpha-ketoglu... [more]
SER331.988e-3930.213-phosphoglycerate dehydrogenase and alpha-ketoglu... [more]
GOR11.493e-2528.11Glyoxylate reductase; null mutation results in inc... [more]
FDH13.518e-1826.16NAD(+)-dependent formate dehydrogenase; may protec... [more]
YGL185C_mRNA1.894e-1332.20Putative protein with sequence similar to hydroxya... [more]
back to top
BLAST of D-3-phosphoglycerate dehydrogenase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO374173.521e-11052.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO430239.132e-3533.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO328786.216e-3433.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO478531.963e-3327.80Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO418041.234e-3226.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of D-3-phosphoglycerate dehydrogenase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
phgdh4.393e-10650.46phosphoglycerate dehydrogenase [Source:NCBI gene;A... [more]
phgdh6.233e-10650.62phosphoglycerate dehydrogenase [Source:NCBI gene;A... [more]
grhpra2.311e-3530.34glyoxylate reductase/hydroxypyruvate reductase [So... [more]
grhprb8.848e-3428.57glyoxylate reductase/hydroxypyruvate reductase [So... [more]
ctbp11.078e-3333.85C-terminal-binding protein 1 [Source:NCBI gene;Acc... [more]
back to top
BLAST of D-3-phosphoglycerate dehydrogenase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000048075.10.000e+099.04SMESG000048075.1[more]
SMESG000039168.17.181e-3134.50SMESG000039168.1[more]
SMESG000039168.17.366e-3134.50SMESG000039168.1[more]
SMESG000004374.11.165e-3027.33SMESG000004374.1[more]
SMESG000004379.11.921e-2928.79SMESG000004379.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027938 ID=SMED30027938|Name=D-3-phosphoglycerate dehydrogenase|organism=Schmidtea mediterranea sexual|type=transcript|length=2029bp
ATCTATCAAAGTGCAATTTAAAATTTTTATACACATTGATAAAAATTTAA
CAACTTTGATTGGTTGAAAAAACATATTAATGATTTCTAAAATGTTTTTA
ATTATTTTAAAATGAATGAATTCAAATTAGCAAGGATTTTGTCCACAGAC
GGATTGGACAGAAATGGAGTCCAGGCACTCAGAGACTTTGGATTTGATGT
TGTTGAACAGAAGTTTTCGAAATCTGAACTGATCCAACAGCTGATCAACT
TCGATGCCATTATAGTCAGATCGGCCACAACAATTGATGCGGAAATAATT
CGTGCTGTAACAAGTAATGATGGAAGCCGATTAAAAGTTATCGCAAGAGC
TGGGACTGGAGTTGATAATATTGACGTTGAAGTTGCGACGGAAAAAGGTT
TATTGGTAATTAATACTCCAGCAGCAAATACAATTTCTGCCGCTGAACAC
ACAGTAGCATTGATGTGTAGTCTTAGTCGGCAAATTCCACAGGCACATTC
AAACATGAAACAAGGGAAATGGGACAGAAAACTATATATGGGAACTGAGT
TATTGCATAAGACCTTAGCAATAATCGGATTGGGTAAAATTGGAAAAGAA
GTTGCATTGAGAGCTCAGGCTTTCGGAATGACAACTATTGGGTTTGATCC
AATCATTGGAAATGAAGAAGCAAAGTCATTTAACGTGGACTGGATGGAAT
TGAATGAAATTTGGCCAATTGCTGATTATATATCTGTTCATGTTCCTTTG
ATTCCTCAAACAGAAAACCTGATAAACTTGAAAACAATTGAAAAATGTAA
ACCAAGCGTAAAATTTATTAATTGTGCCAGAGGTGGAATCATTAATGAAG
ACGATTTATTGAAGTCTCTTGAAATGAATTTGTGCAGTGGAGCAGCATTG
GATGTTTTCACTGAAGAGCCACCGACTTTCAATAATTTAATCAAACATCC
AAAGCTGATTGTCACTCCTCACCTAGGTGCTAGCACTGTAGAAGCTCAAT
TCCGCGTTTCTATGGAAATAGCAGAAAATCTCATATCTATTACTAAAGGT
GAATCGATTCCTGGATCTGTCAACGGGCACGCAATTGAAATGTCAAATTT
GAAACAAATACAGCTTTTGAAAATTCTTTTAACGAAAATCAGTCCAATTT
TGAAGAATTACGACATAGTCGAACTGTCGTATAAGGATAACTATGAATTT
TGCTCTAATCGAGCTATAGAAAATTTCATCAAAAGCTATTTAGCCATGGA
GATTCTGAAATTGAGAAATGTCGGTTCTTCCATAAATCTAATAAACTCTA
TGAAAATGGCATTGGGAAAAAATTTAACTATCGTTTTGAGAAAAATGGAG
GAAATAGATTCATGCCTACTACCTAAGCTAGCGGTAAAAGTTGGAAAGGA
TGTCATGGTGGTAACATTAATGAAAGAGAGATTATTTTTGACGAAATTTA
ATGAAATTGAGATTTTCCCACCAGTTTTTATTGGAAGCAGGGGACATTTA
TTAATTGTTTCAGATGATGCCAAAGCTCACGATATTTTATGTCAATCAAA
TCATAATAGTGATAACAGCCTGATTAATTATTCCTATCAGCAAGAAAACC
ATTTCCATATTTTTATTATGAAAAGGCTCAAGGAAAAGATCGCTGAGGAT
GTGAAGTTATCCCTCCAAATTTGAAAGCTGATTTTTAATTGAATAAATAT
ATCAAATAAATATCTTTCATAGAAAAATTACAGTTTTTATCTATTTATCT
TACAAAATGAATATTTAATAAAGAAGGGCCCCCAACTTGTGCGTCGTGAA
TTTAACTATTTCCAATTTGAAAGTTACTAAATTCTAATGTGAATAGGCTA
CTCTTTTGTGGTTCCTTACTATCATTCTGTTGCTACAACTCTGACTACTG
GAAAAATACAGCGAAGTTGGAGTAACCTGAACAATTTTGTTGTTGGGATC
AACGCAGCTTGGAAAATGCTATCAAAGAGTAAAAACGAGAAAGGTTGGAA
ATCGATGTATAAAAGGATAGATCGGAAGA
back to top

protein sequence of SMED30027938-orf-1

>SMED30027938-orf-1 ID=SMED30027938-orf-1|Name=SMED30027938-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=521bp
MNEFKLARILSTDGLDRNGVQALRDFGFDVVEQKFSKSELIQQLINFDAI
IVRSATTIDAEIIRAVTSNDGSRLKVIARAGTGVDNIDVEVATEKGLLVI
NTPAANTISAAEHTVALMCSLSRQIPQAHSNMKQGKWDRKLYMGTELLHK
TLAIIGLGKIGKEVALRAQAFGMTTIGFDPIIGNEEAKSFNVDWMELNEI
WPIADYISVHVPLIPQTENLINLKTIEKCKPSVKFINCARGGIINEDDLL
KSLEMNLCSGAALDVFTEEPPTFNNLIKHPKLIVTPHLGASTVEAQFRVS
MEIAENLISITKGESIPGSVNGHAIEMSNLKQIQLLKILLTKISPILKNY
DIVELSYKDNYEFCSNRAIENFIKSYLAMEILKLRNVGSSINLINSMKMA
LGKNLTIVLRKMEEIDSCLLPKLAVKVGKDVMVVTLMKERLFLTKFNEIE
IFPPVFIGSRGHLLIVSDDAKAHDILCQSNHNSDNSLINYSYQQENHFHI
FIMKRLKEKIAEDVKLSLQI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002075pigment cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036291NAD(P)-bd_dom_sf
IPR029752D-isomer_DH_CS1
IPR006139D-isomer_2_OHA_DH_cat_dom
IPR016040NAD(P)-bd_dom
IPR006140D-isomer_DH_NAD-bd
Vocabulary: biological process
TermDefinition
GO:0008152metabolic process
GO:0055114oxidation-reduction process
GO:0006564L-serine biosynthetic process
GO:0008652cellular amino acid biosynthetic process
Vocabulary: molecular function
TermDefinition
GO:0051287NAD binding
GO:0016616oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
GO:0004617phosphoglycerate dehydrogenase activity
GO:0016491oxidoreductase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006140D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding domainPFAMPF028262-Hacid_dh_Ccoord: 115..289
e-value: 6.8E-55
score: 185.2
IPR006139D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domainPFAMPF003892-Hacid_dhcoord: 10..321
e-value: 1.4E-31
score: 109.5
NoneNo IPR availableGENE3DG3DSA:3.40.50.720coord: 9..300
e-value: 5.4E-109
score: 365.3
NoneNo IPR availableGENE3DG3DSA:3.40.50.720coord: 102..291
e-value: 5.4E-109
score: 365.3
NoneNo IPR availablePANTHERPTHR42938FAMILY NOT NAMEDcoord: 4..454
NoneNo IPR availablePANTHERPTHR42938:SF5D-3-PHOSPHOGLYCERATE DEHYDROGENASEcoord: 4..454
NoneNo IPR availableCDDcd12173PGDH_4coord: 8..314
e-value: 1.03504E-156
score: 446.477
NoneNo IPR availableSUPERFAMILYSSF52283Formate/glycerate dehydrogenase catalytic domain-likecoord: 8..144
IPR029752D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding domain conserved site 1PROSITEPS00065D_2_HYDROXYACID_DH_1coord: 152..179
IPR036291NAD(P)-binding domain superfamilySUPERFAMILYSSF51735NAD(P)-binding Rossmann-fold domainscoord: 109..290