Gamma-glutamyltransferase 7

Overview
NameGamma-glutamyltransferase 7
Smed IDSMED30027931
Length (bp)2126
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Gamma-glutamyltransferase 7 (SMED30027931) t-SNE clustered cells

Violin plots show distribution of expression levels for Gamma-glutamyltransferase 7 (SMED30027931) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Gamma-glutamyltransferase 7 (SMED30027931) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Gamma-glutamyltransferase 7 (SMED30027931) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027931

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermisSMED30027931SMESG000022957.1 dd_Smed_v4_4573_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30027931SMESG000022957.1 dd_Smed_v4_4573_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30027931SMESG000025000.1 Contig3911GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30027931SMESG000022957.1 Contig53242uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30027931SMESG000022957.1 Contig53242newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30027931SMESG000022957.1 Contig3911GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
epidermisSMED30027931SMESG000022957.1 dd_Smed_v4_4573_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Gamma-glutamyltransferase 7 vs. Ensembl Human
Match: GGT7 (gamma-glutamyltransferase 7 [Source:HGNC Symbol;Acc:HGNC:4259])

HSP 1 Score: 141.739 bits (356), Expect = 1.719e-34
Identity = 141/511 (27.59%), Postives = 236/511 (46.18%), Query Frame = 2
Query:  293 TVAMILCIFFGPPQIRPHAGISTDVTECTDLGLEICRQGGSAVDSAIGSFLCVSIARPDLASLGGCGXXXXXXXXXXXXXXIDFSCVAPPNAQPEPIPLGYGISKS--VAMPGVLSGLKLAHKTYGKMNWTNILNLVTVKLQNGIKVTPEMQTVFKDPIFNSLSQNFRTNYQNWASGSVFTPSK-----ELLDILTALTKEGADSGIT-GSFANEMINLGFPWTGRLD-------TARELKPLTAVFGDYSLITAPLPSKGGLELAIAIEMLSKVVPMTALVKENTLFYHRLIESLKVAQSTTSFLGDS--DNGIEP---KLLSTQSIQNLINMMGTSTALPNKNYGPYYSLSNIEKGSGTHISIIDSSSLYVSLTVNLGSKFGSGIATKSGIVLNDAMRLFTSNDSTSLVPGIQIRNRTTSNNIAAPGKRPLNELAPLIVYNFKRKCGVRFAVGGDRGPQSTTGNLQMIMGAIYLDQKFCPSKDCMNLVKAGSRLRLYVNLLENTNQNNT 1765
            TVA+++ I+FG PQI     + TD   CT LG+E+  + GS+VD+A+ + LC+ I  P  + LGG G ++VH+     S+ IDF   AP   + E +   +       V +PG++ GL  AH+ YG++ W+ +L       Q+G  VT ++     + +  ++S+ FR  +    SG    P       +L ++L  L   G  +    G+   EM+       G +        +A   KP+  V+  + L+ +P P   G  L  A+ +L      + + +E  L  H + E+LK+A +  S LGD   D+ I      +LS      L   +  S A P     P Y L      +   + I+      V++  +L   FGSG+ T SGI+LN  M  F+  + T+        +  +  N   PGKRPL+ L P +V   +  CG   A+G +   +  +G  Q+++  + L++         NL  + +R RL+ +L  N  Q ++
Sbjct:  122 TVALVMQIYFGDPQIFQQGAVVTDAARCTSLGIEVLSKQGSSVDAAVAAALCLGIVAPHSSGLGGGGVMLVHDIRRNESHLIDFRESAPGALREETLQRSWETKPGLLVGVPGMVKGLHEAHQLYGRLPWSQVLAFAAAVAQDGFNVTHDLARALAEQLPPNMSERFRETF--LPSGRPPLPGSLLHRPDLAEVLDVLGTSGPAAFYAGGNLTLEMVAEAQHAGGVITEEDFSNYSALVEKPVCGVYRGH-LVLSPPPPHTGPALISALNILEGFNLTSLVSREQAL--HWVAETLKIALALASRLGDPVYDSTITESMDDMLSKVEAAYLRGHINDSQAAPAPLL-PVYELDGAP--TAAQVLIMGPDDFIVAMVSSLNQPFGSGLITPSGILLNSQMLDFSWPNRTA------NHSAPSLENSVQPGKRPLSFLLPTVVRPAEGLCGTYLALGANGAARGLSGLTQVLLNVLTLNR---------NLSDSLARGRLHPDLQSNLLQVDS 609          
BLAST of Gamma-glutamyltransferase 7 vs. Ensembl Human
Match: GGT1 (gamma-glutamyltransferase 1 [Source:HGNC Symbol;Acc:HGNC:4250])

HSP 1 Score: 105.145 bits (261), Expect = 6.993e-23
Identity = 130/540 (24.07%), Postives = 219/540 (40.56%), Query Frame = 2
Query:  332 QIRPHAGISTDVTECTDLGLEICRQGGSAVDSAIGSFLCVSIARPDLASLGGCGXXXXXXXXXXXXXXIDFSCVAPPNAQPEPIPLGYGISK---SVAMPGVLSGLKLAHKTYGKMNWTNILNLVTVKLQNGIKVTPEMQTVFKD--------PIFNSLSQNFRTNYQNWASGSVFTPSKELLDILTALTKEGADSGITGSFANEMINLGFPWTGRLDTAREL---------KPLTAVFGDYSLITAPLPSKGGLELAIAIEMLSKVVPMTALV---KENTLFYHRLIESLKVAQSTTSFLGDSDNGIEPKLLS-TQSIQNLIN---------MMGTSTALPNKNYGPYYSLSNIEKGSGTHISIIDSSSLYVSLTVNLGSKFGSGIATK-SGIVLNDAMRLFTSNDSTSL--VPGIQIRNRTTSNNIAAPGKRPLNELAPLIVYNFKRKCGVRFAVGGDRGPQSTTGNLQMIMGAIYLDQKFCPSKDCMNLVKAGSRLRLYVNLLENTNQNNTATVYFDQNFPENFKTELTTVYQHSNF 1843
             +   A ++ D  +C+ +G +  R GGSAVD+AI + LCV +       +GG   L ++N ++  +  I+   VAP  A            K   SVA+PG + G +LAH+ +G++ W  +        + G  V   +    ++        P+   L + F  + +    G   T   +L D    L  EGA +   GS   +++       G + TA +L          PL    GD  L     P  G + LA+ + +L         V   ++  L YHR++E+ + A +  + LGD      PK +  T+ ++N+ +          +   T  P   Y P +   +   G   H+S++      VS T  +   FGS + +  SGI+ N+ M  F+S   T+   VP        +  N   PGK+PL+ + P I+    +   VR  VG   G Q TT     I+  ++            ++ +A    RL+  LL N           ++N  +     L T + H+  
Sbjct:   36 HVYTRAAVAADAKQCSKIGRDALRDGGSAVDAAIAALLCVGLMNAHSMGIGGGLFLTIYNSTTRKAEVINAREVAPRLAFATMFNSSEQSQKGGLSVAVPGEIRGYELAHQRHGRLPWARLFQPSIQLARQGFPVGKGLAAALENKRTVIEQQPV---LCEVFCRDRKVLREGERLT-LPQLADTYETLAIEGAQAFYNGSLTAQIVK-DIQAAGGIVTAEDLNNYRAELIEHPLNISLGDVVLYMPSAPLSGPV-LALILNILKGYNFSRESVESPEQKGLTYHRIVEAFRFAYAKRTLLGD------PKFVDVTEVVRNMTSEFFAAQLRAQISDDTTHPISYYKPEFYTPD--DGGTAHLSVVAEDGSAVSATSTINLYFGSKVRSPVSGILFNNEMDDFSSPSITNEFGVP-------PSPANFIQPGKQPLSSMCPTIMVG--QDGQVRMVVGAAGGTQITTATALAIIYNLWFG---------YDVKRAVEEPRLHNQLLPNVTT-------VERNIDQAVTAALETRHHHTQI 536          
BLAST of Gamma-glutamyltransferase 7 vs. Ensembl Human
Match: GGT1 (gamma-glutamyltransferase 1 [Source:HGNC Symbol;Acc:HGNC:4250])

HSP 1 Score: 105.145 bits (261), Expect = 6.993e-23
Identity = 130/540 (24.07%), Postives = 219/540 (40.56%), Query Frame = 2
Query:  332 QIRPHAGISTDVTECTDLGLEICRQGGSAVDSAIGSFLCVSIARPDLASLGGCGXXXXXXXXXXXXXXIDFSCVAPPNAQPEPIPLGYGISK---SVAMPGVLSGLKLAHKTYGKMNWTNILNLVTVKLQNGIKVTPEMQTVFKD--------PIFNSLSQNFRTNYQNWASGSVFTPSKELLDILTALTKEGADSGITGSFANEMINLGFPWTGRLDTAREL---------KPLTAVFGDYSLITAPLPSKGGLELAIAIEMLSKVVPMTALV---KENTLFYHRLIESLKVAQSTTSFLGDSDNGIEPKLLS-TQSIQNLIN---------MMGTSTALPNKNYGPYYSLSNIEKGSGTHISIIDSSSLYVSLTVNLGSKFGSGIATK-SGIVLNDAMRLFTSNDSTSL--VPGIQIRNRTTSNNIAAPGKRPLNELAPLIVYNFKRKCGVRFAVGGDRGPQSTTGNLQMIMGAIYLDQKFCPSKDCMNLVKAGSRLRLYVNLLENTNQNNTATVYFDQNFPENFKTELTTVYQHSNF 1843
             +   A ++ D  +C+ +G +  R GGSAVD+AI + LCV +       +GG   L ++N ++  +  I+   VAP  A            K   SVA+PG + G +LAH+ +G++ W  +        + G  V   +    ++        P+   L + F  + +    G   T   +L D    L  EGA +   GS   +++       G + TA +L          PL    GD  L     P  G + LA+ + +L         V   ++  L YHR++E+ + A +  + LGD      PK +  T+ ++N+ +          +   T  P   Y P +   +   G   H+S++      VS T  +   FGS + +  SGI+ N+ M  F+S   T+   VP        +  N   PGK+PL+ + P I+    +   VR  VG   G Q TT     I+  ++            ++ +A    RL+  LL N           ++N  +     L T + H+  
Sbjct:   36 HVYTRAAVAADAKQCSKIGRDALRDGGSAVDAAIAALLCVGLMNAHSMGIGGGLFLTIYNSTTRKAEVINAREVAPRLAFATMFNSSEQSQKGGLSVAVPGEIRGYELAHQRHGRLPWARLFQPSIQLARQGFPVGKGLAAALENKRTVIEQQPV---LCEVFCRDRKVLREGERLT-LPQLADTYETLAIEGAQAFYNGSLTAQIVK-DIQAAGGIVTAEDLNNYRAELIEHPLNISLGDVVLYMPSAPLSGPV-LALILNILKGYNFSRESVESPEQKGLTYHRIVEAFRFAYAKRTLLGD------PKFVDVTEVVRNMTSEFFAAQLRAQISDDTTHPISYYKPEFYTPD--DGGTAHLSVVAEDGSAVSATSTINLYFGSKVRSPVSGILFNNEMDDFSSPSITNEFGVP-------PSPANFIQPGKQPLSSMCPTIMVG--QDGQVRMVVGAAGGTQITTATALAIIYNLWFG---------YDVKRAVEEPRLHNQLLPNVTT-------VERNIDQAVTAALETRHHHTQI 536          
BLAST of Gamma-glutamyltransferase 7 vs. Ensembl Human
Match: GGT1 (gamma-glutamyltransferase 1 [Source:HGNC Symbol;Acc:HGNC:4250])

HSP 1 Score: 105.145 bits (261), Expect = 6.993e-23
Identity = 130/540 (24.07%), Postives = 219/540 (40.56%), Query Frame = 2
Query:  332 QIRPHAGISTDVTECTDLGLEICRQGGSAVDSAIGSFLCVSIARPDLASLGGCGXXXXXXXXXXXXXXIDFSCVAPPNAQPEPIPLGYGISK---SVAMPGVLSGLKLAHKTYGKMNWTNILNLVTVKLQNGIKVTPEMQTVFKD--------PIFNSLSQNFRTNYQNWASGSVFTPSKELLDILTALTKEGADSGITGSFANEMINLGFPWTGRLDTAREL---------KPLTAVFGDYSLITAPLPSKGGLELAIAIEMLSKVVPMTALV---KENTLFYHRLIESLKVAQSTTSFLGDSDNGIEPKLLS-TQSIQNLIN---------MMGTSTALPNKNYGPYYSLSNIEKGSGTHISIIDSSSLYVSLTVNLGSKFGSGIATK-SGIVLNDAMRLFTSNDSTSL--VPGIQIRNRTTSNNIAAPGKRPLNELAPLIVYNFKRKCGVRFAVGGDRGPQSTTGNLQMIMGAIYLDQKFCPSKDCMNLVKAGSRLRLYVNLLENTNQNNTATVYFDQNFPENFKTELTTVYQHSNF 1843
             +   A ++ D  +C+ +G +  R GGSAVD+AI + LCV +       +GG   L ++N ++  +  I+   VAP  A            K   SVA+PG + G +LAH+ +G++ W  +        + G  V   +    ++        P+   L + F  + +    G   T   +L D    L  EGA +   GS   +++       G + TA +L          PL    GD  L     P  G + LA+ + +L         V   ++  L YHR++E+ + A +  + LGD      PK +  T+ ++N+ +          +   T  P   Y P +   +   G   H+S++      VS T  +   FGS + +  SGI+ N+ M  F+S   T+   VP        +  N   PGK+PL+ + P I+    +   VR  VG   G Q TT     I+  ++            ++ +A    RL+  LL N           ++N  +     L T + H+  
Sbjct:   36 HVYTRAAVAADAKQCSKIGRDALRDGGSAVDAAIAALLCVGLMNAHSMGIGGGLFLTIYNSTTRKAEVINAREVAPRLAFATMFNSSEQSQKGGLSVAVPGEIRGYELAHQRHGRLPWARLFQPSIQLARQGFPVGKGLAAALENKRTVIEQQPV---LCEVFCRDRKVLREGERLT-LPQLADTYETLAIEGAQAFYNGSLTAQIVK-DIQAAGGIVTAEDLNNYRAELIEHPLNISLGDVVLYMPSAPLSGPV-LALILNILKGYNFSRESVESPEQKGLTYHRIVEAFRFAYAKRTLLGD------PKFVDVTEVVRNMTSEFFAAQLRAQISDDTTHPISYYKPEFYTPD--DGGTAHLSVVAEDGSAVSATSTINLYFGSKVRSPVSGILFNNEMDDFSSPSITNEFGVP-------PSPANFIQPGKQPLSSMCPTIMVG--QDGQVRMVVGAAGGTQITTATALAIIYNLWFG---------YDVKRAVEEPRLHNQLLPNVTT-------VERNIDQAVTAALETRHHHTQI 536          
BLAST of Gamma-glutamyltransferase 7 vs. Ensembl Human
Match: GGT1 (gamma-glutamyltransferase 1 [Source:HGNC Symbol;Acc:HGNC:4250])

HSP 1 Score: 98.2117 bits (243), Expect = 6.198e-21
Identity = 111/440 (25.23%), Postives = 186/440 (42.27%), Query Frame = 2
Query:  344 HAGISTDVTECTDLGLEICRQGGSAVDSAIGSFLCVSIARPDLASLGGCGXXXXXXXXXXXXXXIDFSCVAPPNAQPEPIPLGYGISK---SVAMPGVLSGLKLAHKTYGKMNWTNILNLVTVKLQNGIKVTPEMQTVFKD--------PIFNSLSQNFRTNYQNWASGSVFTPSKELLDILTALTKEGADSGITGSFANEMINLGFPWTGRLDTAREL---------KPLTAVFGDYSLITAPLPSKGGLELAIAIEMLSKVVPMTALV---KENTLFYHRLIESLKVAQSTTSFLGDSDNGIEPKLLS-TQSIQNLIN---------MMGTSTALPNKNYGPYYSLSNIEKGSGTHISIIDSSSLYVSLTVNLGSKFGSGIATK-SGIVLNDAMRLFTSNDSTSL--VPGIQIRNRTTSNNIAAPGKRPLNELAPLIV 1555
             A ++ D  +C+ +G +  R GGSAVD+AI + LCV +       +GG   L ++N ++  +  I+   VAP  A            K   SVA+PG + G +LAH+ +G++ W  +        + G  V   +    ++        P+   L + F  + +    G   T   +L D    L  EGA +   GS   +++       G + TA +L          PL    GD  L     P  G + LA+ + +L         V   ++  L YHR++E+ + A +  + LGD      PK +  T+ ++N+ +          +   T  P   Y P +   +   G   H+S++      VS T  +   FGS + +  SGI+ N+ M  F+S   T+   VP        +  N   PGK+PL+ + P I+
Sbjct:   40 RAAVAADAKQCSKIGRDALRDGGSAVDAAIAALLCVGLMNAHSMGIGGGLFLTIYNSTTRKAEVINAREVAPRLAFATMFNSSEQSQKGGLSVAVPGEIRGYELAHQRHGRLPWARLFQPSIQLARQGFPVGKGLAAALENKRTVIEQQPV---LCEVFCRDRKVLREGERLT-LPQLADTYETLAIEGAQAFYNGSLTAQIVK-DIQAAGGIVTAEDLNNYRAELIEHPLNISLGDVVLYMPSAPLSGPV-LALILNILKGYNFSRESVESPEQKGLTYHRIVEAFRFAYAKRTLLGD------PKFVDVTEVVRNMTSEFFAAQLRAQISDDTTHPISYYKPEFYTPD--DGGTAHLSVVAEDGSAVSATSTINLYFGSKVRSPVSGILFNNEMDDFSSPSITNEFGVP-------PSPANFIQPGKQPLSSMCPTIM 458          
BLAST of Gamma-glutamyltransferase 7 vs. Ensembl Celegans
Match: H14N18.4 (pep chromosome:WBcel235:V:8924264:8927853:-1 gene:WBGene00019204.1 transcript:H14N18.4d.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:H14N18.4)

HSP 1 Score: 108.227 bits (269), Expect = 3.063e-24
Identity = 134/546 (24.54%), Postives = 232/546 (42.49%), Query Frame = 2
Query:  347 AGISTDVTECTDLGLEICRQGGSAVDSAIGSFLCVSIARPDLASLGGCGXXXXXXXXXXXXXXIDFSCVAPPNA-------QPEPIPLGYGISKSVAMPGVLSGLKLAHKTY--GKMNWTNILNLVTVKLQNGIKVTPEMQTVFKD--------PIFNSLSQNFRTNYQNWASGSVFTPSKELLDILTALTKEGAD-------SGITGSFANEMI-NLGFPWTGRL---DTARELKPL--TAVFGDYSLITAPLPSKGGLELAIAIEMLSKVVPMTALVKENTLFYHRLIESLKVAQSTTSFLGD-----SDNGIEPKLLSTQSIQNLINMMGTSTALPNKNYGPYYSLSNIEKGSGTHISIIDSSSLYVSLTVNLGSKFGSGIATKS-GIVLNDAMRLFTSNDSTSLVPGIQ--IRNRTTSNNIAAPGKRPLNELAPLIVYNFKRKCGVRFAVGGDRGPQSTTGNLQMIMGAIYLDQKFCPSKDCMNLVKAGSRLRLYVNLLENTNQNNTATVYFDQNFPENFKTELTTVYQHSNFNISKAQNSI 1870
            A +++D   C+++G ++  +GG+AVD+ I S LC+    P  + +GG   + ++N S+ +  +I+    AP  A        P+   +GY   KS+A P  L G       Y  GK++W  +         +G  V+  +  V  D        P    +  N +TN + +  G +    ++ L    AL     D        G+  + A E+  N GF     L   +T  +  PL  T + GDY +   P PS   +   I I+++++      +  ++ L YHRLIE+ K A +  + LGD     S   +  ++++ +  + + +++   TA     YG        + G+ +H+SIIDS    VS T  +    GS  A+ + GIV ND M  F++       PG++       +  N   PGKRP++ ++P+I+YN K +  V    G   G    +   Q ++  +  +Q    + D           R +   L  T +   A        P   +  L   Y+  NF +   Q S+
Sbjct:   75 AAVTSDHGLCSEIGRDVLIEGGNAVDAMIASLLCIGTVNPQSSGIGGGFVMTLYNASTGMCQTINARETAPAAATETMFVDNPKESVMGY---KSIATPSELHGFWTVFNMYGSGKVSWARLFQPSITLAHDGFPVSSNLAMVLADKEKYIREEPTMKDIFVNPKTN-RVYEEGDIL--KRQRLASTYALLANATDPVELFYKGGMAQTIAGEITDNGGFVNESDLASYETTIDDAPLLSTHLPGDYEMCGPPPPSSFVITQNI-IQVMAQYYKDGQVDLDDPLVYHRLIEAEKFAYAQRTKLGDVKFVESAKTLVDEMMTEEYTKKIASLI-KDTAQTLDYYGGEKKDMAPDHGT-SHVSIIDSHGNAVSCTSTVNQILGSMRASPTLGIVWNDQMDDFST-------PGMKNSFGYAPSETNFIQPGKRPMSSMSPMIIYN-KNENRVEMVTGASGGSYIISATAQTVIRTLLFNQTVKAAVDAP---------RFHNQYLPETTETEEA-------MPLALREVLVEQYKQ-NFTVVPRQKSV 586          
BLAST of Gamma-glutamyltransferase 7 vs. Ensembl Celegans
Match: H14N18.4 (pep chromosome:WBcel235:V:8923900:8927853:-1 gene:WBGene00019204.1 transcript:H14N18.4d.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:H14N18.4)

HSP 1 Score: 108.227 bits (269), Expect = 3.063e-24
Identity = 134/546 (24.54%), Postives = 232/546 (42.49%), Query Frame = 2
Query:  347 AGISTDVTECTDLGLEICRQGGSAVDSAIGSFLCVSIARPDLASLGGCGXXXXXXXXXXXXXXIDFSCVAPPNA-------QPEPIPLGYGISKSVAMPGVLSGLKLAHKTY--GKMNWTNILNLVTVKLQNGIKVTPEMQTVFKD--------PIFNSLSQNFRTNYQNWASGSVFTPSKELLDILTALTKEGAD-------SGITGSFANEMI-NLGFPWTGRL---DTARELKPL--TAVFGDYSLITAPLPSKGGLELAIAIEMLSKVVPMTALVKENTLFYHRLIESLKVAQSTTSFLGD-----SDNGIEPKLLSTQSIQNLINMMGTSTALPNKNYGPYYSLSNIEKGSGTHISIIDSSSLYVSLTVNLGSKFGSGIATKS-GIVLNDAMRLFTSNDSTSLVPGIQ--IRNRTTSNNIAAPGKRPLNELAPLIVYNFKRKCGVRFAVGGDRGPQSTTGNLQMIMGAIYLDQKFCPSKDCMNLVKAGSRLRLYVNLLENTNQNNTATVYFDQNFPENFKTELTTVYQHSNFNISKAQNSI 1870
            A +++D   C+++G ++  +GG+AVD+ I S LC+    P  + +GG   + ++N S+ +  +I+    AP  A        P+   +GY   KS+A P  L G       Y  GK++W  +         +G  V+  +  V  D        P    +  N +TN + +  G +    ++ L    AL     D        G+  + A E+  N GF     L   +T  +  PL  T + GDY +   P PS   +   I I+++++      +  ++ L YHRLIE+ K A +  + LGD     S   +  ++++ +  + + +++   TA     YG        + G+ +H+SIIDS    VS T  +    GS  A+ + GIV ND M  F++       PG++       +  N   PGKRP++ ++P+I+YN K +  V    G   G    +   Q ++  +  +Q    + D           R +   L  T +   A        P   +  L   Y+  NF +   Q S+
Sbjct:   75 AAVTSDHGLCSEIGRDVLIEGGNAVDAMIASLLCIGTVNPQSSGIGGGFVMTLYNASTGMCQTINARETAPAAATETMFVDNPKESVMGY---KSIATPSELHGFWTVFNMYGSGKVSWARLFQPSITLAHDGFPVSSNLAMVLADKEKYIREEPTMKDIFVNPKTN-RVYEEGDIL--KRQRLASTYALLANATDPVELFYKGGMAQTIAGEITDNGGFVNESDLASYETTIDDAPLLSTHLPGDYEMCGPPPPSSFVITQNI-IQVMAQYYKDGQVDLDDPLVYHRLIEAEKFAYAQRTKLGDVKFVESAKTLVDEMMTEEYTKKIASLI-KDTAQTLDYYGGEKKDMAPDHGT-SHVSIIDSHGNAVSCTSTVNQILGSMRASPTLGIVWNDQMDDFST-------PGMKNSFGYAPSETNFIQPGKRPMSSMSPMIIYN-KNENRVEMVTGASGGSYIISATAQTVIRTLLFNQTVKAAVDAP---------RFHNQYLPETTETEEA-------MPLALREVLVEQYKQ-NFTVVPRQKSV 586          
BLAST of Gamma-glutamyltransferase 7 vs. Ensembl Celegans
Match: H14N18.4 (pep chromosome:WBcel235:V:8923900:8928938:-1 gene:WBGene00019204.1 transcript:H14N18.4c.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:H14N18.4)

HSP 1 Score: 107.842 bits (268), Expect = 4.101e-24
Identity = 134/546 (24.54%), Postives = 232/546 (42.49%), Query Frame = 2
Query:  347 AGISTDVTECTDLGLEICRQGGSAVDSAIGSFLCVSIARPDLASLGGCGXXXXXXXXXXXXXXIDFSCVAPPNA-------QPEPIPLGYGISKSVAMPGVLSGLKLAHKTY--GKMNWTNILNLVTVKLQNGIKVTPEMQTVFKD--------PIFNSLSQNFRTNYQNWASGSVFTPSKELLDILTALTKEGAD-------SGITGSFANEMI-NLGFPWTGRL---DTARELKPL--TAVFGDYSLITAPLPSKGGLELAIAIEMLSKVVPMTALVKENTLFYHRLIESLKVAQSTTSFLGD-----SDNGIEPKLLSTQSIQNLINMMGTSTALPNKNYGPYYSLSNIEKGSGTHISIIDSSSLYVSLTVNLGSKFGSGIATKS-GIVLNDAMRLFTSNDSTSLVPGIQ--IRNRTTSNNIAAPGKRPLNELAPLIVYNFKRKCGVRFAVGGDRGPQSTTGNLQMIMGAIYLDQKFCPSKDCMNLVKAGSRLRLYVNLLENTNQNNTATVYFDQNFPENFKTELTTVYQHSNFNISKAQNSI 1870
            A +++D   C+++G ++  +GG+AVD+ I S LC+    P  + +GG   + ++N S+ +  +I+    AP  A        P+   +GY   KS+A P  L G       Y  GK++W  +         +G  V+  +  V  D        P    +  N +TN + +  G +    ++ L    AL     D        G+  + A E+  N GF     L   +T  +  PL  T + GDY +   P PS   +   I I+++++      +  ++ L YHRLIE+ K A +  + LGD     S   +  ++++ +  + + +++   TA     YG        + G+ +H+SIIDS    VS T  +    GS  A+ + GIV ND M  F++       PG++       +  N   PGKRP++ ++P+I+YN K +  V    G   G    +   Q ++  +  +Q    + D           R +   L  T +   A        P   +  L   Y+  NF +   Q S+
Sbjct:  105 AAVTSDHGLCSEIGRDVLIEGGNAVDAMIASLLCIGTVNPQSSGIGGGFVMTLYNASTGMCQTINARETAPAAATETMFVDNPKESVMGY---KSIATPSELHGFWTVFNMYGSGKVSWARLFQPSITLAHDGFPVSSNLAMVLADKEKYIREEPTMKDIFVNPKTN-RVYEEGDIL--KRQRLASTYALLANATDPVELFYKGGMAQTIAGEITDNGGFVNESDLASYETTIDDAPLLSTHLPGDYEMCGPPPPSSFVITQNI-IQVMAQYYKDGQVDLDDPLVYHRLIEAEKFAYAQRTKLGDVKFVESAKTLVDEMMTEEYTKKIASLI-KDTAQTLDYYGGEKKDMAPDHGT-SHVSIIDSHGNAVSCTSTVNQILGSMRASPTLGIVWNDQMDDFST-------PGMKNSFGYAPSETNFIQPGKRPMSSMSPMIIYN-KNENRVEMVTGASGGSYIISATAQTVIRTLLFNQTVKAAVDAP---------RFHNQYLPETTETEEA-------MPLALREVLVEQYKQ-NFTVVPRQKSV 616          
BLAST of Gamma-glutamyltransferase 7 vs. Ensembl Celegans
Match: H14N18.4 (pep chromosome:WBcel235:V:8924264:8928978:-1 gene:WBGene00019204.1 transcript:H14N18.4c.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:H14N18.4)

HSP 1 Score: 107.842 bits (268), Expect = 4.101e-24
Identity = 134/546 (24.54%), Postives = 232/546 (42.49%), Query Frame = 2
Query:  347 AGISTDVTECTDLGLEICRQGGSAVDSAIGSFLCVSIARPDLASLGGCGXXXXXXXXXXXXXXIDFSCVAPPNA-------QPEPIPLGYGISKSVAMPGVLSGLKLAHKTY--GKMNWTNILNLVTVKLQNGIKVTPEMQTVFKD--------PIFNSLSQNFRTNYQNWASGSVFTPSKELLDILTALTKEGAD-------SGITGSFANEMI-NLGFPWTGRL---DTARELKPL--TAVFGDYSLITAPLPSKGGLELAIAIEMLSKVVPMTALVKENTLFYHRLIESLKVAQSTTSFLGD-----SDNGIEPKLLSTQSIQNLINMMGTSTALPNKNYGPYYSLSNIEKGSGTHISIIDSSSLYVSLTVNLGSKFGSGIATKS-GIVLNDAMRLFTSNDSTSLVPGIQ--IRNRTTSNNIAAPGKRPLNELAPLIVYNFKRKCGVRFAVGGDRGPQSTTGNLQMIMGAIYLDQKFCPSKDCMNLVKAGSRLRLYVNLLENTNQNNTATVYFDQNFPENFKTELTTVYQHSNFNISKAQNSI 1870
            A +++D   C+++G ++  +GG+AVD+ I S LC+    P  + +GG   + ++N S+ +  +I+    AP  A        P+   +GY   KS+A P  L G       Y  GK++W  +         +G  V+  +  V  D        P    +  N +TN + +  G +    ++ L    AL     D        G+  + A E+  N GF     L   +T  +  PL  T + GDY +   P PS   +   I I+++++      +  ++ L YHRLIE+ K A +  + LGD     S   +  ++++ +  + + +++   TA     YG        + G+ +H+SIIDS    VS T  +    GS  A+ + GIV ND M  F++       PG++       +  N   PGKRP++ ++P+I+YN K +  V    G   G    +   Q ++  +  +Q    + D           R +   L  T +   A        P   +  L   Y+  NF +   Q S+
Sbjct:  105 AAVTSDHGLCSEIGRDVLIEGGNAVDAMIASLLCIGTVNPQSSGIGGGFVMTLYNASTGMCQTINARETAPAAATETMFVDNPKESVMGY---KSIATPSELHGFWTVFNMYGSGKVSWARLFQPSITLAHDGFPVSSNLAMVLADKEKYIREEPTMKDIFVNPKTN-RVYEEGDIL--KRQRLASTYALLANATDPVELFYKGGMAQTIAGEITDNGGFVNESDLASYETTIDDAPLLSTHLPGDYEMCGPPPPSSFVITQNI-IQVMAQYYKDGQVDLDDPLVYHRLIEAEKFAYAQRTKLGDVKFVESAKTLVDEMMTEEYTKKIASLI-KDTAQTLDYYGGEKKDMAPDHGT-SHVSIIDSHGNAVSCTSTVNQILGSMRASPTLGIVWNDQMDDFST-------PGMKNSFGYAPSETNFIQPGKRPMSSMSPMIIYN-KNENRVEMVTGASGGSYIISATAQTVIRTLLFNQTVKAAVDAP---------RFHNQYLPETTETEEA-------MPLALREVLVEQYKQ-NFTVVPRQKSV 616          
BLAST of Gamma-glutamyltransferase 7 vs. Ensembl Celegans
Match: H14N18.4 (pep chromosome:WBcel235:V:8923900:8928938:-1 gene:WBGene00019204.1 transcript:H14N18.4a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:H14N18.4)

HSP 1 Score: 107.457 bits (267), Expect = 6.588e-24
Identity = 137/553 (24.77%), Postives = 232/553 (41.95%), Query Frame = 2
Query:  347 AGISTDVTECTDLGLEICRQGGSAVDSAIGSFLCVSIARPDLASLGGCGXXXXXXXXXXXXXXIDFSCVAPPNA-------QPEPIPLGYGISKSVAMPGVLSGLKLAHKTY--GKMNWTNILNLVTVKLQNGIKVTPEMQTVFKD--------PIFNSLSQNFRTNYQNWASGSVFTPSKELLDILTALTKEGAD-------SGITGSFANEMI-NLGFPWTGRL---DTARELKPL--TAVFGDYSLITAPLPSKGGLELAIAIEMLSKVVPMTALVKENTLFYHRLIESLKVAQSTTSFLGD-----SDNGIEPKLLSTQSIQNLINMMGTSTALPNKNYG------PYYSLSNIEKGSGT-HISIIDSSSLYVSLTVNLGSKFGSGIATKS-GIVLNDAMRLFTSNDSTSLVPGIQ--IRNRTTSNNIAAPGKRPLNELAPLIVYNFKRKCGVRFAVGGDRGPQSTTGNLQMIMGAIYLDQKFCPSKDCMNLVKAGSRLRLYVNLLENTNQNNTATVYFDQNFPENFKTELTTVYQHSNFNISKAQNSI 1870
            A +++D   C+++G ++  +GG+AVD+ I S LC+    P  + +GG   + ++N S+ +  +I+    AP  A        P+   +GY   KS+A P  L G       Y  GK++W  +         +G  V+  +  V  D        P    +  N +TN + +  G +    ++ L    AL     D        G+  + A E+  N GF     L   +T  +  PL  T + GDY +   P PS   +   I I+++++      +  ++ L YHRLIE+ K A +  + LGD     S   +  ++++ +  + + +++   TA     YG      P     N     GT H+SIIDS    VS T  +    GS  A+ + GIV ND M  F++       PG++       +  N   PGKRP++ ++P+I+YN K +  V    G   G    +   Q ++  +  +Q    + D           R +   L  T +   A        P   +  L   Y+  NF +   Q S+
Sbjct:  105 AAVTSDHGLCSEIGRDVLIEGGNAVDAMIASLLCIGTVNPQSSGIGGGFVMTLYNASTGMCQTINARETAPAAATETMFVDNPKESVMGY---KSIATPSELHGFWTVFNMYGSGKVSWARLFQPSITLAHDGFPVSSNLAMVLADKEKYIREEPTMKDIFVNPKTN-RVYEEGDIL--KRQRLASTYALLANATDPVELFYKGGMAQTIAGEITDNGGFVNESDLASYETTIDDAPLLSTHLPGDYEMCGPPPPSSFVITQNI-IQVMAQYYKDGQVDLDDPLVYHRLIEAEKFAYAQRTKLGDVKFVESAKTLVDEMMTEEYTKKIASLI-KDTAQTLDYYGGEKKDMPDSETINKAPDHGTSHVSIIDSHGNAVSCTSTVNQILGSMRASPTLGIVWNDQMDDFST-------PGMKNSFGYAPSETNFIQPGKRPMSSMSPMIIYN-KNENRVEMVTGASGGSYIISATAQTVIRTLLFNQTVKAAVDA---------PRFHNQYLPETTETEEA-------MPLALREVLVEQYKQ-NFTVVPRQKSV 624          
BLAST of Gamma-glutamyltransferase 7 vs. Ensembl Fly
Match: Ggt-1 (gene:FBgn0030932 transcript:FBtr0074622)

HSP 1 Score: 98.5969 bits (244), Expect = 4.498e-21
Identity = 118/464 (25.43%), Postives = 207/464 (44.61%), Query Frame = 2
Query:  374 CTDLGLEICRQGGSAVDSAIGSFLCVSIARPDLASLGGCGXXXXXXXXXXXXXXIDFSCVAPPNAQPEPIPLGYGI--SKSVAMPGVLSGLKLAHKTYGKMNWTNILNLVTVKLQNGIKVTPEMQTVFKDPIFN-----SLSQNFRTNYQNWASGSVFTPSKELLDILTALTKEGA----DSGITG-SFANEMINLGFPWTGRLDTARELKPLTA-----------VFGDYSLITAPLPSKGGLELAIAIEMLSKVVPMTALVKENT-LFYHRLIESLKVAQSTTSFLGDS--------------DNGIEPKLLSTQSIQNLINMMGTSTALPNKNYGPYYSLSNIEKGSGT-HISIIDSSSLYVSLTVNLGSKFGSGIA-TKSGIVLNDAMRLFTSNDSTSLVPGIQIRNRTTSNNIAAPGKRPLNELAPLIVYNFKRKCGVRFAVGGDRGPQSTTGNLQMIM 1645
            C  +G E+   GGSAVD+AI + LC  +  P    +GG     ++  SS    ++     AP  A  +       I  +KS A+PG + G    H+ YG + W  +        + G  V+  +    +  + N      LS  F     +      +     L D L  + + GA    D G TG  F  ++  +     G + T ++L+  T            V G Y+L + P+PS G + LA  + +      M  L  +N  +++ R++E+ K A    + LGD               +  ++P+ L  +S++ LI+   TS     ++Y  Y +   +E+  GT H++++ ++   VS+T  + + FGS +A T++GI+LND M  F+   +  ++ G  +    +  N   PGKRP++ ++P I+ +  ++  VR  VG   G + TT    +IM
Sbjct:   50 CAAVGGEMLTDGGSAVDAAIATLLCEGLLLPHSMGIGGGFVATIYTRSSRKVETVIARESAPAAAHKDMFVGETSITGAKSGAVPGEILGYWEMHRRYGILPWKRLFEPSIKLAREGHVVSRYLAAAIQSKLDNIKADPGLSAVFLNATGDPHLEGDYMKRPALADTLERIAENGAKEFYDGGETGRKFVEDIQKM-----GGIITEQDLRDYTVRWESDGHVSAHVSGTYTLYSTPMPSSGPV-LAFILNL------MADLYTDNEPIYWQRVVEAFKHAYGQRTNLGDMYADPVSAASINATLEEMLKPEFL--ESVRKLIHDNSTS-----EDYLYYGANFTVEEDHGTAHMNVLATNGDAVSITSTINNYFGSKVASTQTGIILNDEMDDFS---TPGVINGFGV--PASPANYIYPGKRPMSSMSPCIIVD--QEGNVRLLVGAAGGTRITTSVAAVIM 487          
BLAST of Gamma-glutamyltransferase 7 vs. Ensembl Fly
Match: Ggt-1 (gene:FBgn0030932 transcript:FBtr0340368)

HSP 1 Score: 98.5969 bits (244), Expect = 4.498e-21
Identity = 118/464 (25.43%), Postives = 207/464 (44.61%), Query Frame = 2
Query:  374 CTDLGLEICRQGGSAVDSAIGSFLCVSIARPDLASLGGCGXXXXXXXXXXXXXXIDFSCVAPPNAQPEPIPLGYGI--SKSVAMPGVLSGLKLAHKTYGKMNWTNILNLVTVKLQNGIKVTPEMQTVFKDPIFN-----SLSQNFRTNYQNWASGSVFTPSKELLDILTALTKEGA----DSGITG-SFANEMINLGFPWTGRLDTARELKPLTA-----------VFGDYSLITAPLPSKGGLELAIAIEMLSKVVPMTALVKENT-LFYHRLIESLKVAQSTTSFLGDS--------------DNGIEPKLLSTQSIQNLINMMGTSTALPNKNYGPYYSLSNIEKGSGT-HISIIDSSSLYVSLTVNLGSKFGSGIA-TKSGIVLNDAMRLFTSNDSTSLVPGIQIRNRTTSNNIAAPGKRPLNELAPLIVYNFKRKCGVRFAVGGDRGPQSTTGNLQMIM 1645
            C  +G E+   GGSAVD+AI + LC  +  P    +GG     ++  SS    ++     AP  A  +       I  +KS A+PG + G    H+ YG + W  +        + G  V+  +    +  + N      LS  F     +      +     L D L  + + GA    D G TG  F  ++  +     G + T ++L+  T            V G Y+L + P+PS G + LA  + +      M  L  +N  +++ R++E+ K A    + LGD               +  ++P+ L  +S++ LI+   TS     ++Y  Y +   +E+  GT H++++ ++   VS+T  + + FGS +A T++GI+LND M  F+   +  ++ G  +    +  N   PGKRP++ ++P I+ +  ++  VR  VG   G + TT    +IM
Sbjct:   50 CAAVGGEMLTDGGSAVDAAIATLLCEGLLLPHSMGIGGGFVATIYTRSSRKVETVIARESAPAAAHKDMFVGETSITGAKSGAVPGEILGYWEMHRRYGILPWKRLFEPSIKLAREGHVVSRYLAAAIQSKLDNIKADPGLSAVFLNATGDPHLEGDYMKRPALADTLERIAENGAKEFYDGGETGRKFVEDIQKM-----GGIITEQDLRDYTVRWESDGHVSAHVSGTYTLYSTPMPSSGPV-LAFILNL------MADLYTDNEPIYWQRVVEAFKHAYGQRTNLGDMYADPVSAASINATLEEMLKPEFL--ESVRKLIHDNSTS-----EDYLYYGANFTVEEDHGTAHMNVLATNGDAVSITSTINNYFGSKVASTQTGIILNDEMDDFS---TPGVINGFGV--PASPANYIYPGKRPMSSMSPCIIVD--QEGNVRLLVGAAGGTRITTSVAAVIM 487          
BLAST of Gamma-glutamyltransferase 7 vs. Ensembl Fly
Match: CG17636 (gene:FBgn0025837 transcript:FBtr0112921)

HSP 1 Score: 92.0485 bits (227), Expect = 4.940e-19
Identity = 126/513 (24.56%), Postives = 215/513 (41.91%), Query Frame = 2
Query:  374 CTDLGLEICRQGGSAVDSAIGSFLCVSIARPDLASLGGCGXXXXXXXXXXXXXXIDFSCVAPPNAQPEPIPLGYGISK--SVAMPGVLSGLKLAHKTYGKMNWTNILNLVTVKLQNGIKVT--------PEMQTVFKDPIFNSLSQNFRTNYQNWASGSVFTPSKELLDILTALTKEGADSGITGSFANEMINLGFPWTGRLDTARELK--------PLTAVF-GDYSLITAPLPSKGGLELAIAIEMLSKVVPMTALVKENT-LFYHRLIESLKVAQSTTSFLGD----------SDNGIEPKLLSTQSIQNLINMMGTSTALPNKNYGPYYSLSNIEKGSGTHISIIDSSSLYVSLTVNLGSKFGSGIATK-SGIVLNDAMRLFTSNDSTSLVPGIQIRNRTTSNNIAAPGKRPLNELAPLIVYNFKRKCGVRFAVGGDRGPQSTTGNLQMIMGAIYLDQKFCPSKDCMNLVKAGSRLR-LYVNLLENTNQNNTA---TVYFDQNFPENFK 1807
            C ++G  I   GGSA D+AI + LC  +  P    +GG G +          + +  +    P A  + + +   I+   S A+P  + G    H  YG++ W  +        + GI V+         E + +  +P    +  N +T+ + +  G V      L + L  +  EGA +   G      +       G + T  +L+        PL + F G Y LIT+ LP+ G    A+   ML+ + P   L   NT  ++ RLIE+ K A    + LGD           +N I+P   +   I+ LI  +   T      YG   + +N E     HIS++  +   +S+T  + S  G+ + ++ +G +LND M  F++    +   GI      +  N   PGKRP++   P IV +      V+  VGG  G + TT   Q I+    L +   P +  +N  +   +L  +++++  N  ++  A    +  D  F E+ K
Sbjct:   49 CAEVGGSILDIGGSAADAAIATMLCEGVMLPHSLGVGG-GFVATIYSRETEFSEVLIARETAPAAATQDMFVKTEITGALSCAVPAEIYGYSELHDKYGRLPWKTLFQPTIDLCRRGILVSRYLSGVLQREEERIRNEPSMAEIFINPKTD-EVYKQGEVMY-RHTLAETLEIIADEGAKAIYGGGRVGRKLVEDIQAMGGIVTEEDLQSYNVRWEMPLHSHFSGGYKLITSTLPTSG----AVLTFMLNVMEP---LYTSNTDKYWQRLIETFKHAYGHRTNLGDIHYEPDVQEMYENLIDPAFAA--EIRKLI--LDDRTFEDMSYYGA--NFANEEDHGTAHISVLAPNGDAISVTSTINSHLGAKVRSRQTGFILNDEMDDFSTPGKINAY-GIP----ASPANFIKPGKRPMSSTCPSIVLD--THGNVKLIVGGAGGSKITTSVAQTILRYFVLHE---PIEKAVNSGRLHHQLAPMHIDMEPNVPRHTVAYLSAIGHDIRFLEDDK 535          
BLAST of Gamma-glutamyltransferase 7 vs. Ensembl Fly
Match: CG17636 (gene:FBgn0025837 transcript:FBtr0307095)

HSP 1 Score: 91.6633 bits (226), Expect = 5.537e-19
Identity = 126/513 (24.56%), Postives = 215/513 (41.91%), Query Frame = 2
Query:  374 CTDLGLEICRQGGSAVDSAIGSFLCVSIARPDLASLGGCGXXXXXXXXXXXXXXIDFSCVAPPNAQPEPIPLGYGISK--SVAMPGVLSGLKLAHKTYGKMNWTNILNLVTVKLQNGIKVT--------PEMQTVFKDPIFNSLSQNFRTNYQNWASGSVFTPSKELLDILTALTKEGADSGITGSFANEMINLGFPWTGRLDTARELK--------PLTAVF-GDYSLITAPLPSKGGLELAIAIEMLSKVVPMTALVKENT-LFYHRLIESLKVAQSTTSFLGD----------SDNGIEPKLLSTQSIQNLINMMGTSTALPNKNYGPYYSLSNIEKGSGTHISIIDSSSLYVSLTVNLGSKFGSGIATK-SGIVLNDAMRLFTSNDSTSLVPGIQIRNRTTSNNIAAPGKRPLNELAPLIVYNFKRKCGVRFAVGGDRGPQSTTGNLQMIMGAIYLDQKFCPSKDCMNLVKAGSRLR-LYVNLLENTNQNNTA---TVYFDQNFPENFK 1807
            C ++G  I   GGSA D+AI + LC  +  P    +GG G +          + +  +    P A  + + +   I+   S A+P  + G    H  YG++ W  +        + GI V+         E + +  +P    +  N +T+ + +  G V      L + L  +  EGA +   G      +       G + T  +L+        PL + F G Y LIT+ LP+ G    A+   ML+ + P   L   NT  ++ RLIE+ K A    + LGD           +N I+P   +   I+ LI  +   T      YG   + +N E     HIS++  +   +S+T  + S  G+ + ++ +G +LND M  F++    +   GI      +  N   PGKRP++   P IV +      V+  VGG  G + TT   Q I+    L +   P +  +N  +   +L  +++++  N  ++  A    +  D  F E+ K
Sbjct:   63 CAEVGGSILDIGGSAADAAIATMLCEGVMLPHSLGVGG-GFVATIYSRETEFSEVLIARETAPAAATQDMFVKTEITGALSCAVPAEIYGYSELHDKYGRLPWKTLFQPTIDLCRRGILVSRYLSGVLQREEERIRNEPSMAEIFINPKTD-EVYKQGEVMY-RHTLAETLEIIADEGAKAIYGGGRVGRKLVEDIQAMGGIVTEEDLQSYNVRWEMPLHSHFSGGYKLITSTLPTSG----AVLTFMLNVMEP---LYTSNTDKYWQRLIETFKHAYGHRTNLGDIHYEPDVQEMYENLIDPAFAA--EIRKLI--LDDRTFEDMSYYGA--NFANEEDHGTAHISVLAPNGDAISVTSTINSHLGAKVRSRQTGFILNDEMDDFSTPGKINAY-GIP----ASPANFIKPGKRPMSSTCPSIVLD--THGNVKLIVGGAGGSKITTSVAQTILRYFVLHE---PIEKAVNSGRLHHQLAPMHIDMEPNVPRHTVAYLSAIGHDIRFLEDDK 549          
BLAST of Gamma-glutamyltransferase 7 vs. Ensembl Fly
Match: CG4829 (gene:FBgn0030796 transcript:FBtr0112994)

HSP 1 Score: 85.5001 bits (210), Expect = 6.015e-17
Identity = 121/475 (25.47%), Postives = 207/475 (43.58%), Query Frame = 2
Query:  335 IRPHAGISTDVTECTDLGLEICRQGGSAVDSAIGSFLCVSIARPDLASLGGCGXXXXXXXXXXXXXXIDFSCVAPPNA-------QPEPIPLGYGISKSVAMPGVLSGLKLAHKTYGKMNWTNILNLVTVKLQNGIKVTPEMQTVFKD--PIFNSLSQ-----NFRTNYQNWASGSVFTPSKELLDILTALTKEGADSGITGSFANEMINLGFPWTGRLDTARELK--------PLTAVFGDYSLITAPLPSKGGLELAIAIEML-----SKVVPMTALVKENTLFYHRLIESLKVAQSTTSFLGDSDNGIEPKLLSTQ------SIQNLINMMGTSTALPN-KNYGPYYSLSNIEKGSGT-HISIIDSSSLYVSLTVNLGSKFGSG-IATKSGIVLNDAMRLFTSNDSTSLVPGIQIRNRTTSNNIAAPGKRPLNELAPLIVYNFKRKCGVRFAVGGDRGPQSTTGNLQMIMGA 1651
            +  H  +S+D  EC+ +G  I ++ GSAVD+AI + LC  +       +GG   + V+N     + +ID   VAP  A       QPE    G     S+A+PG + G  +AH+ +G++ W  ++       + G  V+  M+       P      Q     N  T   + A G+V  P K L      L + G      G+ A +++       G +  A +L+         +T   GD +L   P P   G  +A  + +L     +     T  +K  T+  HR  E++K A +    LGD  + I+ + L ++        QN    +  S  LP+ + YG  ++   IE   GT ++ ++  +   VS+T ++ S FGSG I  ++GIVLN+ M  F   ++   +P      ++ SN I A  KR ++  +P+++ +                     GN++M++GA
Sbjct:  151 VYQHGAVSSDNLECSKIGSGILQKNGSAVDAAIAALLCNGLLTLQSMGIGGGHLMNVYNRKERHATAIDAREVAPYEATEDMFAQQPENSDKG---PLSIAVPGEVMGYHVAHQKFGQLPWAELVAPSLELCEKGYHVSQHMERALDIALPYIKEHEQYQIYLNAETGKPHVA-GTVVKPPKNLCKTYKLLAENGPMDMYNGTIA-KLLAEDLQDMGSIILADDLESYEADVINSITMDLGDDTLYVVP-PVSSGSVVAHVLAILQGYNFTAQDLSTEELKARTI--HRFAEAMKFAFAQRPELGDM-HFIDARELVSRLNSPDFGDQNRAK-INDSHVLPDAQAYGANFAA--IEDLDGTSNLVVLAPNGDAVSVTSSINSYFGSGLIGPRTGIVLNNGMNDFAVKNNIFALP------QSQSNKIEAH-KRAMSSQSPILLAD-------------------KDGNMKMVIGA 587          
BLAST of Gamma-glutamyltransferase 7 vs. Ensembl Zebrafish
Match: GGT7 (gamma-glutamyltransferase 7 [Source:NCBI gene;Acc:101882295])

HSP 1 Score: 143.28 bits (360), Expect = 1.583e-35
Identity = 137/464 (29.53%), Postives = 212/464 (45.69%), Query Frame = 2
Query:  293 TVAMILCIFFGPPQIRPHAGISTDVTECTDLGLEICRQGGSAVDSAIGSFLCVSIARPDLASLGGCGXXXXXXXXXXXXXXIDFSCVAPPNAQPEPIPLGYGISKSVAMPGVLSGLKLAHKTYGKMNWTNILNLVTVKLQNGIKVTPEMQTVFKDPIFNSLSQNFRTNYQNWASGSVFTPSKELLDILTALTKEGADSGITGSFANEMINLGFPWTGRLDTARELKPLTAVFGDYSLITAPLPSKGGLELAIAIEML-----SKVVPMTALVKENTLFYHRLIESLKVAQSTTSFLGDS--DNGIE---PKLLSTQSIQNLINMMGTSTALPNKNYGPYYSLSNIEKGSGTHISIIDSSSLYVSLTVNLGSKFGSGIATKSGIVLNDAMRLFTSNDSTSLVPGIQIRNRTTSNNIAAPGKRPLNELAPLIVYNFKRKCGVRFAVGGDRGPQSTTGNLQMIMGAI 1654
            TVA+I+ I+FG PQ+   A + TDV+ CT LGL++  + GS+VD+AI + LC+ I  P  + +GG G ++VH+     S  IDF    P     E +    G++  VA+PG++SGL  AH+ YG+ +                            PI  +L   F   +Q  A+G V             LT+E         F N        +T  + T     PL +++    +   P P + G+ L  A+ +L     S   P +++       YH + +SLK+A S  S LGDS  D+ +     ++LS         M+  + A    +Y P Y L +  +     ISI+ + +L VS+  +L   FGSGI T SGI+LN  +  F+  + T        RN        APGKRPL+ L PL V     +CG   A+G   G ++ +G  Q+++  +
Sbjct:  126 TVALIMQIYFGEPQVYSQAAVVTDVSRCTTLGLDVLGKQGSSVDAAIAASLCLGIIHPHSSGIGGGGVMLVHDIRKNESRVIDFRETVPSGLH-EDMMQHPGLT--VAVPGLISGLHQAHQLYGRYD--------------------------HQPI--TLRSEFCVVFQVQANGGV-------------LTEE--------DFRN--------YTTVIQT-----PLQSLYQGQQVFVPP-PPQAGVALLSALNILEGFNISSQTPRSSV-------YHWVADSLKIALSQASGLGDSMFDSSVSELVAEMLSKTQAAAFRQMISDTLASTADHYTPSYELQDTNEAG--QISIMGTDNLIVSVMSSLNRPFGSGIVTSSGILLNSQILDFSWPNKTLSSSAFNQRNSI------APGKRPLSFLLPLAVRPSVGQCGTYIALGSCSGDRALSGITQVLVNVL 508          
BLAST of Gamma-glutamyltransferase 7 vs. Ensembl Zebrafish
Match: ggt1a (gamma-glutamyltransferase 1a [Source:ZFIN;Acc:ZDB-GENE-040426-1388])

HSP 1 Score: 132.88 bits (333), Expect = 4.729e-32
Identity = 137/528 (25.95%), Postives = 242/528 (45.83%), Query Frame = 2
Query:  347 AGISTDVTECTDLGLEICRQGGSAVDSAIGSFLCVSIARPDLASLGGCGXXXXXXXXXXXXXXIDFSCVAPPNAQPEPIPLGYGISK----SVAMPGVLSGLKLAHKTYGKMNWTNILNLVTVKL-QNGIKVTPEMQTVFKDPIFNSLSQNFRTNYQNWASGSVFTPSKE-------------LLDILTALTKEGADSGITGSFANEMINLGFPWTG--RLDTARELK------PLTAVFGDYSLITAPLPSKGGLELAIAIEMLSKV---VPMTALVKENTLFYHRLIESLKVAQSTTSFLGDSDNGIEPKLLSTQSI----------QNLINMMGTSTALPNKNYGPYYSLSNIEKGSGT-HISII--DSSSLYVSLTVNLGSKFGSGIATKS-GIVLNDAMRLFTSNDSTSLVPGIQIRNRTTSNNIAAPGKRPLNELAPLIVYNFKRKCGVRFAVGGDRGPQSTTGNLQMIMGAIYLDQKFCPSKDCMNLVKAGSRLRLYVNLLENTNQNNTATVYFDQNFPEN 1801
            A ++ D  +C+++G +I ++ GSAVD++I + LCV +       +GG     + N S+    +ID    AP NA  +       +S+    S+A+PG + G ++AH  +G++ W  +  L ++KL +NG  V   +         N++++N  T   +     VF  S +             L D    + +EG D   +GS A  +++      G   L+  RE K      PL    G+Y++     PS G + LA+ + ++          +  ++ TL YHR++E+ + A +  S LGD      P+ L+   +           N+ + +   T  P+  Y P Y + +     GT H+S+I  D S++  + T+NL   FGS + ++S GI+ ND M  F+S   T+   G  +    + NN   PGKRPL+ + P I+  F +   V+  VG   G + TT    +I+ +++ +          +L KA +  R++       NQ N      +Q+F ++
Sbjct:   49 AAVAADAGKCSEVGRDILKRNGSAVDASIAALLCVGLFNAHSMGIGGGLFFTIFNASTGKVETIDARETAPKNASEDMFGNNTQLSRKGGLSIAIPGEIRGYEMAHNRHGRLPWRELF-LPSIKLARNGFPVGKALA--------NAIAKNKETILSDMTLCEVFCDSDKNILKENDIIRFTTLADTYEKIAEEGPDVFYSGSLAQNIVDDIQAAGGIITLEDLREYKPVLNETPLKLTVGEYTINVPDAPSSGPV-LALILNIVDGFNFSDHSVSTAEKKTLTYHRIVEAFRFAYAKRSKLGD------PRYLNITDLIHNMTSDYFADNIRSKITDDTTHPDSYYDPEYFVPD---NHGTAHLSVIAEDGSAVAATSTINL--YFGSKVMSRSTGIIFNDEMDDFSSPYITN---GFGV--PPSPNNFIQPGKRPLSSMCPTII--FDKHNRVKMVVGASGGTKITTATALVILNSLFFN---------YDLKKAVTEPRVH-------NQLNPNMTVVEQDFEQS 532          
BLAST of Gamma-glutamyltransferase 7 vs. Ensembl Zebrafish
Match: ggt1l2.2 (gamma-glutamyltransferase 1 like 2.2 [Source:ZFIN;Acc:ZDB-GENE-090312-37])

HSP 1 Score: 131.339 bits (329), Expect = 1.280e-31
Identity = 131/482 (27.18%), Postives = 213/482 (44.19%), Query Frame = 2
Query:  347 AGISTDVTECTDLGLEICRQGGSAVDSAIGSFLCVSIARPDLASLGGCGXXXXXXXXXXXXXXIDFSCVAPPNA-------QPEPIPLGYGISKSVAMPGVLSGLKLAHKTYGKMNWTNILNLVTVKLQNGIKVTPEMQTVFKDPIFNSLSQNFRTNYQNWASGSVFTPSK-------------ELLDILTALTKEGADSGITGSFANEMINLGFPWTGRLDTARELKPLTAVFGDYSL--------ITAPLPSKGGLELAIAIEMLSKV---VPMTALVKENTLFYHRLIESLKVAQSTTSFLGDSDNGIEPKLLSTQSIQNLINMMGTSTA----------LPNKNYGPYYSLSNIEKGSGT-HISIIDSSSLYVSLTVNLGSKFGSGIATKS-GIVLNDAMRLFTSNDSTSLVPGIQIRNRTTSNNIAAPGKRPLNELAPLIVYNF-KRKCGVRFAVGGDRGPQSTTGNLQMIMGAIYL 1660
            A ++ D  +C+++G +I ++ GSAVD+AI + LCVS+       +GG     ++N  S    +I+    AP +A        PE    G  I    A+PG L G  LAHK +GK+ W  +        Q  IK+  E   + K  + N++++   T  +N     VF  S              +L +    +++EG D+   GS    +++      G + T  +LK    V  +++L          AP    GG  LA+ ++++          A     TL YHRLIE+ + A    S LGD         L     +++ NM+  S A          L   +Y     ++ + +  GT H+S++      V++T ++ + FGSG+ ++S GI+ ND M  F   +   L+ G         NN   PGKRPL+ + P I++    RK  VR  VGG  G   TT   Q+I+  ++ 
Sbjct:   40 AAVAADARKCSEIGRDILQRNGSAVDAAIAALLCVSLVNAQSMGIGGGLVFTIYNAPSGKVETINSRETAPMSASENMFGTNPEKAKPGLFI----AVPGELRGYALAHKRHGKLPWKEL-------FQPSIKLASEGFKIGK-ALANAINETRATIQRNATLCEVFCDSNNIVLKENDTIRFPKLAETYRKISEEGPDAFYNGSLTQSIVD-DIKAAGGIITREDLKAYGPVLTEHALNFTVGKYIFHAPGAPFGGPVLALILKVMKGYNISWKSMATTGNKTLTYHRLIEAFRFADVQKSKLGDP--------LFENITEHVKNMVSDSFADHIRSKIKDDLKQTSYDEQEDINTVPEDHGTSHVSVLAKDGSAVAVTSSINNYFGSGVMSRSTGIIFNDQMWDFIEPE---LMSG------PNKNNKIKPGKRPLSSMCPTIIFEKDDRKNKVRMVVGGAGGTNITTSVAQVILNHLFF 491          
BLAST of Gamma-glutamyltransferase 7 vs. Ensembl Zebrafish
Match: si:ch73-236c18.3 (si:ch73-236c18.3 [Source:ZFIN;Acc:ZDB-GENE-121214-50])

HSP 1 Score: 128.257 bits (321), Expect = 1.575e-30
Identity = 136/523 (26.00%), Postives = 227/523 (43.40%), Query Frame = 2
Query:  311 CIFFGPPQIRPHAGISTDVTECTDLGLEICRQGGSAVDSAIGSFLCVSIARPDLASLGGCGXXXXXXXXXXXXXXIDFSCVAPPNAQPEPIPLGYGISKS---VAMPGVLSGLKLAHKTYGKMNWTNILNLVTVKLQNGIKVTPEMQTVFKDPIFN-----SLSQNFRTNYQNWASGSVFTPSKELLDILTALTKEGADSGITGSFANEMINLGFPWTGRLDTARELKPLTAVF---------GDYSLITAPLPSKGGLELAIAIEML--------------SKVVPMTALVKENTLFYHRLIESLKVAQSTTSFLGDSDNGIEPKLLSTQSIQNLI--NMMGTSTALPNK-----------NYGPYYSLSNIEKGSGTHISIIDSSSLYVSLTVNLGSKFGSGIATK-SGIVLNDAMRLFTSNDSTSLVPGIQIRNRTTSNNIAAPGKRPLNELAPLIVYNFKRKCG--VRFAVGGDRGPQSTTGNLQMIMGAIYLDQKFCPSKDCMNLVKAGSRLRLYVNL 1738
            C+F G       A ++TD   C+D+G +I ++GGSAVD+AI + LCVS+  P    +GG     ++N S+    +I+    AP +A  +        +K    +A+PG L G KLAH  +G++ W  +        + G K+   +    K+         +L + F     N    + +    +L      +++EG D+   GS    +++      G + T ++L     V          G Y +  AP    GG  L + +++L               K V  T   K  TL YHR+IE+L +A    + LGD            Q I N +  NM+  S A  N+           N     S S  +    +H+S+ID+    V++T ++ + FGSG+ ++ +GI+ ND M+ FT N+                +N    GKRPL+ + P I+ + +++    V   VG + G   TT   Q+I+  +Y D      KD +N     SR+++  N+
Sbjct:   51 CMFNG--NCYGKAAVATDAETCSDIGRDILQRGGSAVDAAIAALLCVSVINPQSIGIGGGVVFTIYNASTGKVETINARETAPMSATADMFDNNNNNTKPGLLIAVPGELRGYKLAHDRHGRLEWKELFKPSIKLARKGFKIGKALADAIKEEEDKFQKNTTLCEVFCDADYNLPKINDYIRFSQLAATYRKISEEGPDAFYNGSLTQSIVDDIRAAGGNI-TRKDLTDYEPVLTESAINFNVGKY-IFHAPGAPFGGPVLTLIMKILLGNGTKGFSGFNLSKKSVSTT---KNKTLTYHRIIETLCIADVEKTKLGDP---------LKQPIVNEVVKNMISDSFADHNRSEIDDSIATACNKSNNVSKSVPDDSGTSHVSVIDAEGNAVAVTSSINNYFGSGVMSECTGIIFNDQMKDFTDNE----------------HNRIEKGKRPLSSMCPTIILDEEKENSEKVTMVVGAEGGTNITTAVAQVILNYLYFDYDL---KDAVN----ASRVQIKNNV 534          
BLAST of Gamma-glutamyltransferase 7 vs. Ensembl Zebrafish
Match: ggt1b (gamma-glutamyltransferase 1b [Source:ZFIN;Acc:ZDB-GENE-110408-13])

HSP 1 Score: 126.331 bits (316), Expect = 5.310e-30
Identity = 130/531 (24.48%), Postives = 246/531 (46.33%), Query Frame = 2
Query:  347 AGISTDVTECTDLGLEICRQGGSAVDSAIGSFLCVSIARPDLASLGGCGXXXXXXXXXXXXXXIDFSCVAPPNAQPEPIPLGYGISK----SVAMPGVLSGLKLAHKTYGKMNWTNILNLVTVKL-QNGIKVTPEMQTVFKDPIFNSLSQNFRTNYQNWASGSVFTPSK-----ELLDILTALTKEGADSGITGSFANEMIN-----LGFPWTGRLDTAREL---KPLTAVFGDYSLITAPLPSKGGLELAIAIEMLS--KVVPMTALVKENTLF-YHRLIESLKVAQSTTSFLGDSDNGIEPKLLSTQS-IQN--------LINMMGTSTALPNKN-YGPYYSLSNIEKGSGTHISIIDSSSLYVSLTVNLGSKFGSGIATKS-GIVLNDAMRLFTS---NDSTSLVPGIQIRNRTTSNNIAAPGKRPLNELAPLIVYNFKRKCGVRFAVGGDRGPQSTTGNLQMIMGAIYLDQKFCPSKDCMNLVKAGSRLRLYVNLLENTNQNNTATVYFDQNFPENF--KTELTTVY 1828
            A ++TD   C+++G ++ ++GGSAVDSAI + LC  +       +GG     +++  +  + +I+    AP NA  +       +S+    S+A+PG + G ++AH+ +G++ W  +  L ++KL ++G  V   + +  +    N L      +    ++G++   +      +L D   A+ ++G ++  +G+ A  ++       G      L   R L    P TA  G+++++T   PS G + L + + +LS   + P +    E  +  YHR++E+ + A +  S LGD      P+ L+    IQN        +I +  T  +   ++ Y P + L   E    +H+S++      V+ T  + + FGS + +KS GI+LN+ M  F+S    ++  + P        + NN   P KRP++ + P I+ +  +   V+  VG   G + TT   Q+++  ++            +L KA +  R++  L  NT Q   +   FD+   E    K   T V+
Sbjct:   44 AAVATDAGTCSEIGRDVLKKGGSAVDSAIAALLCAGLMNAHSMGIGGGLFFTIYDAKTGKAETINARETAPANATRDMFGNSTELSQKGGLSIAVPGEIRGYEMAHRRHGRLPWKELF-LPSIKLARDGFPVGRALASAIRSNRNNILEDKMLCSVFCNSTGNILQENDTITFTKLADTYEAIAEQGPEAFYSGALAESLVRDIQDADGIITLADLRDYRALLDEYPPTASVGEFTMVTPDAPSSGPV-LTLMLNILSGYSLSPDSVSSTEKKILTYHRVVEAFRFAYAKRSVLGD------PQFLNISDFIQNITSKGYADMIRLKITDNSTQQESYYEPEFYLP--ENYGTSHVSVVAEDGSAVAATSTINTYFGSKLMSKSTGILLNNEMDDFSSPLITNNFGVPP--------SPNNFIVPNKRPMSSMCPAILLD--KNNQVKMVVGASGGTKITTAVAQVVLNTLFFQ---------YDLKKAIAEARVHNQLSPNTTQVEQS---FDKAVLEGLAEKNHFTEVF 542          
BLAST of Gamma-glutamyltransferase 7 vs. Ensembl Xenopus
Match: GGT7 (gamma-glutamyltransferase 7 [Source:NCBI gene;Acc:100496833])

HSP 1 Score: 160.229 bits (404), Expect = 8.979e-41
Identity = 150/523 (28.68%), Postives = 243/523 (46.46%), Query Frame = 2
Query:  293 TVAMILCIFFGPPQIRPHA-GISTDVTECTDLGLEICRQGGSAVDSAIGSFLCVSIARPDLASLGGCGXXXXXXXXXXXXXXIDFSCVAPPNAQPEPIPLGYGISKS--VAMPGVLSGLKLAHKTYGKMNWTNILNLVTVKLQNGIKVTPEMQTVFKDPIFNSLSQNFRTNY---QNWASGSVFTPSKELLDILTALTKEGADSGITGSFANEMINLGFPWTGRLDTARE---------LKPLTAVFGDYSLITAPLPSKGGLELAIAIEMLSKVVPMTALVKENTLFYHRLIESLKVAQSTTSFLGDSDNGIEPKLLSTQSIQNLINMMGTSTALPNKNYGPYYSLSNIEKGSGTHIS-IIDSSSLYVSLTVNLGSKFGSGIATKSGIVLNDA-MRLFTSNDSTSLVPGIQIRNRTT---SNNIAAPGKRPLNELAPLIVYNFKRKCGVRFAVGGDRGPQSTTGNLQMIMGAIYLDQKFCPSKDCMNLVKAGSRLRLYVNLLENTNQNNTATVYFDQNFPEN 1801
            T+A+I+ I+FG PQ+R H  G    +   +   L      GS+VD+AI + LC+ I  P  + +GG G +++H+  + +SN IDF   AP +   E +   +       V +PG+L GL  AH+ YGK+ W  ++++       G  VT ++     +    + S  F   +           F    +L  IL A+ K G ++  + +   EM++    + G L  A E          KP+  V+  + L+ AP     GL L  A+ +L          + + L  H + E+LK+A +T S LGD  +  +P + S   I  L   +  S A P ++Y P+Y   N+E GS +  + ++      V++  +L   FGSGI T SGI+LN   +  F SN S          NRT+    +N   PGKRPL+ L P +V      CG   ++GG  G ++ TG  Q+++  +  ++         NL  + S  RL+ +L        T+ +  D +FPEN
Sbjct:  120 TIALIMQIYFGDPQVRTHEMGTQGSICSSSISCLR-----GSSVDAAIVTTLCLGIVNPHTSGIGGGGVMLIHDIRNNISNVIDFRETAPASIHEELVRHYWKERPGILVGVPGMLKGLSKAHEMYGKLPWQEVISMAAEVAHGGFNVTHDLAEAINESRGQTFSNTFLETFLPDDKPLMAETFIRRPDLAAILYAVAKGGIEAFYSSNLTQEMVSEVNAYGGVL--AEEDFSNYSVLVEKPMQTVYQGH-LVFAPPAPNAGLALITALNILEGANLTKQTPRASAL--HWIAETLKIALATASTLGDPTH--DPSIES--EINFLRQRINESHAAPTEHYMPFY---NLETGSASSQALVVGPDDFIVAVVSSLNRPFGSGIMTSSGILLNSQILDFFWSNRS----------NRTSFPSPSNTVEPGKRPLSFLLPTVVRPAHGLCGTYLSLGGSNGDRALTGITQVLLNVLSFNK---------NLSDSVSNGRLHPDL-------QTSLLEVDGDFPEN 599          
BLAST of Gamma-glutamyltransferase 7 vs. Ensembl Xenopus
Match: GGT7 (gamma-glutamyltransferase 7 [Source:NCBI gene;Acc:100496833])

HSP 1 Score: 158.303 bits (399), Expect = 4.525e-40
Identity = 150/517 (29.01%), Postives = 242/517 (46.81%), Query Frame = 2
Query:  293 TVAMILCIFFGPPQIRPHA-GISTDVTECTDLGLEICRQGGSAVDSAIGSFLCVSIARPDLASLGGCGXXXXXXXXXXXXXXIDFSCVAPPNAQPEPIPLGYGISKSVAMPGVLSGLKLAHKTYGKMNWTNILNLVTVKLQNGIKVTPEMQTVFKDPIFNSLSQNFRTNY---QNWASGSVFTPSKELLDILTALTKEGADSGITGSFANEMINLGFPWTGRLDTARE---------LKPLTAVFGDYSLITAPLPSKGGLELAIAIEMLSKVVPMTALVKENTLFYHRLIESLKVAQSTTSFLGDSDN-----GIEPKLLSTQSIQNLINMMGTSTALPNKNYGPYYSLSNIEKGSGTHIS-IIDSSSLYVSLTVNLGSKFGSGIATKSGIVLNDA-MRLFTSNDSTSLVPGIQIRNRTT---SNNIAAPGKRPLNELAPLIVYNFKRKCGVRFAVGGDRGPQSTTGNLQMIMGAIYLDQKFCPSKDCMNLVKAGSRLRLYVNL---LENTNQNNT 1765
            T+A+I+ I+FG PQ+R H  G    +   +   L      GS+VD+AI + LC+ I  P  + +GG G +++H+  + +SN IDF   AP +   E +P   GI   V +PG+L GL  AH+ YGK+ W  ++++       G  VT ++     +    + S  F   +           F    +L  IL A+ K G ++  + +   EM++    + G L  A E          KP+  V+  + L+ AP     GL L  A+ +L          + + L  H + E+LK+A +T S LGD  +     G   ++L    I  L   +  S A P ++Y P+Y   N+E GS +  + ++      V++  +L   FGSGI T SGI+LN   +  F SN S          NRT+    +N   PGKRPL+ L P +V      CG   ++GG  G ++ TG  Q+++  +  ++         NL  + S  RL+ +L   L   ++N+T
Sbjct:  129 TIALIMQIYFGDPQVRTHEMGTQGSICSSSISCLR-----GSSVDAAIVTTLCLGIVNPHTSGIGGGGVMLIHDIRNNISNVIDFRETAPASIHEE-LP---GIL--VGVPGMLKGLSKAHEMYGKLPWQEVISMAAEVAHGGFNVTHDLAEAINESRGQTFSNTFLETFLPDDKPLMAETFIRRPDLAAILYAVAKGGIEAFYSSNLTQEMVSEVNAYGGVL--AEEDFSNYSVLVEKPMQTVYQGH-LVFAPPAPNAGLALITALNILEGANLTKQTPRASAL--HWIAETLKIALATASTLGDPTHDPSMPGFVKEMLRESEINFLRQRINESHAAPTEHYMPFY---NLETGSASSQALVVGPDDFIVAVVSSLNRPFGSGIMTSSGILLNSQILDFFWSNRS----------NRTSFPSPSNTVEPGKRPLSFLLPTVVRPAHGLCGTYLSLGGSNGDRALTGITQVLLNVLSFNK---------NLSDSVSNGRLHPDLQTSLLEVDENDT 607          
BLAST of Gamma-glutamyltransferase 7 vs. Ensembl Xenopus
Match: GGT7 (gamma-glutamyltransferase 7 [Source:NCBI gene;Acc:100496833])

HSP 1 Score: 154.451 bits (389), Expect = 6.498e-39
Identity = 151/520 (29.04%), Postives = 240/520 (46.15%), Query Frame = 2
Query:  293 TVAMILCIFFGPPQIRPHAGISTDVTECTDLGLEICRQGGSAVDSAIGSFLCVSIARPDLASLGGCGXXXXXXXXXXXXXXIDFSCVAPPNAQPEPIPLGYGISKSVAMPGVLSGLKLAHKTYGKMNWTNILNLVTVKLQNGIKVTPEMQTVFKDPIFNSLSQNFRTNY---QNWASGSVFTPSKELLDILTALTKEGADSGITGSFANEMINLGFPWTGRLDTARE---------LKPLTAVFGDYSLITAPLPSKGGLELAIAIEMLSKVVPMTALVKENTLFYHRLIESLKVAQSTTSFLGDSDNGIEPKLLSTQSIQNLINMMGTSTALPNKNYGPYYSLSNIEKGSGTHIS-IIDSSSLYVSLTVNLGSKFGSGIATKSGIVLNDA-MRLFTSNDSTSLVPGIQIRNRTT---SNNIAAPGKRPLNELAPLIVYNFKRKCGVRFAVGGDRGPQSTTGNLQMIMGAIYLDQKFCPSKDCMNLVKAGSRLRLYVNLLENTNQNNTATVYFDQNFPEN 1801
            T+A+I+ I+FG PQ     G       C           GS+VD+AI + LC+ I  P  + +GG G +++H+  + +SN IDF   AP +   E +P   GI   V +PG+L GL  AH+ YGK+ W  ++++       G  VT ++     +    + S  F   +           F    +L  IL A+ K G ++  + +   EM++    + G L  A E          KP+  V+  + L+ AP     GL L  A+ +L          + + L  H + E+LK+A +T S LGD  +  +P + S   I  L   +  S A P ++Y P+Y   N+E GS +  + ++      V++  +L   FGSGI T SGI+LN   +  F SN S          NRT+    +N   PGKRPL+ L P +V      CG   ++GG  G ++ TG  Q+++  +  ++         NL  + S  RL+ +L        T+ +  D +FPEN
Sbjct:  120 TIALIMQIYFGDPQ-----GPGVYTPSCLR---------GSSVDAAIVTTLCLGIVNPHTSGIGGGGVMLIHDIRNNISNVIDFRETAPASIHEE-LP---GIL--VGVPGMLKGLSKAHEMYGKLPWQEVISMAAEVAHGGFNVTHDLAEAINESRGQTFSNTFLETFLPDDKPLMAETFIRRPDLAAILYAVAKGGIEAFYSSNLTQEMVSEVNAYGGVL--AEEDFSNYSVLVEKPMQTVYQGH-LVFAPPAPNAGLALITALNILEGANLTKQTPRASAL--HWIAETLKIALATASTLGDPTH--DPSIES--EINFLRQRINESHAAPTEHYMPFY---NLETGSASSQALVVGPDDFIVAVVSSLNRPFGSGIMTSSGILLNSQILDFFWSNRS----------NRTSFPSPSNTVEPGKRPLSFLLPTVVRPAHGLCGTYLSLGGSNGDRALTGITQVLLNVLSFNK---------NLSDSVSNGRLHPDL-------QTSLLEVDGDFPEN 581          
BLAST of Gamma-glutamyltransferase 7 vs. Ensembl Xenopus
Match: ggt1 (gamma-glutamyltransferase 1 [Source:NCBI gene;Acc:448376])

HSP 1 Score: 119.013 bits (297), Expect = 2.212e-27
Identity = 130/484 (26.86%), Postives = 208/484 (42.98%), Query Frame = 2
Query:  335 IRPHAGISTDVTECTDLGLEICRQGGSAVDSAIGSFLCVSIARPDLASLGGCGXXXXXXXXXXXXXXIDFSCVAPPNAQPEPI----PLGYGISKSVAMPGVLSGLKLAHKTYGKMNWTNILNL----------VTVKLQNG-------IKVTPEMQTVFKDPIFNSLSQNFRTNYQNWASGSVFTPSKELLDILTALTKEGADSGITGSFANEMINLGFPWTGRLDTARELK---------PLTAVFGDYSLITAPLPSKGGLELAIAIEMLSKVVPMTALVKENT---LFYHRLIESLKVAQSTTSFLGDS--DNGIE--PKLLSTQSIQNLINMMGTSTALPNKNYGPYYSLSNIEKGSGT-HISIIDSSSLYVSLTVNLGSKFGSG-IATKSGIVLNDAMRLFTS---NDSTSLVPGIQIRNRTTSNNIAAPGKRPLNELAPLIVYNFKRKCGVRFAVGGDRGPQSTTGNLQMIMGAIYL 1660
            +   A ++TD  +C+++G +I ++ GSAVD+AI   LCV +       +GG   L +++  +  +  I+    AP  A  E       L     KS+A+PG + G +LAHK +GK+ W  +             V + L+ G       I+  P +  VF  P  + L             G +    K L + L  L  EG D+  TGS + +++       G + T  +L+         PL    GD++L++   P  G + L + + +L         V+ +    L YHR++E+ + A +  + LGD   +N  E    L S    + L   +   T      Y P Y    I+   GT H+SI+      VS T  +   FGS  I+  +GI+ ND M  F+S   N    + P        +  N   PGKRPL+ + P I+ +  +K  V   VG   GP+ TT     IM  ++ 
Sbjct:   66 VYARAAVATDAGKCSEIGRDILKEAGSAVDAAIACLLCVGLLNAHSMGIGGGAILTIYDSKTGKAEVINARERAPLAATEEMYGNNSQLAQIGGKSIAVPGEIRGYQLAHKRHGKLPWKRLFEPSIKLAREGFPVGLGLEQGLNRSREAIESNPLLCEVFCGPDGHVLQM-----------GDIVKMPK-LANTLQTLADEGPDAFYTGSLSKQIVKDIQDAEGII-TEEDLRNYTVDFQDDPLQFSLGDFTLVSPTAPLSGPV-LGLIMNILKGYNFSRQSVETDEKLGLTYHRILEAFRFAYAKRTLLGDPMYENMTEVIKNLTSVYYAEALRQKITDDTTHQPDYYEPTYF---IQDSHGTAHLSIVAEDGSAVSATSTINRYFGSKVISNVTGIIYNDEMDDFSSPLINSGFDIPP--------SPANFIKPGKRPLSSMCPSIILDKNKK--VHLVVGASGGPKITTSVALAIMSTLWF 522          
BLAST of Gamma-glutamyltransferase 7 vs. Ensembl Xenopus
Match: ggt1 (gamma-glutamyltransferase 1 [Source:NCBI gene;Acc:448376])

HSP 1 Score: 116.701 bits (291), Expect = 9.594e-27
Identity = 128/472 (27.12%), Postives = 204/472 (43.22%), Query Frame = 2
Query:  335 IRPHAGISTDVTECTDLGLEICRQGGSAVDSAIGSFLCVSIARPDLASLGGCGXXXXXXXXXXXXXXIDFSCVAPPNAQPEPI----PLGYGISKSVAMPGVLSGLKLAHKTYGKMNWTNILNL----------VTVKLQNG-------IKVTPEMQTVFKDPIFNSLSQNFRTNYQNWASGSVFTPSKELLDILTALTKEGADSGITGSFANEMINLGFPWTGRLDTARELK---------PLTAVFGDYSLITAPLPSKGGLELAIAIEMLSKVVPMTALVKENT---LFYHRLIESLKVAQSTTSFLGDS--DNGIE--PKLLSTQSIQNLINMMGTSTALPNKNYGPYYSLSNIEKGSGT-HISIIDSSSLYVSLTVNLGSKFGSG-IATKSGIVLNDAMRLFTS---NDSTSLVPGIQIRNRTTSNNIAAPGKRPLNELAPLIVYNFKRKCGVRFAVGGDRGPQSTT 1624
            +   A ++TD  +C+++G +I ++ GSAVD+AI   LCV +       +GG   L +++  +  +  I+    AP  A  E       L     KS+A+PG + G +LAHK +GK+ W  +             V + L+ G       I+  P +  VF  P  + L             G +    K L + L  L  EG D+  TGS + +++       G + T  +L+         PL    GD++L++   P  G + L + + +L         V+ +    L YHR++E+ + A +  + LGD   +N  E    L S    + L   +   T      Y P Y    I+   GT H+SI+      VS T  +   FGS  I+  +GI+ ND M  F+S   N    + P        +  N   PGKRPL+ + P I+ +  +K  V   VG   GP+ TT
Sbjct:   66 VYARAAVATDAGKCSEIGRDILKEAGSAVDAAIACLLCVGLLNAHSMGIGGGAILTIYDSKTGKAEVINARERAPLAATEEMYGNNSQLAQIGGKSIAVPGEIRGYQLAHKRHGKLPWKRLFEPSIKLAREGFPVGLGLEQGLNRSREAIESNPLLCEVFCGPDGHVLQM-----------GDIVKMPK-LANTLQTLADEGPDAFYTGSLSKQIVKDIQDAEGII-TEEDLRNYTVDFQDDPLQFSLGDFTLVSPTAPLSGPV-LGLIMNILKGYNFSRQSVETDEKLGLTYHRILEAFRFAYAKRTLLGDPMYENMTEVIKNLTSVYYAEALRQKITDDTTHQPDYYEPTYF---IQDSHGTAHLSIVAEDGSAVSATSTINRYFGSKVISNVTGIIYNDEMDDFSSPLINSGFDIPP--------SPANFIKPGKRPLSSMCPSIILDKNKK--VHLVVGASGGPKITT 510          
BLAST of Gamma-glutamyltransferase 7 vs. Ensembl Mouse
Match: Ggt7 (gamma-glutamyltransferase 7 [Source:MGI Symbol;Acc:MGI:1913385])

HSP 1 Score: 136.346 bits (342), Expect = 5.231e-33
Identity = 140/511 (27.40%), Postives = 234/511 (45.79%), Query Frame = 2
Query:  293 TVAMILCIFFGPPQIRPHAGISTDVTECTDLGLEICRQGGSAVDSAIGSFLCVSIARPDLASLGGCGXXXXXXXXXXXXXXIDFSCVAPPNAQPEPIPLGYGISKS--VAMPGVLSGLKLAHKTYGKMNWTNILNLVTVKLQNGIKVTPEMQTVFKDPIFNSLSQNFRTNYQNWAS----GSVFTPSK--ELLDILTALTKEGADSGITGSFANEMINLGFPWTGRLD-------TARELKPLTAVFGDYSLITAPLPSKGGLELAIAIEMLSKVVPMTALVKENTLFYHRLIESLKVAQSTTSFLGDS--DNGIEP---KLLSTQSIQNLINMMGTSTALPNKNYGPYYSLSNIEKGSGTHISIIDSSSLYVSLTVNLGSKFGSGIATKSGIVLNDAMRLFTSNDSTSLVPGIQIRNRTTSNNIAAPGKRPLNELAPLIVYNFKRKCGVRFAVGGDRGPQSTTGNLQMIMGAIYLDQKFCPSKDCMNLVKAGSRLRLYVNLLENTNQNNT 1765
            TVA+++ I+FG PQI     + TD + CT LG+E+  + GS+VD+A+ + LC+ I  P  + LGG G ++VH+     S+ IDF   AP   + E +   +       V +PG++ GL  AH+ YG++ W+ +L       Q+G  VT ++     + +  + S  F   +         GS+       E+LDIL         +G  G+   EM+       G +        +A   KP+  V+  + L+ +P P   G  L  A+ +L      + + +E  L  H + E+LK+A +  S LGD   D+ I      +LS     N    +  S A P     P Y L      +   + ++      V++  +L   FGSG+ T SGI+LN  M  F+  + T+        +  +  N   PGKRPL+ L P +V   +  CG   A+G +   +  +G  Q+++  + L++         NL  + +R RL+ +L  N  Q ++
Sbjct:  122 TVALVMQIYFGDPQIFQQGAVVTDASSCTALGMEVLSKQGSSVDAAVAAALCLGIVAPHSSGLGGGGVMLVHDIRRNESHLIDFRESAPGALREEALQRSWDTKPGLLVGVPGMVKGLHEAHQLYGRLPWSQVLAFAAAVAQDGFNVTHDLAHALAEQLPPNASDRFLDTFLPLGHPPLPGSLLRRPDLAEVLDILGTSGPAAFYNG--GNLTLEMVAEAQHAGGVITEEDFSNYSALTEKPVCGVYRGH-LVLSPPPPHTGPALISALNILEGFNLTSLVSREQAL--HWVAETLKIALALASRLGDPVYDSTITESMDDMLSKVEAANFRGHISDSQAAPAPLL-PVYELDGAP--TAAQVLVMGPDDFIVAMVSSLNRPFGSGLLTPSGILLNSQMLDFSWPNRTA------NHSAPSLENSVQPGKRPLSFLLPTVVRPAEGLCGTYLALGANGAARGLSGLTQVLLNVLTLNR---------NLSDSLARGRLHPDLQSNLLQVDS 609          
BLAST of Gamma-glutamyltransferase 7 vs. Ensembl Mouse
Match: Ggt1 (gamma-glutamyltransferase 1 [Source:MGI Symbol;Acc:MGI:95706])

HSP 1 Score: 123.635 bits (309), Expect = 4.096e-29
Identity = 137/526 (26.05%), Postives = 230/526 (43.73%), Query Frame = 2
Query:  308 LCIFF-----GPPQIRPHAGISTDVTECTDLGLEICRQGGSAVDSAIGSFLCVSIARPDLASLGGCGXXXXXXXXXXXXXXIDFSCVAPPNAQPEPIPLGYGISK-------SVAMPGVLSGLKLAHKTYGKMNWTNILNLVTVKLQNG--------IKVTPEMQTVFKDPIFNSLSQNFRTNYQNWASGSVFTPSKELLDILTALTKEGADSGITGSFANEMINLGFPWTGRLDTAREL---------KPLTAVFGDYSLITAPLPSKGGLELAIAIEMLS--KVVPMT-ALVKENTLFYHRLIESLKVAQSTTSFLGDSDNGIEPKLLS-TQSIQN---------LINMMGTSTALPNKNYGPYYSLSNIEKGSGTHISII--DSSSLYVSLTVNLGSKFGSGIATK-SGIVLNDAMRLFTSNDSTSLVPGIQIRNRTTSNNIAAPGKRPLNELAPLIVYNFKRKCGVRFAVGGDRGPQSTTGNLQMIMGAIYLDQKFCPSKDCMNLVKAGSRLRLYVNLLENT 1750
            LCI+       P  +   A ++TD   C+++G +I ++GGS VD+AI S LC+ +       +GG     ++N ++     I+   VAP  A        +  SK       SVA+PG + G +LAH+ +G++ W  +        ++G        I +  +   + K P   +L + F    +    G   T  K L D L  L +EGA +   GS   +++       G + T  +L          P++   GD +L     P  G + L + + +L      P + A  ++  L YHR++E+ + A +  + LGD      PK +  +Q I+N         L   +   T  P   Y P + L +   G   H+S +  D S++  + T+NL   FGS + ++ SGI+ ND M  F+S +  +     Q R   +  N   PGK+PL+ + P I+ +  +   VR  VG   G Q TT     I+ +++            ++ +A    RL+  LL NT
Sbjct:   22 LCIWLPYTSGKPDHVYSRAAVATDAKRCSEIGRDILQEGGSVVDAAIASLLCMGLMNAHSMGIGGGLFFTIYNSTTGKVEVINAREVAPRLANTTM----FNNSKDSEEGGLSVAVPGEIRGYELAHQRHGRLPWARLFQPSIQLARHGFPVGKGLAIALDKKRDVIEKTP---ALCEVFCRQGKVLQEGETVTMPK-LADTLQILAQEGAKAFYNGSLTAQIVK-DIQEAGGIMTVEDLNNYRAELIEHPMSIGLGDATLYVPSAPLSGPV-LILILNILKGYNFSPKSVATPEQKALTYHRIVEAFRFAYAKRTMLGD------PKFVDVSQVIRNMSSEFYATQLRARITDETTHPAAYYEPEFYLQD--DGGTAHLSAVSEDGSAVAATSTINL--YFGSKVLSRVSGILFNDEMDDFSSPNFIN-----QFRVAPSPANFIKPGKQPLSSMCPSIILD--KDGQVRMVVGASGGTQITTSVALAIINSLWFG---------YDVKRAVEEPRLHNQLLPNT 511          
BLAST of Gamma-glutamyltransferase 7 vs. Ensembl Mouse
Match: Ggt1 (gamma-glutamyltransferase 1 [Source:MGI Symbol;Acc:MGI:95706])

HSP 1 Score: 123.635 bits (309), Expect = 4.096e-29
Identity = 137/526 (26.05%), Postives = 230/526 (43.73%), Query Frame = 2
Query:  308 LCIFF-----GPPQIRPHAGISTDVTECTDLGLEICRQGGSAVDSAIGSFLCVSIARPDLASLGGCGXXXXXXXXXXXXXXIDFSCVAPPNAQPEPIPLGYGISK-------SVAMPGVLSGLKLAHKTYGKMNWTNILNLVTVKLQNG--------IKVTPEMQTVFKDPIFNSLSQNFRTNYQNWASGSVFTPSKELLDILTALTKEGADSGITGSFANEMINLGFPWTGRLDTAREL---------KPLTAVFGDYSLITAPLPSKGGLELAIAIEMLS--KVVPMT-ALVKENTLFYHRLIESLKVAQSTTSFLGDSDNGIEPKLLS-TQSIQN---------LINMMGTSTALPNKNYGPYYSLSNIEKGSGTHISII--DSSSLYVSLTVNLGSKFGSGIATK-SGIVLNDAMRLFTSNDSTSLVPGIQIRNRTTSNNIAAPGKRPLNELAPLIVYNFKRKCGVRFAVGGDRGPQSTTGNLQMIMGAIYLDQKFCPSKDCMNLVKAGSRLRLYVNLLENT 1750
            LCI+       P  +   A ++TD   C+++G +I ++GGS VD+AI S LC+ +       +GG     ++N ++     I+   VAP  A        +  SK       SVA+PG + G +LAH+ +G++ W  +        ++G        I +  +   + K P   +L + F    +    G   T  K L D L  L +EGA +   GS   +++       G + T  +L          P++   GD +L     P  G + L + + +L      P + A  ++  L YHR++E+ + A +  + LGD      PK +  +Q I+N         L   +   T  P   Y P + L +   G   H+S +  D S++  + T+NL   FGS + ++ SGI+ ND M  F+S +  +     Q R   +  N   PGK+PL+ + P I+ +  +   VR  VG   G Q TT     I+ +++            ++ +A    RL+  LL NT
Sbjct:   22 LCIWLPYTSGKPDHVYSRAAVATDAKRCSEIGRDILQEGGSVVDAAIASLLCMGLMNAHSMGIGGGLFFTIYNSTTGKVEVINAREVAPRLANTTM----FNNSKDSEEGGLSVAVPGEIRGYELAHQRHGRLPWARLFQPSIQLARHGFPVGKGLAIALDKKRDVIEKTP---ALCEVFCRQGKVLQEGETVTMPK-LADTLQILAQEGAKAFYNGSLTAQIVK-DIQEAGGIMTVEDLNNYRAELIEHPMSIGLGDATLYVPSAPLSGPV-LILILNILKGYNFSPKSVATPEQKALTYHRIVEAFRFAYAKRTMLGD------PKFVDVSQVIRNMSSEFYATQLRARITDETTHPAAYYEPEFYLQD--DGGTAHLSAVSEDGSAVAATSTINL--YFGSKVLSRVSGILFNDEMDDFSSPNFIN-----QFRVAPSPANFIKPGKQPLSSMCPSIILD--KDGQVRMVVGASGGTQITTSVALAIINSLWFG---------YDVKRAVEEPRLHNQLLPNT 511          
BLAST of Gamma-glutamyltransferase 7 vs. Ensembl Mouse
Match: Ggt5 (gamma-glutamyltransferase 5 [Source:MGI Symbol;Acc:MGI:1346063])

HSP 1 Score: 92.4337 bits (228), Expect = 4.926e-19
Identity = 100/396 (25.25%), Postives = 169/396 (42.68%), Query Frame = 2
Query:  347 AGISTDVTECTDLGLEICRQGGSAVDSAIGSFLCVSIARPDLASLGGCGXXXXXXXXXXXXXXIDFSCVAPP-------NAQPEPIPLGYGISKSVAMPGVLSGLKLAHKTYGKMNWTNILNLVTVKLQNGIKVTPEMQTVFKDPIF------NSLSQNFRTNYQNWASGSVFTPSKELLDILTALTKEGADSGITGSFANEMINLGFPWTGRLDTAREL--------KPLTAVFGDYSLITAPLPSKGGLELAIAIEMLSKV---VPMTALVKENTLFYHRLIESLKVAQSTTSFLGD--SDNGIE---PKLLS---TQSIQNLINMMGTSTALPNKNYGPYYSLSNIE--KGSGTHISIIDSSSLYVSLTVNLGSKFGSGI-ATKSGIVLNDAM 1429
            A ++ D   C+D+G  I +Q GS VD+AI + +C  +  P    LGG     ++N S+     I+     P        N     +PLG G ++ + +PG L G   AH+ +G++ W  +       L+ G +V   +     + I       ++L Q F    +   S   F P   L + L  + KEGA+   TG     ++       G L T ++L        +PL    G+Y+L + P P  GG  L+  + +L          A        YH L+E+LK A      L D  S  GI+     LL     Q I+  I+  G    L       +Y+L+ +   +   +H+S++      V+ T  + + FG+ + + ++GI+LN+ +
Sbjct:   44 AAVAADSKICSDIGRAILQQRGSPVDAAIAALVCTGVVNPQSMGLGGGVVFTIYNASTGKVEIINARETVPASYDQGLLNQCKNVLPLGTG-AQWIGVPGELRGYAEAHRRHGRLPWAQLFQPTIALLREGFRVPFILSQFLNNSILRPHLSASTLRQLFFNGTETLRSQDPF-PWPALANTLETVAKEGAEVLYTGRLGRMLVE-DIAKQGSLLTVQDLAAFQPEVVEPLEMPLGNYTLYSPP-PPAGGAILSFILNVLKGFNFSAETVARPGGEVNMYHHLVETLKFAVGQRWRLWDPSSHPGIQNISRDLLREDLAQRIRQQIDGRGDHHQL------SHYNLTGVRGNRMGTSHVSVLGEDGSAVAATSTINTPFGAMVYSPRTGILLNNEL 429          
BLAST of Gamma-glutamyltransferase 7 vs. Ensembl Mouse
Match: Ggt7 (gamma-glutamyltransferase 7 [Source:MGI Symbol;Acc:MGI:1913385])

HSP 1 Score: 84.3445 bits (207), Expect = 1.803e-17
Identity = 55/171 (32.16%), Postives = 92/171 (53.80%), Query Frame = 2
Query:  293 TVAMILCIFFGPPQIRPHAGISTDVTECTDLGLEICRQGGSAVDSAIGSFLCVSIARPDLASLGGCGXXXXXXXXXXXXXXIDFSCVAPPNAQPEPIPLGYGISKS--VAMPGVLSGLKLAHKTYGKMNWTNILNLVTVKLQNGIKVTPEMQTVFKDPIFNSLSQNFRTNY 799
            TVA+++ I+FG PQI     + TD + CT LG+E+  + GS+VD+A+ + LC+ I  P  + LGG G ++VH+     S+ IDF   AP   + E +   +       V +PG++ GL  AH+ YG++ W+ +L       Q+G  VT ++     + +  + S  F   +
Sbjct:   46 TVALVMQIYFGDPQIFQQGAVVTDASSCTALGMEVLSKQGSSVDAAVAAALCLGIVAPHSSGLGGGGVMLVHDIRRNESHLIDFRESAPGALREEALQRSWDTKPGLLVGVPGMVKGLHEAHQLYGRLPWSQVLAFAAAVAQDGFNVTHDLAHALAEQLPPNASDRFLDTF 216          
BLAST of Gamma-glutamyltransferase 7 vs. UniProt/SwissProt
Match: sp|Q9UJ14|GGT7_HUMAN (Glutathione hydrolase 7 OS=Homo sapiens OX=9606 GN=GGT7 PE=1 SV=2)

HSP 1 Score: 141.739 bits (356), Expect = 8.256e-34
Identity = 141/511 (27.59%), Postives = 236/511 (46.18%), Query Frame = 2
Query:  293 TVAMILCIFFGPPQIRPHAGISTDVTECTDLGLEICRQGGSAVDSAIGSFLCVSIARPDLASLGGCGXXXXXXXXXXXXXXIDFSCVAPPNAQPEPIPLGYGISKS--VAMPGVLSGLKLAHKTYGKMNWTNILNLVTVKLQNGIKVTPEMQTVFKDPIFNSLSQNFRTNYQNWASGSVFTPSK-----ELLDILTALTKEGADSGIT-GSFANEMINLGFPWTGRLD-------TARELKPLTAVFGDYSLITAPLPSKGGLELAIAIEMLSKVVPMTALVKENTLFYHRLIESLKVAQSTTSFLGDS--DNGIEP---KLLSTQSIQNLINMMGTSTALPNKNYGPYYSLSNIEKGSGTHISIIDSSSLYVSLTVNLGSKFGSGIATKSGIVLNDAMRLFTSNDSTSLVPGIQIRNRTTSNNIAAPGKRPLNELAPLIVYNFKRKCGVRFAVGGDRGPQSTTGNLQMIMGAIYLDQKFCPSKDCMNLVKAGSRLRLYVNLLENTNQNNT 1765
            TVA+++ I+FG PQI     + TD   CT LG+E+  + GS+VD+A+ + LC+ I  P  + LGG G ++VH+     S+ IDF   AP   + E +   +       V +PG++ GL  AH+ YG++ W+ +L       Q+G  VT ++     + +  ++S+ FR  +    SG    P       +L ++L  L   G  +    G+   EM+       G +        +A   KP+  V+  + L+ +P P   G  L  A+ +L      + + +E  L  H + E+LK+A +  S LGD   D+ I      +LS      L   +  S A P     P Y L      +   + I+      V++  +L   FGSG+ T SGI+LN  M  F+  + T+        +  +  N   PGKRPL+ L P +V   +  CG   A+G +   +  +G  Q+++  + L++         NL  + +R RL+ +L  N  Q ++
Sbjct:  122 TVALVMQIYFGDPQIFQQGAVVTDAARCTSLGIEVLSKQGSSVDAAVAAALCLGIVAPHSSGLGGGGVMLVHDIRRNESHLIDFRESAPGALREETLQRSWETKPGLLVGVPGMVKGLHEAHQLYGRLPWSQVLAFAAAVAQDGFNVTHDLARALAEQLPPNMSERFRETF--LPSGRPPLPGSLLHRPDLAEVLDVLGTSGPAAFYAGGNLTLEMVAEAQHAGGVITEEDFSNYSALVEKPVCGVYRGH-LVLSPPPPHTGPALISALNILEGFNLTSLVSREQAL--HWVAETLKIALALASRLGDPVYDSTITESMDDMLSKVEAAYLRGHINDSQAAPAPLL-PVYELDGAP--TAAQVLIMGPDDFIVAMVSSLNQPFGSGLITPSGILLNSQMLDFSWPNRTA------NHSAPSLENSVQPGKRPLSFLLPTVVRPAEGLCGTYLALGANGAARGLSGLTQVLLNVLTLNR---------NLSDSLARGRLHPDLQSNLLQVDS 609          
BLAST of Gamma-glutamyltransferase 7 vs. UniProt/SwissProt
Match: sp|Q0V8L2|GGT7_BOVIN (Glutathione hydrolase 7 OS=Bos taurus OX=9913 GN=GGT7 PE=2 SV=1)

HSP 1 Score: 137.887 bits (346), Expect = 1.481e-32
Identity = 144/511 (28.18%), Postives = 236/511 (46.18%), Query Frame = 2
Query:  293 TVAMILCIFFGPPQIRPHAGISTDVTECTDLGLEICRQGGSAVDSAIGSFLCVSIARPDLASLGGCGXXXXXXXXXXXXXXIDFSCVAPPNAQPEPIPLGYGISKS--VAMPGVLSGLKLAHKTYGKMNWTNILNLVTVKLQNGIKVTPEM-QTVFKDPIFNSLSQNFRTNYQNWAS----GSVFTPSKELLDILTALTKEGADSGIT-GSFANEMINLGFPWTGRLD-------TARELKPLTAVFGDYSLITAPLPSKGGLELAIAIEMLSKVVPMTALVKENTLFYHRLIESLKVAQSTTSFLGDS--DNGIEP---KLLSTQSIQNLINMMGTSTALPNKNYGPYYSLSNIEKGSGTHISIIDSSSLYVSLTVNLGSKFGSGIATKSGIVLNDAMRLFTSNDSTSLVPGIQIRNRTTSNNIAAPGKRPLNELAPLIVYNFKRKCGVRFAVGGDRGPQSTTGNLQMIMGAIYLDQKFCPSKDCMNLVKAGSRLRLYVNLLENTNQNNT 1765
            TVA+I+ I+FG PQI     + TD   CT LG+E+  + GS+VD+A+ + LC+ I  P  + LGG G ++VH+     S+ IDF   AP   + E +   +       V +PG++ GL  AH+ YG++ W+ +L       Q+G  VT ++ Q + + P  N+ S  FR  +         GS+     +L  +L  L   G  +    G+   EM+       G +        +A   KP+  V+  + L+ +P P   G  L  A+ +L      + + +E  L  H + E+LK+A +  S LGD   D+ I      +LS          +  S A P     P Y L+     +   + I+      V++  +L   FGSG+ T SGI+LN  M  F+  + T+  P   + N         PGKRPL+ L P +V   +  CG   A+G +   +  +G  Q+++  + L++         NL  + +R RL+ +L  N  Q ++
Sbjct:  122 TVALIMQIYFGDPQIFHQGAVVTDAARCTSLGIEVLSKQGSSVDAAVAAALCLGIVAPHSSGLGGGGVMLVHDIRRNKSHLIDFRESAPGALREEALQRSWETKPGLLVGVPGMVKGLHEAHQLYGRLPWSQVLAFAAAVAQDGFNVTHDLAQALAEQPPPNA-SDRFRETFLPMGHPPLPGSLLR-RPDLAAVLEVLGTYGPAAFYAGGNLTLEMVAEAQHAGGVITEEDFSNYSALLEKPVCGVYRGH-LVLSPRPPHTGPALISALNILEGFNLTSLVSREQAL--HWVAETLKIALALASRLGDPIYDSTITESMDDMLSKVEAAYFRGQINDSQAAPVPLL-PIYELNGAP--TAAQVLIMGPDDFIVAMVSSLNRPFGSGLITPSGILLNSQMLDFSWPNRTANHPAPSLENSVQ------PGKRPLSFLLPTVVRPAEGLCGTYLALGANGAARGLSGLTQVLLNVLTLNR---------NLSDSLARGRLHPDLQTNLLQVDS 609          
BLAST of Gamma-glutamyltransferase 7 vs. UniProt/SwissProt
Match: sp|Q99JP7|GGT7_MOUSE (Glutathione hydrolase 7 OS=Mus musculus OX=10090 GN=Ggt7 PE=1 SV=2)

HSP 1 Score: 136.346 bits (342), Expect = 3.659e-32
Identity = 140/511 (27.40%), Postives = 234/511 (45.79%), Query Frame = 2
Query:  293 TVAMILCIFFGPPQIRPHAGISTDVTECTDLGLEICRQGGSAVDSAIGSFLCVSIARPDLASLGGCGXXXXXXXXXXXXXXIDFSCVAPPNAQPEPIPLGYGISKS--VAMPGVLSGLKLAHKTYGKMNWTNILNLVTVKLQNGIKVTPEMQTVFKDPIFNSLSQNFRTNYQNWAS----GSVFTPSK--ELLDILTALTKEGADSGITGSFANEMINLGFPWTGRLD-------TARELKPLTAVFGDYSLITAPLPSKGGLELAIAIEMLSKVVPMTALVKENTLFYHRLIESLKVAQSTTSFLGDS--DNGIEP---KLLSTQSIQNLINMMGTSTALPNKNYGPYYSLSNIEKGSGTHISIIDSSSLYVSLTVNLGSKFGSGIATKSGIVLNDAMRLFTSNDSTSLVPGIQIRNRTTSNNIAAPGKRPLNELAPLIVYNFKRKCGVRFAVGGDRGPQSTTGNLQMIMGAIYLDQKFCPSKDCMNLVKAGSRLRLYVNLLENTNQNNT 1765
            TVA+++ I+FG PQI     + TD + CT LG+E+  + GS+VD+A+ + LC+ I  P  + LGG G ++VH+     S+ IDF   AP   + E +   +       V +PG++ GL  AH+ YG++ W+ +L       Q+G  VT ++     + +  + S  F   +         GS+       E+LDIL         +G  G+   EM+       G +        +A   KP+  V+  + L+ +P P   G  L  A+ +L      + + +E  L  H + E+LK+A +  S LGD   D+ I      +LS     N    +  S A P     P Y L      +   + ++      V++  +L   FGSG+ T SGI+LN  M  F+  + T+        +  +  N   PGKRPL+ L P +V   +  CG   A+G +   +  +G  Q+++  + L++         NL  + +R RL+ +L  N  Q ++
Sbjct:  122 TVALVMQIYFGDPQIFQQGAVVTDASSCTALGMEVLSKQGSSVDAAVAAALCLGIVAPHSSGLGGGGVMLVHDIRRNESHLIDFRESAPGALREEALQRSWDTKPGLLVGVPGMVKGLHEAHQLYGRLPWSQVLAFAAAVAQDGFNVTHDLAHALAEQLPPNASDRFLDTFLPLGHPPLPGSLLRRPDLAEVLDILGTSGPAAFYNG--GNLTLEMVAEAQHAGGVITEEDFSNYSALTEKPVCGVYRGH-LVLSPPPPHTGPALISALNILEGFNLTSLVSREQAL--HWVAETLKIALALASRLGDPVYDSTITESMDDMLSKVEAANFRGHISDSQAAPAPLL-PVYELDGAP--TAAQVLVMGPDDFIVAMVSSLNRPFGSGLLTPSGILLNSQMLDFSWPNRTA------NHSAPSLENSVQPGKRPLSFLLPTVVRPAEGLCGTYLALGANGAARGLSGLTQVLLNVLTLNR---------NLSDSLARGRLHPDLQSNLLQVDS 609          
BLAST of Gamma-glutamyltransferase 7 vs. UniProt/SwissProt
Match: sp|Q99MZ4|GGT7_RAT (Glutathione hydrolase 7 OS=Rattus norvegicus OX=10116 GN=Ggt7 PE=1 SV=2)

HSP 1 Score: 134.806 bits (338), Expect = 1.227e-31
Identity = 143/520 (27.50%), Postives = 237/520 (45.58%), Query Frame = 2
Query:  293 TVAMILCIFFGPPQIRPHAGISTDVTECTDLGLEICRQGGSAVDSAIGSFLCVSIARPDLASLGGCGXXXXXXXXXXXXXXIDFSCVAPPNAQPEPIPLGYGISKS--VAMPGVLSGLKLAHKTYGKMNWTNILNLVTVKLQNGIKVTPEMQTVFKDPIFNSLSQNFRTNYQNWAS----GSVFTPSK--ELLDILTALTKEGADSGITG--SFAN------EMINLGFPWTGRLDTAREL--------KPLTAVFGDYSLITAPLPSKGGLELAIAIEMLSKVVPMTALVKENTLFYHRLIESLKVAQSTTSFLGDS--DNGIEP---KLLSTQSIQNLINMMGTSTALPNKNYGPYYSLSNIEKGSGTHISIIDSSSLYVSLTVNLGSKFGSGIATKSGIVLNDAMRLFTSNDSTSLVPGIQIRNRTTSNNIAAPGKRPLNELAPLIVYNFKRKCGVRFAVGGDRGPQSTTGNLQMIMGAIYLDQKFCPSKDCMNLVKAGSRLRLYVNLLENTNQNNT 1765
            TVA+++ I+FG PQI     + TD + CT LG+E+  + GS+VD+A+ + LC+ I  P  + LGG G ++VH+     S+ IDF   AP   + E +   +       V +PG++ GL  AH+ YG++ W+ +L       Q+G  VT ++     + +  + S  F   +         GS+       E+LDIL          GI+G  +F N      EM+       G + T  +         KP+  V+  + L+ +P P   G  L  A+ +L      + + +E  L  H + E+LK+A +  S LGD   D+ I      +LS     N    +  S A P     P Y L      +   + ++      V++  +L   FGSG+ T SGI+LN  M  F+  + T+        +  +  N   PGKRPL+ L P +V   +  CG   A+G +   +  +G  Q+++  + L++         NL  + +R RL+ +L  N  Q ++
Sbjct:  122 TVALVMQIYFGDPQIFQQGAVVTDASCCTALGMEVLSKQGSSVDAAVAAALCLGIVAPHSSGLGGGGVMLVHDIRRNESHLIDFRESAPGALREEALQRSWDTKPGLLVGVPGMVKGLYEAHQLYGRLPWSQVLAFAAAVAQDGFNVTHDLAHALAEQLPPNASDRFLETFLPLGHPPLPGSLLRRPDLAEVLDIL----------GISGPAAFYNGGNLTLEMVA-EVQHAGGVMTEEDFSNYSALTEKPVCGVYRGH-LVLSPPPPHTGPALISALNILEGFNLTSLVSREQAL--HWVAETLKIALALASRLGDPVYDSTISESMDDMLSKVEAANFRGHISDSQAAPAPLL-PVYELDGAP--TAAQVLVMGPDDFIVAMVSSLNRPFGSGLLTPSGILLNSQMLDFSWPNRTA------NHSAPSLENSVQPGKRPLSFLLPTVVRPAEGLCGTYLALGANGAARGLSGLTQVLLNVLTLNR---------NLSDSLARGRLHPDLQSNVLQVDS 609          
BLAST of Gamma-glutamyltransferase 7 vs. UniProt/SwissProt
Match: sp|P0DPU3|TX14A_SCODE (Scoloptoxin SSD14 OS=Scolopendra dehaani OX=2609776 PE=1 SV=1)

HSP 1 Score: 129.413 bits (324), Expect = 4.082e-30
Identity = 135/526 (25.67%), Postives = 229/526 (43.54%), Query Frame = 2
Query:  335 IRPHAGISTDVTECTDLGLEICRQGGSAVDSAIGSFLCVSIARPDLASLGGCGXXXXXXXXXXXXXXIDFSCVAPPNAQPEPIPLGYGISK----SVAMPGVLSGLKLAHKTYGKMNWTNILNLVTVKLQNGIKVTPEMQTVFKDPIFNSL-SQNFRTNYQNWASGSVFTPSK-----ELLDILTALTKEGADSGITGSFANEMINLGFPWTGRLDTARELKPLTAVF---------GDYSLITAPLPSKGGLELAIAIEMLSKVVPMTALVKE---NTLFYHRLIESLKVAQSTTSFLGDSD----NGIEPKLLSTQSIQNLINMMGTSTALPNKNYGPYYSLSNIEKGSGTHISIIDSSSLYVSLTVNLGSKFGSGIATKS-GIVLNDAMRLFTSNDSTSL--VPGIQIRNRTTSNNIAAPGKRPLNELAPLIVYNFKRKCGVRFAVGGDRGPQSTTGNLQMIMGAIYLDQKFCPSKDCMNLVKAGSRLRLYVNLLENTNQNNTATVYFDQNFPENFKTELTTV 1825
            I   + +++D   C + G  + RQ GSAVD+AI + LC+ +  P  + +GG   +V+++ S+     ID    AP  A  +       +S     S+A+PG L G+ LAH+ +GK++W  +        + G  V  E+    ++   + L S   +  + +  SG +   +      +L + L  + K GAD    G  A ++IN      G + TA +LK    V          G  +L + P PS G + L+  + +L K     A V +    TL YHR +E+LK A +  + LGD      + +  +L S   I+     +         +YG    L+  + G+  HIS++      V +T  +   FGSG+ + S G++LND M  F++ D  ++  VP        +  N   PGKRP +   P I  N  +   V  A+G   G + T+      M  ++L +         N+ +A    RL+  LL +        + ++  FP     +L  +
Sbjct:   41 IYDESAVASDAVPCAEAGQSMLRQKGSAVDAAIATLLCIGVYNPQSSGIGGGSFMVIYDRSTRTPEVIDAREEAPAAATQKMFKGDKKLSSEGGLSIAVPGELRGMALAHERHGKLDWETLFQPAIRLAKEGFPVGSELAMALREQRSHILNSPTLKAVFTDPVSGDILKENDIVIRTKLGETLEKIAKNGADEFYEGQVAKDLIN-DIKSFGGIITAEDLKNYQPVLKNATVAHLSGCLTLYSVPPPSSGYI-LSFILRVLDKFHFSKASVSDIENATLTYHRFLETLKYAYAYRTKLGDERIENVSSVIAELTSEDVIEKTKQKIEDGKTYEPLHYGA--QLATNDHGT-AHISVVSREGDAVVVTTTINYWFGSGLRSPSTGVILNDEMDDFSAPDIQNIYGVP-------PSKANFIVPGKRPQSSTCPSIFVN--KGGDVVMAIGASGGTRITSSVSLTSMRVLWLGR---------NIKEAIDEPRLHHQLLPD-------EIEYESKFPNEILEKLKAI 536          
BLAST of Gamma-glutamyltransferase 7 vs. TrEMBL
Match: A0A5J4N933 (Gamma-glutamyltranspeptidase / glutathione hydrolase OS=Paragonimus westermani OX=34504 GN=DEA37_0000243 PE=4 SV=1)

HSP 1 Score: 190.66 bits (483), Expect = 5.766e-49
Identity = 152/473 (32.14%), Postives = 242/473 (51.16%), Query Frame = 2
Query:  293 TVAMILCIFFGPPQIRPHAGISTDVTECTDLGLEICRQG-GSAVDSAIGSFLCVSIARPDLASLGGCGXXXXXXXXXXXXXXIDFSCVAPPNA------QPEPIPLGYGISKSVAMPGVLSGLKLAHKTYGKMNWTNILNLVTVKLQNGIKVTPEMQTVFKDPIFNSLSQNFRTNYQNWA--SGSVFTPSKELLDILTALTKEGADSGITG-----SFANEMINLGFPWTGR-LDTAR--ELKPLTAVFGDYSLITAPLPSKGG---LELAIAIEMLSKVVPMT--AL----VKENTLFYHRLIESLKVAQSTTSFLGD-SDNGI-------EPKLLSTQSIQNLINMMGTSTALPNKNYGPYYSLSNIEKGSGTHISIIDSSSLYVSLTVNLGSKFGSG-IATKSGIVLNDAMRLFTS----NDSTSLVPGIQIRNRTTSNNIAAPGKRPLNELAPLIVYNFKRKCGVRFAV 1594
            TVA+I+CIF GP Q++PH  ++++   C+  GLE+  Q  G+AVDSA+ + LC+++ RPD+ASL GCG ++V N ++  S+  DF C AP N       +PE +         V +PG L GL+LAH  +GK  W +++   +    NG +    +    K  + +S      T   +    SG ++TP   L D+L  L + G+++  +G     SFAN +++    W  + L+  +  + KP+   F  ++L   P PS GG   L L    ++ + V P++  AL    V       HRLIE  K A+++   LGD SD+ I       + +L S  S + L+N +  S  LP    G     S++  G  T I   DS+ L V + + LG+ FGSG +   +G+ LN A+RLF++    N S  ++            N+ A G+RPL  ++P+ +   +RKCG+R  V
Sbjct:   73 TVALIICIFAGPSQVQPHGAVASESGYCSRFGLELMEQDDGNAVDSAVATALCLAVVRPDVASLAGCGMMLVKNRNTQHSHLYDFMCSAPSNPPAADLNRPETL---------VGLPGFLKGLQLAHSQFGKRPWADLVRGASYAAANGFQPDTALLEAAK-AVKSSNPSGAGTIVDSLVTLSGGIYTPPSALKDVLRTLAERGSETFYSGGTDSTSFANRLLSFMVGWQAKDLNDYKVNQPKPIQMGFAGFTLEAFPAPSSGGPFLLSLLGNTDLKNAVAPLSRKALAENDVNATATVLHRLIEFSKAAEASVLTLGDISDSSIADEATRLQNQLFSPTSRKALVNSVDDSGTLPVS--GSLQRESDVAIGD-TGIVATDSAYLTVVMNLFLGAPFGSGLVVPNTGVHLNAALRLFSNATLVNSSKPIL------------NMIASGRRPLVPVSPVYLSTTQRKCGIRVGV 520          
BLAST of Gamma-glutamyltransferase 7 vs. TrEMBL
Match: A0A1D1UY36 (Uncharacterized protein OS=Ramazzottius varieornatus OX=947166 GN=RvY_03377-1 PE=4 SV=1)

HSP 1 Score: 189.889 bits (481), Expect = 7.620e-48
Identity = 139/481 (28.90%), Postives = 233/481 (48.44%), Query Frame = 2
Query:  293 TVAMILCIFFGPPQIRPHAGISTDVTECTDLGLEICRQGGSAVDSAIGSFLCVSIARPDLASLGGCGXXXXXXXXXXXXXXIDFSCVAPPNAQPEPI-PLGYGISKSVAMPGVLSGLKLAHKTYGKMNWTNILNLVTVKLQNGIKVTPEMQTVFKDPIFNSLSQ---NFRTNYQNWASGSVFTPSKELL-----DILTALTKEGADSGITGSFANEMIN--------LGFPWTGRLD-TARELKPLTAVFGDYSLITAPLPSKGGLELAIAIEMLSKVVPMTALVKENTLFYHRLIESLKVAQSTTSFLGDS--DNGIE---PKLLSTQSIQNLINMMGTSTALPNKNYGPYYSLSNIEKGSGTHISIIDSSSLYVSLTVNLGSKFGSGIATKSGIVLNDAMRLFTSNDSTSLVPGIQIRNRTTSNNIAAPGKRPLNELAPLIVYNFKRKCGVRFAVGGDRGPQSTTGNLQMIMGAIYLDQ 1666
            TV ++  I +GPPQ+ PH  ++TDV  C+ +GL++ ++GGSAVD+AI +  C+ +  P  + +GG G  +++NH +     +DF   AP   + E +  L    + +V +PG L GL   +  YGK+ W+ +L+      ++G  +T  +   F    F  L +   + R     +  G       +++     D+L  +   G +   TG    E+++        L      R + TARE  PL   +  + ++T P PS G   L  A+ +L     M         ++HR+IE+LK   +  S LGD   + G+E    +++     + L  ++   + LP+  Y    +    +    TH+S++D++ LYVS+T  +   FG GI T  GIVLND +R F +N                + N A  GKRPL+ + P IV++ KR CG+R ++GG  G    +G L ++M  + L Q
Sbjct:   99 TVGLVAHIIWGPPQVLPHGAVATDVPACSKIGLDVLKEGGSAVDAAIAALFCLQVVNPQASGIGGGGLALIYNHKNKEKFYVDFRETAPAAFKAEMMDQLDSKPALAVGVPGELKGLHDIYSKYGKLRWSKLLSPAIHLARSGFNMTGALHEDFWR--FEKLKRFPTSKRLEQLLYPDGKKLQLETKIVRNNFADMLERIAYSGVEEFYTGKLGQEIVDELKEMGGILTMEDLARYNATARE--PLFTTYNGFQVVTGPPPSSGAAVL-FALNLLEG-YNMNHTHATTPTYWHRMIEALKFESACRSRLGDPHFEPGVENIAKEMIDKSYAEKLRLLIRDDSVLPHSEYLTNLTAKQPDAKGTTHVSVLDTNELYVSITSTVNDFFGGGIMTSHGIVLNDELRDFAANTEGD-----------NNANKALAGKRPLSSMTPTIVFHPKRACGLRMSIGGSNGTHIPSGVLGVLMNILTLGQ 562          
BLAST of Gamma-glutamyltransferase 7 vs. TrEMBL
Match: A0A210Q1U8 (Gamma-glutamyltranspeptidase 1 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT02018 PE=4 SV=1)

HSP 1 Score: 185.267 bits (469), Expect = 2.806e-46
Identity = 153/557 (27.47%), Postives = 261/557 (46.86%), Query Frame = 2
Query:  320 FGPPQIRPHAGISTDVTECTDLGLEICRQGGSAVDSAIGSFLCVSIARPDLASLGGCGXXXXXXXXXXXXXXIDFSCVAPPNAQPEPIPLGYGIS----KSVAMPGVLSGLKLAHKTYGKMNWTNILNLVTVKLQNGIKVTPEMQTVF-----KDPIFNS-LSQNFRTNYQNWASGSVFTPSKELLDILTALTKEGADSGITGSFANEMINLGFPWTGRLDTARE---------LKPLTAVFGDYSLITAPLPSKGGLELAIAIEMLSKVVPMTALVKENTLFYHRLIESLKVAQSTTSFLGDSDNGIEPKLLSTQSIQNLINMMGTSTA-------LPNKNYGPYYSLSNIEKGSGTHISIIDSSSLYVSLTVNLGSKFGSGIATKSGIVLNDAMRLFTSNDSTSLVPGIQIRNRTTSNNIAAPGKRPLNELAPLIVYNFKRKCGVRFAVGGDRGPQSTTGNLQMIMGAIYLDQKFCPSKDCMNLVKAGSRLRLYVNLLENTNQNNTATVYFDQNFPENFKTELTTVYQHSNFNISKAQNSINSIGKVQYEIQGFA 1912
            FG PQ+  +AG++ DV  C+D+G +I R GG+AVD+ + + LCV +     + LGG G +++H+H S VS+ IDF  +AP  A P   P G G S     +V +PG L G++ AH  +GK++W N++       +NG KVTP M  VF     K+  F   L + +    +++          +L + L  + + GAD+   G  +  +I+     T      RE          + +   +  +++++ P P+ G + L I + +L     +T   K +   +HR++E+LK A      LGD D        ST  ++N   M+ +          + N         + ++KG+ +HISIID+  L VS+T  +   FGS + T +GI+LND M  F      S  P  Q+       N   PGKRPL+ +AP ++ N  R C +R  VG   G +  +G ++ ++  +   +         NL KA    R++ + +    +       ++  F ++    LT +  H+     +  N + ++ KV   +Q  +
Sbjct:  100 FGEPQVGGNAGVAADVPLCSDMGRDILRDGGNAVDAMVTTMLCVGVVDAQSSGLGGGGFMLIHDHKSHVSSVIDFREMAPAMASPGMYP-GKGQSLMGGLAVGVPGELKGMQTAHNKHGKLSWQNVVQPAANLARNGFKVTPSMAKVFTEGKVKESEFTGMLGEIYLDENRDFVKQGTLISRPQLANTLDIIAEHGADAFYDGQLSQSIIDAVSNATPPGIMTREDLKNYDVVIREAVKTTYNGHTILSTPAPASGSVLLFI-MNVLEG-FKLTKADKNSVQAFHRIVETLKFAFEKQQQLGDPDKD------STGQVKNTTEMLASKAEAKKIRSLISNVTMDETGQFNKLDKGT-SHISIIDAQELMVSVTTTVNMWFGSRVMTSTGILLNDQMADFFIPTPGSSQPSNQL-------NAIGPGKRPLSNMAPTMLLNEDRPCALRMVVGAANGSRIISGVVETLLNVVSFGE--------TNLTKAILEPRIHYDAISRDTE-------YEPGFKDSIVKGLTDL-GHTMVATVEGINIVQAVSKVNNTLQAVS 623          
BLAST of Gamma-glutamyltransferase 7 vs. TrEMBL
Match: A0A310U8P0 (Uncharacterized protein OS=Xenopus laevis OX=8355 GN=XELAEV_18004671mg PE=4 SV=1)

HSP 1 Score: 184.111 bits (466), Expect = 1.116e-45
Identity = 153/528 (28.98%), Postives = 254/528 (48.11%), Query Frame = 2
Query:  293 TVAMILCIFFGPPQIRPHAGISTDVTECTDLGLEICRQGGSAVDSAIGSFLCVSIARPDLASLGGCGXXXXXXXXXXXXXXIDFSCVAPPNAQPEPIPLGYGISKS---VAMPGVLSGLKLAHKTYGKMNWTNILNLVTVKLQNGIKVTPEMQTVFKDPIFNSLSQNFRTNY---QNWASGSVFTPSKELLDILTALTKEGADSGITGSFANEMINLGFPWTGRLDTARE---------LKPLTAVFGDYSLITAPLPSKGGLELAIAIEMLSKVVPMTALVKENTLFYHRLIESLKVAQSTTSFLGDSDN-----GIEPKLLSTQSIQNLINMMGTSTALPNKNYGPYYSLSNIEKGSGTHIS-IIDSSSLYVSLTVNLGSKFGSGIATKSGIVLNDA-MRLFTSNDSTSLVPGIQIRNRT---TSNNIAAPGKRPLNELAPLIVYNFKRKCGVRFAVGGDRGPQSTTGNLQMIMGAIYLDQKFCPSKDCMNLVKAGSRLRLYVNLLENTNQNNTATVYFDQNFPEN 1801
            T+A+I+ I+FG PQI     + +D + CT LG+E+  + GS+VD+AI + LC+ I  P  + +GG G +++H+  + VSN IDF   A P+A  E +   Y   +    V +PG+L GL  AH+ YGK++W +++++     + G  VT ++     + +  + S  F   +           F    +L  IL ++ KEG ++  + +   EM++    + G +  A E          KP+  V+  + +   P P+  GL L  A+ +L          + + L  H + E+LK+A +T S LGD  +     G   ++L    I  L   +  S A P ++Y P+Y   N+E GS +  + ++      V++  +L   FGSGI T SGI+LN   +  F SN S          NRT   + +N   PGKRPL+ L P +V      CG   ++GG  G  + TG  Q+++  +  ++         NL  + S  RL+ +L        T+ +  D +F EN
Sbjct:  124 TIALIMQIYFGDPQIFHQGAVVSDASRCTALGIEVLEKRGSSVDAAIVTTLCLGIVNPHTSGIGGGGVMLIHDIRNNVSNVIDFRETA-PSAIHEELVRRYWKERPGILVGVPGMLKGLSKAHEMYGKLSWQDVISMAAEVARGGFNVTHDLAKAINESMGQTFSNAFLETFLPDDKPLMAETFIRRPDLAAILYSVAKEGVEAFYSSNLTQEMVSEVNAYGGVM--AEEDFSNYSVLVEKPMETVYQGHLVFVPPAPN-AGLALITALNILEGANLTKQTPRASAL--HWIAETLKIALATASTLGDPTHDPSMPGFVKEMLRESEINFLRQRINESHAAPAEHYMPFY---NLETGSDSSQALVVGPDDFIVAVVSSLNRPFGSGIMTSSGILLNSQILDFFWSNRS----------NRTSFPSPSNTVEPGKRPLSFLLPTVVRPAHGLCGTYLSLGGSNGDHALTGITQVLLNVLSFNK---------NLSDSVSNGRLHPDL-------QTSLLEVDGDFSEN 616          
BLAST of Gamma-glutamyltransferase 7 vs. TrEMBL
Match: A0A1S3JS09 (glutathione hydrolase 1 proenzyme-like OS=Lingula unguis OX=7574 GN=LOC106175585 PE=4 SV=1)

HSP 1 Score: 182.956 bits (463), Expect = 1.717e-45
Identity = 146/479 (30.48%), Postives = 240/479 (50.10%), Query Frame = 2
Query:  293 TVAMILCIFFGPPQIRPHAGISTDVTECTDLGLEICRQGGSAVDSAIGSFLCVSIARPDLASLGGCGXXXXXXXXXXXXXXIDFSCVAPPNAQPEPIPLGYGISKSVAMPGVLSGLKLAHKTYGKMNWTNILNLVTVKLQNGIKVTPEMQTVFKDPIFNSLSQNFRTNYQN-WASGSVFTPSKE--------LLDILTALTKEGADSGITGSFANEMINLGFPWTGRLDT-------ARELKPLTAVFGDYSLITAPLPSKGGLELAIAIEMLSKVVPMTALVKENTLFYHRLIESLKVAQSTTSFLGDSDNGIEPKLLS---TQSIQNLINM-MGTSTALPN-KNYGPYYSLSNIEKGSGTHISIIDSSSLYVSLTVNLGSKFGSGIATKSGIVLNDAMRLFTSNDSTSLVPGIQIRNRTTSNNIAAPGKRPLNELAPLIVYNFKRKCGVRFAVGGDRGPQSTTGNLQMIMGAIYLDQ 1666
            T+A+IL I+ G PQ+ PH  +++D   C+ +G+ I ++GG+AVD+AI +  C+ +  P  + LGG G ++VH+H +M S+  +F   AP  A  + +       K VA+PG L GL+ A+ TYG + W +++       +NG KV+ ++  V    +  SL+++F   ++  + + S   P KE        L + L  +  +G  +   GS  N++I     + G + T         + +PL   +G Y + ++  P+ G + L + + +LS+   MTA     TL YHRL E+ K   +  S LGDS+     K++      S  NL    +  S  LP+  +YG   +L  +  GS  H+S+       VS+T  LG  FGS I T SGI+LN  M  F+S          Q  ++   NN+ AP  RPL  +AP + Y+  + C +R   GG  G ++  G +Q ++  +   Q
Sbjct:  104 TLALILQIYLGAPQVPPHGVVTSDNPVCSQIGVNIMQRGGTAVDAAIAAMFCLGVVHPHNSGLGGGGVMLVHSHMTMKSDVFNFLSSAPSAATGDMLNNNSTKGKFVAVPGELKGLRQAYDTYGSLPWADLVKPAADLARNGFKVSKDLAHVLNTHL--SLNEDFDAEFKKTFTNSSSGVPYKEGDTMRLENLANTLDIIASQGEGALYGGSLGNDIIGKLQSYNGIITTEDLTQYSVSQEQPLEMAYGGYRVWSSAAPTAGPVLLYM-LNILSQ-FEMTAKDFNTTLMYHRLAETFKFGYNKMSQLGDSNKETVEKVVQEMFNSSAANLTRYTIKDSGVLPSAADYGTANTLKVMTGGS--HVSVFGPKEQMVSVTGCLGQWFGSKIMTSSGIILNAGMSAFSS----------QTDSKPNPNNVVAPNMRPLTGMAPAVFYSHDKPCSLRATFGGTNGTETVAGLVQALLNLVTFSQ 566          
BLAST of Gamma-glutamyltransferase 7 vs. Ensembl Cavefish
Match: GGT7 (gamma-glutamyltransferase 7 [Source:HGNC Symbol;Acc:HGNC:4259])

HSP 1 Score: 140.969 bits (354), Expect = 1.309e-34
Identity = 118/401 (29.43%), Postives = 192/401 (47.88%), Query Frame = 2
Query:  293 TVAMILCIFFGPPQIRPHAGISTDVTECTDLGLEICRQGGSAVDSAIGSFLCVSIARPDLASLGGCGXXXXXXXXXXXXXXIDFSCVAPPNAQPEPIPLGYGISKS----VAMPGVLSGLKLAHKTYGKMNWTNILNLVTVKLQNGIKVTPEMQTVFKDPIFNSLSQNFRTNY----QNWASGSVFTPSKELLDILTALTKEGADSGITGSFANEMINLGFPWTGRLDTARELKPLTAVFGDYS----LITAPLPSKGGLELAIAIEMLSKVVPMTALVKENTLFYHRLIESLKVAQSTTSFLGD-----SDNGIEPKLLSTQSIQNLINMMGTSTALPNKNYGPYYSLSNIEKGS-GTHISIIDSSSLYVSLTVNLGSKFGSGIATKSGIVLNDAMRLFT 1441
            TVA+I+ I+FG PQI     + TDV  CT LG ++  Q GS+VD+AI + LC+ I  P  + +GG G ++VH+     S  IDF    P   + E +     + +     VA+PG+LSGL  AH+ YGK  W  ++++     +NG  +T ++          ++S+ FR  +    Q+  SG +FT   +L  +L  +   G     +G+ + EM             +    P T    +YS    ++ AP P   G  L  A+ +L      +   + +T  +H + E+LK+A S  S +GD     S + +  ++LS         M+  S A P  +Y P Y+L   E+G+  + + ++      VS+  +L   FGS I T SGI+LN  +  F+
Sbjct:  122 TVALIMQIYFGDPQIYNQGAVVTDVARCTSLGFDVLGQQGSSVDAAIAAALCLGIIHPHASGIGGGGVMLVHDIRKNESRVIDFRETVPSGLREEML---LSVEQKPGLLVAVPGMLSGLYQAHQLYGKRPWKEVISMAADVARNGFNITHDLADALSKVKDQNVSEAFRELFLPDGQSPLSG-LFTRRLDLAALLDRIAANGISEFYSGNLSQEM------------ASTVQHPHTFTSTNYSKCHQVMAAP-PPHAGTALITALNILEGYNISSQAQRNST--HHWIAETLKIALSLASGIGDPMFDPSVSEVVTQMLSKTQAGVFRQMINDSHAAPPGHYTPSYAL---EEGTVASQVMVMGPDDFIVSVMSSLNQPFGSRIVTPSGILLNSQILDFS 500          
BLAST of Gamma-glutamyltransferase 7 vs. Ensembl Cavefish
Match: si:ch73-59p9.2 (gamma-glutamyltranspeptidase 1 [Source:NCBI gene;Acc:103031919])

HSP 1 Score: 128.257 bits (321), Expect = 1.091e-30
Identity = 130/520 (25.00%), Postives = 236/520 (45.38%), Query Frame = 2
Query:  347 AGISTDVTECTDLGLEICRQGGSAVDSAIGSFLCVSIARPDLASLGGCGXXXXXXXXXXXXXXIDFSCVAPPNAQPEPIPLGYGISK----SVAMPGVLSGLKLAHKTYGKMNWTNILNLVTVKLQNGIKVTPEMQTVF---KDPIFNSLS--QNFRTNYQNWASGSVFTPSKELLDILTALTKEGADSGITGSFANEMINLGFPWTGRLDTAREL---------KPLTAVFGDYSLITAPLPSKGGLELAIAIEMLSKV---VPMTALVKENTLFYHRLIESLKVAQSTTSFLGDSDNGIEPKLLSTQSI----------QNLINMMGTSTALPNKNYGPYYSLSNIEKGSGT-HISII--DSSSLYVSLTVNLGSKFGSGIATKS-GIVLNDAMRLFTSNDSTSLVPGIQIRNRTTSNNIAAPGKRPLNELAPLIVYNFKRKCGVRFAVGGDRGPQSTTGNLQMIMGAIYLDQKFCPSKDCMNLVKAGSRLRLYVNLLENTNQNNTATVYFDQNFPEN 1801
            A ++ D  +C+++G +I ++ GSAVD++I + LCV +       +GG     ++N S+    +ID    AP NA  +       +S+    S+A+PG + G ++AH+ +G++ W  +        + G  +   +       K+ I   L+  + F  + +N    +       L D    + +EG D    G+ A  +++      G + T  +L          PL    G+Y++     PS G + LA+ + ++          +  ++ TL YHR++E+ + A +  S LGD      P+ L+   +           N+ + +   T  P+  Y P Y + +     GT H+S+I  D S++  + T+NL   FGS + ++S GI+ ND M  F+S   T+   G  I    + NN   PGKRPL+ + P I+++   K  V+  VG   G + TT    +I+ +++ +          +L KA +  R++       NQ N      +QNF ++
Sbjct:   44 AAVAADAGKCSEIGRDILKRNGSAVDASIAALLCVGLLNAHSMGIGGGLFFTIYNASTGKVETIDARETAPMNATEDMFGNNTQLSRKGGLSIAIPGEIRGYEMAHRRHGRLPWKELFEPSITLARKGFPIGRALANAIEKNKESIQGDLAMCEVFCDSDKNILKENAIVRFPRLADTYQKIAEEGPDVFYNGTMAQTIVD-DIQAAGGIITLEDLLEYKPVLNESPLKLHVGEYTMHVPDAPSSGPV-LALILNIVDGYNFSDRSVSTAEKKTLTYHRIVEAFRFAYAKRSRLGD------PRYLNITDLIHNMTSDYFADNIRSKITDDTTHPDNYYEPEYFVPD---SHGTAHLSVIAEDGSAVAATSTINL--YFGSKVMSRSTGIIFNDEMDDFSSPYITN---GFGI--PPSPNNFIQPGKRPLSSMCPTIIFDKHNK--VKMVVGASGGTKITTATALVILNSLFFN---------YDLKKAVTEPRVH-------NQLNPNKTVVEQNFEQS 527          
BLAST of Gamma-glutamyltransferase 7 vs. Ensembl Cavefish
Match: ggt1b (gamma-glutamyltranspeptidase 1-like [Source:NCBI gene;Acc:103029848])

HSP 1 Score: 112.464 bits (280), Expect = 1.735e-25
Identity = 124/486 (25.51%), Postives = 218/486 (44.86%), Query Frame = 2
Query:  347 AGISTDVTECTDLGLEICRQGGSAVDSAIGSFLCVSIARPDLASLGGCGXXXXXXXXXXXXXXIDFSCVAPPNAQPE------PIPLGYGISKSVAMPGVLSGLKLAHKTYGKMNWTNILNLVTVKL------------------QNGIKVTPEMQTVFKDPIFNSLSQNFRTNYQNWASGSVFTPSKELLDILTALTKEGADSGITGSFANEMINLGFPWTGRLDTARELK---------PLTAVFGDYSLITAPLPSKGGLELAIAIEMLSKVVPMTALV---KENTLFYHRLIESLKVAQSTTSFLGDSDNGIEPKLLS-TQSIQNLI---------NMMGTSTALPNKNYGPYYSLSNIEKGSGTHISIIDSSSLYVSLTVNLGSKFGSGIATKS-GIVLNDAMRLFTS---NDSTSLVPGIQIRNRTTSNNIAAPGKRPLNELAPLIVYNFKRKCGVRFAVGGDRGPQSTTGNLQMIMGAI 1654
            A ++ D   C+++G ++ ++GGSAVD+AI   LC  +     A +GG   L ++N  +    +ID    AP NA  +       + L  G+  ++A+PG + G +LAHK +GK+ W  +  L ++KL                  +N I+    + +VF D     L +N    +             +L D    +  +G  +   G+ A  +I      +G + T  +L+         PL A  GD+++ T   PS G + L   + +LS     +  V   ++  L  HR++E+ K A +  S LGD      P  L+ T+ I N+          + +   +      Y P + + + + G+ +HIS++      V+ T  +   FGS + + S GI+LN+ M  F+S    +S  + P        + NN   P KRP++ + P I+++   K  V+  VGG  G + TT   Q+I+ ++
Sbjct:   42 AAVAADAGTCSEIGRDVLQKGGSAVDAAIAGLLCAGLMNAHSAGIGGGLFLTIYNAKTGRVETIDARETAPANASKDMFGNNTDLSLTGGL--AIAVPGEIRGYELAHKRHGKLPWRELF-LPSIKLARDGFPLGKALAGAIYSNRNIIRNDKTLCSVFCDESGAILKENNTIRFT------------KLADTFQEIADKGPSAFYEGTIAENLIKDIRNASGII-TLEDLQSYTPVLNESPLQAYVGDFTMYTPNAPSSGPI-LTFILNILSGFGFSSNSVSSTEKKILSTHRIVEAFKFAYAKRSVLGD------PSFLNITEFIHNITSKSFAEGIRHKITDDSTQQESYYEPEFFVPD-DHGT-SHISVLAEDGSAVAATSTINRYFGSKVMSASTGIILNNEMDDFSSPLITNSFGVPP--------SPNNFIKPHKRPMSSMCPAILFDKNHK--VKMVVGGSGGTKITTSVAQVILNSL 492          
BLAST of Gamma-glutamyltransferase 7 vs. Ensembl Cavefish
Match: ggt5a (gamma-glutamyltransferase 5a [Source:ZFIN;Acc:ZDB-GENE-080226-1])

HSP 1 Score: 109.768 bits (273), Expect = 1.321e-24
Identity = 117/464 (25.22%), Postives = 201/464 (43.32%), Query Frame = 2
Query:  347 AGISTDVTECTDLGLEICRQGGSAVDSAIGSFLCVSIARPDLASLGGCGXXXXXXXXXXXXXXIDFSCVAPPNAQPEPI-PLGYGISKS-----VAMPGVLSGLKLAHKTYGKMNWTNILNLVTVKLQ-NGIKVTPEMQTVFKDPIFN--SLSQNFRTNYQN--WASGSVFTPSKELLDILTALTKEGADSGITGSFANEMINLGFPWTGRLDTARELKPL--------TAVFGDYSLITAPLPSKGGLELAIAIEMLSKVVPMTALV--KENTLFYHRLIESLKVAQSTTSFLGDSD--NGIEPKLLSTQSIQNLINMMGTSTALPNKNYGPYYSLSNIEKGSGTHISIIDSSSLYVSLTVNLGSKFGSGIAT-KSGIVLNDAMRLFTSNDSTSLVPGIQIRNRTTSNNIAAPGKRPLNELAPLIVYNFKRKCGVRFAVGGDRGPQSTTGNLQMIMGAIYLDQ 1666
            A ++ D   C+ +G  I ++GGSAVD AI + +C SI  P    +GG G +      +     I+    AP   +P+ +   G    ++     + +PG + G + AH+ YG++ W  +    T+KL   G ++   +  +   P FN  SL +   T+ +      G++    K L + L  +  +G D   TG  A  +I+      G L T  +LK          T    DY++   P P+ G +   I   M    +  T+L   +E  L YHR +E+ K A     F+ D    +  E   +      + I  M +S    +  Y  Y     ++    TH+S++D + + VS+T  +   FGS + + K+GI+LN+ +  F            QI          +PG++P +  AP+I+++   K  V   +GG  G   TTG    +M  ++  +
Sbjct:  120 AAVAADSLTCSRIGRTILQEGGSAVDGAIAALICTSIINPQSMGIGG-GVIFTIMERNGKVKIINARETAPKQVKPDLLSECGSSTQQTSGPQWIGVPGEIRGYERAHRLYGRLPWARLFQ-PTIKLATEGFELPTVLSRIL--PFFNGTSLMKELFTDAEGKMLKEGNIVKFEK-LAETLKRIANKGPDEFYTGETATALISDVQEAGGTL-TLEDLKSFEVSESEAWTVPLRDYTMYFPPPPAGGAVLSFILNVMQGYNLRRTSLQNKEERVLTYHRYVEACKFANGLKKFMRDPKISSASEASAMIEDDFADHIRKMISSNTTHDAQY--YNVTPGLDTQGTTHVSVLDENGMAVSVTSTINHIFGSRVYSPKTGIILNNELSDFCGKTE-------QI----------SPGEQPPSSQAPVILHSKANKHLV--VIGGSGGSMITTGMAMTLMNYLWFGK 556          
BLAST of Gamma-glutamyltransferase 7 vs. Ensembl Cavefish
Match: ggt5a (gamma-glutamyltransferase 5a [Source:ZFIN;Acc:ZDB-GENE-080226-1])

HSP 1 Score: 109.383 bits (272), Expect = 1.770e-24
Identity = 117/464 (25.22%), Postives = 201/464 (43.32%), Query Frame = 2
Query:  347 AGISTDVTECTDLGLEICRQGGSAVDSAIGSFLCVSIARPDLASLGGCGXXXXXXXXXXXXXXIDFSCVAPPNAQPEPI-PLGYGISKS-----VAMPGVLSGLKLAHKTYGKMNWTNILNLVTVKLQ-NGIKVTPEMQTVFKDPIFN--SLSQNFRTNYQN--WASGSVFTPSKELLDILTALTKEGADSGITGSFANEMINLGFPWTGRLDTARELKPL--------TAVFGDYSLITAPLPSKGGLELAIAIEMLSKVVPMTALV--KENTLFYHRLIESLKVAQSTTSFLGDSD--NGIEPKLLSTQSIQNLINMMGTSTALPNKNYGPYYSLSNIEKGSGTHISIIDSSSLYVSLTVNLGSKFGSGIAT-KSGIVLNDAMRLFTSNDSTSLVPGIQIRNRTTSNNIAAPGKRPLNELAPLIVYNFKRKCGVRFAVGGDRGPQSTTGNLQMIMGAIYLDQ 1666
            A ++ D   C+ +G  I ++GGSAVD AI + +C SI  P    +GG G +      +     I+    AP   +P+ +   G    ++     + +PG + G + AH+ YG++ W  +    T+KL   G ++   +  +   P FN  SL +   T+ +      G++    K L + L  +  +G D   TG  A  +I+      G L T  +LK          T    DY++   P P+ G +   I   M    +  T+L   +E  L YHR +E+ K A     F+ D    +  E   +      + I  M +S    +  Y  Y     ++    TH+S++D + + VS+T  +   FGS + + K+GI+LN+ +  F            QI          +PG++P +  AP+I+++   K  V   +GG  G   TTG    +M  ++  +
Sbjct:  120 AAVAADSLTCSRIGRTILQEGGSAVDGAIAALICTSIINPQSMGIGG-GVIFTIMERNGKVKIINARETAPKQVKPDLLSECGSSTQQTSGPQWIGVPGEIRGYERAHRLYGRLPWARLFQ-PTIKLATEGFELPTVLSRIL--PFFNGTSLMKELFTDAEGKMLKEGNIVKFEK-LAETLKRIANKGPDEFYTGETATALISDVQEAGGTL-TLEDLKSFEVSESEAWTVPLRDYTMYFPPPPAGGAVLSFILNVMQGYNLRRTSLQNKEERVLTYHRYVEACKFANGLKKFMRDPKISSASEASAMIEDDFADHIRKMISSNTTHDAQY--YNVTPGLDTQGTTHVSVLDENGMAVSVTSTINHIFGSRVYSPKTGIILNNELSDFCGKTE-------QI----------SPGEQPPSSQAPVILHSKANKHLV--VIGGSGGSMITTGMAMTLMNYLWFGK 556          
BLAST of Gamma-glutamyltransferase 7 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001319.1 (pep scaffold:Pmarinus_7.0:GL476337:669740:697940:-1 gene:ENSPMAG00000001168.1 transcript:ENSPMAT00000001319.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 130.568 bits (327), Expect = 6.568e-32
Identity = 134/481 (27.86%), Postives = 211/481 (43.87%), Query Frame = 2
Query:  293 TVAMILCIFFGPPQIRPHAGISTDVTECTDLGLEICRQGGSAVDSAIGSFLCVSIARPDLASLGGCGXXXXXXXXXXXXXXIDFSCVAPPNAQPEPIPLGYGISK-----SVAMPGVLSGLKLAHKTYGKMNWTNILNLVTVKLQNGIKVTPEMQTVFKDPIFNSLSQNFRTNYQNWASGSVFTPSK--ELLDILTALTKEGADSGITGSFANEMINLGFPWTGRLDTAREL--------------KPLTAVFGDYSLITAPLPSKGGLELAIAIEMLSKVVPMTALVKENTLFYHRLIESLKVAQSTTSFLGDS--DNGIEPKL------LSTQSIQNLINMMGTSTALPNKNYGPYYSLSNIEKGSGTHISIIDSSSLYVSLTVNLGSKFGSGIATKSGIVLNDAMRLFTSNDSTSLVPGIQIRNRTTSN-NIAAPGKRPLNELAPLIVYNFKRKCGVRFAVGGDRGPQSTTGNLQMIM 1645
            T+A+I+ I+ G PQ+  +  + +DV  C+D+G +I  + GS+VD+A+ + LC  I  P  + LGG G ++VHN     + +IDF  VAP                     SV +PG++ GL  AH+ YG+M W  ++       ++G  VT E+   F   +    S   R  +    SG  F+  +  ELL        +  +    G       N+ FP+   +     L              KP +     + L++AP P   G  L +A+ ++      T    +  L YH L E+LK +    S LGD   D  +  ++      L    I+ LIN   T   LP  +YG    + +   G  + + ++    L V++T +L   FGS + T SGI+LN AM  FT           Q  N T    N+  PG+RP+    P I    +  CG   ++GG +GP  T+   Q+I+
Sbjct:  122 TIALIIQIYLGEPQVYYNGTVVSDVRLCSDIGTDILHKRGSSVDAAVATALCAGIVHPHSSGLGGGGVMLVHNIKENTTRAIDFWAVAPAEDLLFNNLNANLTLLTKAGLSVGVPGMIKGLYQAHQLYGRMPWGEVVAAAARVAKDGFNVTTELDRGFVIGVPWDFSCR-RIQFTFTNSGLYFSVERRAELLSGQKRNVAKMPEEWWGG------CNITFPFVATVPMHSGLMLGSIFLQCIHMVHKPDSGDVAGHLLLSAP-PPHAGASLLLALGIMEGYNLSTH--DDGNLTYHWLTEALKFSFIQGSTLGDPTVDASVAERMQNILSKLEAGRIRELINDTWT---LPADSYGARQLIDSY--GDASSVLVMGPDDLIVAMTSSLSGAFGSRVMTPSGILLNSAMLDFTDPS--------QSPNPTAGQANVMGPGRRPITWALPTIARPLRGLCGTYLSLGGSKGPADTSSLAQIII 579          
BLAST of Gamma-glutamyltransferase 7 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005677.1 (pep scaffold:Pmarinus_7.0:GL478518:21750:45518:-1 gene:ENSPMAG00000005105.1 transcript:ENSPMAT00000005677.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 122.094 bits (305), Expect = 1.959e-29
Identity = 126/498 (25.30%), Postives = 221/498 (44.38%), Query Frame = 2
Query:  347 AGISTDVTECTDLGLEICRQGGSAVDSAIGSFLCVSIARPDLASLGGCGXXXXXXXXXXXXXXIDFSCVAPPNAQPEPIPLGYGISK----SVAMPGVLSGLKLAHKTYGKMNWTNILNLVTVKLQNGIKVT--------PEMQTVFKDPIFNSLSQNFRTNYQNWASGSVFTPSKELLDILTALTKEGADSGITGSFANEMINLGFPWTGRLDTARELK---------PLTAVFGDYSLITAPLPSKGGLELAIAIEMLSKV---VPMTALVKENTLFYHRLIESLKVAQSTTSFLGDSD----NGIEPKLLSTQSIQNLINMMGTSTALPNKNYGPYYSLSNIEKGSGTHISII--DSSSLYVSLTVNLGSKFGSGIATK-SGIVLNDAMRLFTSNDSTSLVPGIQIRNRTTSNNIAAPGKRPLNELAPLIVYNFKRKCGVRFAVGGDRGPQSTTGNLQMIMGAIYLDQKFCPSKDCMNLVKAGSRLRLYVNLLEN 1747
            A ++TD   C+D+G ++ ++GGSAVD+AI + LCV +       +GG   L ++N S+    +I+    AP NA  +        S+    ++A+PG + G  LAH+ +G++ W  +        +NG ++T           Q +   P   SL   F   +      +     + L + L  +  EG D+   GS +  +++      G +    +L+         PL    G Y + T P P+ G + L++ + +L          +  KE  L YHR++E+ K A +  S L D        +   L S    Q L   +   +  P + Y   +  S+ E    +H+S++  D S++  + ++NLG  FGS + ++ +GI+ N+AM  F+S  + +   G+Q     +  N   PGKRPL+ + P +V +      V+  VG   G +  T     I+  ++  Q         ++  A S  RL+  LL N
Sbjct:    4 AVVTTDSPLCSDIGRDVLKEGGSAVDAAISALLCVGLTCAHSTGIGGGLFLTIYNASTGTVEAINAREGAPLNATQDMFGGDASSSRIVNLAIAVPGEIRGYALAHRRHGRLPWARLFQPSIALARNGFRMTGPLARAVMEHRQAIEASP---SLCDVFCDGHGKILQVNSTVRDERLAETLQVIAAEGPDAFYDGSLSKSIVD-DIQAEGGIIALEDLRAYEPELAEIPLLVEVGRYRVYTPPPPASGAV-LSLILNILEGFHFSADSVSTAKEKALTYHRIVEAFKFAFAKRSELADRRFADVRDLVRNLTSEDYAQALRWKISGDSTHPARFYESMF--SHAEDAGASHVSVVAGDGSAVSATSSINLG--FGSLVRSRTTGIIFNNAMDSFSSPFTIN-TSGVQ----PSPANYIQPGKRPLSSMCPAVVMD--EDAQVKMVVGAAGGIRIVTSAALAIINTLWFGQ---------DIKAAVSAPRLHHQLLPN 476          
BLAST of Gamma-glutamyltransferase 7 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005618.1 (pep scaffold:Pmarinus_7.0:GL478518:2729:14084:1 gene:ENSPMAG00000005075.1 transcript:ENSPMAT00000005618.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 80.4925 bits (197), Expect = 2.600e-16
Identity = 100/422 (23.70%), Postives = 175/422 (41.47%), Query Frame = 2
Query:  608 SVAMPGVLSGLKLAHKTYGKMNWTNILNLVTVKLQNGIKVTPEMQTVFKDPIFNSLSQ-NFRTNYQN---------WASGSV-----FTPSKELLDILTALTKEGADSGITGSFANEMINLGFPWTGRLD-------TARELKPLTAVFGDYSLITAPLPSKGGLELAIAIEMLSKVVPMTALVKE---NTLFYHRLIESLKVAQSTTSFLGDSD-NGIEPKLLSTQS------IQNLINMMGT---STALPNKNYGPYYSLSNIEKGSGTHISIIDSSSLYVSLTVNLGSKFGSGIAT-KSGIVLNDAMRLFTSNDSTSLVPGIQIRNRTTSNNIAAPGKRPLNELAPLIVYNFKRKCGVRFAVGGDRGPQSTTGNLQMIMGAIYLDQKFCPSKDCMNLVKAGSRLRLYVNLLENTNQNNT 1765
            ++ +PG L    LAH+ +G++ W  +L       ++G+ V+ E+           L++ + R  ++N         W +G+V           L   L  + +EG D+   GS A  ++       G L         A  +KPL    G Y+L+T P P  GG  L   +  LS        +++     L +H ++E LK A +    L D +   +  K+    S      ++ LI    T   S   P +   P+Y  S        H+S++      VS+T ++   FGS + + ++GI+LND M     +D +   PG        + N   P KRP++ ++P ++ +  R   V+  +G   G + T    Q++   ++L           +L  A  + RLY+N  +   QN T
Sbjct:    2 AIGVPGELRAYALAHRRHGRLPWHKLLEPSIRMARDGVPVSRELA--------EKLAKIDERVKFKNDSEICALFCWPNGTVKKENDIVRYPALARTLETIAREGEDAFYNGSLATLLVEDVRAKGGVLSLEDLRSYHAEIVKPLIFPVGKYTLVT-PAPPGGGAILTSIVNALSAFHMQRREMQDTEGRALDFHHMVEVLKFAYAQHRELADPEFENMAQKVQELMSPAYGEKLRRLIQHDRTHERSFYTPTEPDKPHYGTS--------HLSVLAEDGGAVSVTSSINFYFGSQVVSNRTGIILNDQM-----SDFSCPQPG------KPAFNFIEPWKRPISFMSPSLLLDEHRM--VKMVIGASGGSKITAAIAQVLANVLWLG---------YDLPNAVCQPRLYINQEDFFLQNET 384          
BLAST of Gamma-glutamyltransferase 7 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006210.1 (pep scaffold:Pmarinus_7.0:GL492264:524:3304:1 gene:ENSPMAG00000005615.1 transcript:ENSPMAT00000006210.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 58.151 bits (139), Expect = 6.442e-10
Identity = 51/187 (27.27%), Postives = 90/187 (48.13%), Query Frame = 2
Query: 1094 KENTLFYHRLIESLKVAQSTTSFLGDSDNGIEPKLLSTQSIQNLINMMGTSTALPNKNYG------PYYS-LSNIEKGSGT-HISIIDSSSLYVSLTVNLGSKFGSGIATKS-GIVLNDAMRLFTSNDSTSLVPGIQIRNRTTSNNIAAPGKRPLNELAPLIVYNFKRKCGVRFAVGGDRGPQSTTG 1627
            ++ +L YHR++E+ K A +  + LGD      P  ++   +   +     + AL  K +        YY  +  + + SGT H+S++      VS+T  +   FGS + + S GI+ N+ M  F+   S  +V G  +    +  N   PGKRPL+ + P ++ +  ++  V+  VG   G + TTG
Sbjct:   12 EQKSLTYHRIVEAFKFAYAKRTELGD------PNFVNLTDLMKNVTSKDFAEALRQKIWDNATHGVEYYEPMFYVPEDSGTAHLSVVGPDGSAVSVTSTINFYFGSKVRSPSTGIIFNNEMDDFS---SPYIVNGFGV--PPSPANFIRPGKRPLSSMCPTLIVD--KQSRVKLIVGASGGTKITTG 185          
BLAST of Gamma-glutamyltransferase 7 vs. Ensembl Yeast
Match: ECM38 (Gamma-glutamyltranspeptidase; major glutathione-degrading enzyme; involved in detoxification of electrophilic xenobiotics; expression induced mainly by nitrogen starvation [Source:SGD;Acc:S000004290])

HSP 1 Score: 60.077 bits (144), Expect = 7.372e-10
Identity = 69/206 (33.50%), Postives = 94/206 (45.63%), Query Frame = 2
Query: 1094 KENTLFYHRLIESLKVAQSTTSFLGDSDNGIEPK-----------LLSTQSIQNLINMMGTSTALPNKN-YGPYYSLSNIEKGSGT-HISIIDSSSLYVSLTVNLGSKFGSGIAT-KSGIVLNDAMR---LFTSNDSTSLVPGIQIRNRTTSNNIAAPGKRPLNELAPLIVYNFKRKCGV-RFAVGGDRGPQSTTGNLQMIMGAIY 1657
            KE T  YH L+ES+K   S  S LGD +    PK           L + +SI+   +  G    L N   Y P Y ++N     GT H SI+DS    VSLT  +   FGS +   K+G++ N+ M     F  ++S  L P I         N   PGKRPL+  AP IV +   + G+    VG   G + TT  LQ I+   +
Sbjct:  392 KETT--YH-LLESMKWMASARSRLGDFEGEALPKHIEEVLDPEWALKAVKSIKR-NSQDGNFKTLENWTLYDPAYDINN---PHGTAHFSIVDSHGNAVSLTTTINLLFGSLVHDPKTGVIFNNEMDDFAQFNKSNSFELAPSIY--------NFPEPGKRPLSSTAPTIVLS---ELGIPDLVVGASGGSRITTSVLQTIVRTYW 579          
BLAST of Gamma-glutamyltransferase 7 vs. Ensembl Nematostella
Match: EDO48355 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJD1])

HSP 1 Score: 173.711 bits (439), Expect = 4.771e-47
Identity = 143/482 (29.67%), Postives = 226/482 (46.89%), Query Frame = 2
Query:  293 TVAMILCIFFGPPQIRPHAGISTDVTECTDLGLEICRQGGSAVDSAIGSFLCVSIARPDLASLGGCGXXXXXXXXXXXXXXIDFSCVAPPNAQP------EPIPLGYGISKSVAMPGVLSGLKLAHKTYGKMNWTNILNLVTVKL-QNGIKVTPE--MQTVFKDPIFNSLSQNFRTNYQNWASGSVFTPSKELLDILTALTKEGADSGITGSFANEMI-----NLGFPWTGRLDTARELKP--LTAVFGDYSLITAPLPSKGGLELAIAIEMLSKVVPMTALVKENTLFYHRLIESLKVAQSTTSFLGDSDNGIEPKLLSTQSIQNLINMMGT-------------STALPNKNYGPYYSLSNIEKGSGTHISIIDSSSLYVSLTVNLGSKFGSGIATKSGIVLNDAMRLFTSNDSTSLVPGI--QIRNRTTSNNIAAPGKRPLNELAPLIVYNFKRKCGVRFAVGGDRGPQSTTGNLQMIM 1645
            T+A+I+ I+ G      HA +S+DV EC+D+GL++ ++GGSAVD++IG+ LCV +  P+   +GG G  ++          IDF   AP  A        E +    G+  +VA+PG L G ++AHK YGK+ W  +    T+KL ++G +V+    M     D I N                      KEL D L  + +EG D+  TG  A  ++     N G      L   + L+   L + +  Y + T PLP  G + L  A+ +L +    + + K     Y  ++E+LK A +  + LGD      P   +   +QN+ N M +             +   P   YGP++  +  E     H+S++      VS+T  +   FGS + T +GI+LN+ M  F+S       PGI  Q   +    N   PGKRPL+ + P++V + +  C  R A+GG  G + TT  LQ ++
Sbjct:   29 TIALIIDIYVGDHHTG-HAAVSSDVKECSDIGLDLMKRGGSAVDASIGALLCVGLMNPESCGIGG-GGFMLIVPPRKKGEVIDFRETAPGKASEGMHKGNEELAATGGL--AVAVPGELRGYEIAHKKYGKLKWAELF-APTIKLARDGFQVSAHTGMYLQVGDMIRN----------------------KELADTLEIIAREGPDAFYTGDIAQSIVKTVRSNDGVITLDDLKNYKALEKDGLNSTYEGYQITTIPLPGSGPV-LFSALNILEQ-FQFSKVDKGKNETYQYIVEALKFAYAQRTHLGD------PADPANAHMQNVTNAMLSKKLAAKLRKKIFANQTFPPSYYGPFFDAA--ESHGTAHLSVVGPDGELVSVTSTINGYFGSYLMTDTGIILNNEMDDFSS-------PGITNQFGIKPAKANYIRPGKRPLSSMVPVVVRHKQDPCTYRLALGGSGGTRITTAVLQTLI 466          
BLAST of Gamma-glutamyltransferase 7 vs. Ensembl Nematostella
Match: EDO42587 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S179])

HSP 1 Score: 129.413 bits (324), Expect = 1.810e-31
Identity = 142/519 (27.36%), Postives = 233/519 (44.89%), Query Frame = 2
Query:  308 LCIFF---------GPP---QIRPHAGISTDVTECTDLGLEICRQGGSAVDSAIGSFLCVSIARPDLASLGGCGXXXXXXXXXX--XXXXIDFSCVAPPNAQPEPIPLGYGISKSVAMPGVLSGLKLAHKTYGKMNWTNILNLVTVKLQNGIKVTPEMQTVFKDPIF-----NSLSQNFRTNYQNWASGSVFTP---SKELLDILTALTKEGADSGITGSFANEMINL--GFPWTGRLDTAREL-----KPLTAVFGDYS---LITAPLPSKGGLELAIAIEMLSKVVPMTALVKENT-LFYHRLIESLKVAQSTTSFLGD-----SDNGIEPKLLSTQSIQNLINMMGTSTALPNKNYGPYYSLSNIEKGSGTHISIIDSSSLYVSLTVNLGSKFGSGIATKS-GIVLNDAMRLFTSN--DSTSLVPGIQIRNRTTSNNIAAPGKRPLNELAPLIVYNFKRKCGVRFAVGGDRGPQSTTGNLQMIMGAIYLDQKFCPSKDCMNLVKAGSRLRLYVNLL 1741
             C+FF         GPP   +  PHA ++ D   C+ LG +  + GG AVD+AI + LCV +  P  A +GG G +V+++  S       I  S ++P  A+   +    G+   V +PG L G + A K YGK+ W  +        + G KV P + T            NSL + F  N +    G +       K L +I  +    GAD    G  +  ++    G      LD  +E      KP+ A  G  +   +IT P P+ GG  ++ A+++LS      + +K++  L YHR+IE+ K A ++ ++LGD       + +  K++      NL   +   T  P K YGP    +++  G+ TH+S++D+    VSLT ++   FGS I +K  GI+ ND +    ++  +   LVP          +N   P ++PL+   P I+ +  ++  ++  +G   G    T   Q+IM   +           +NL  A +R RL+  L 
Sbjct:   13 FCLFFLSTCSSAVVGPPPAPREFPHAAVAADHELCSKLGTQALKDGGHAVDAAIVTALCVGVVNPHSAGIGGGGFMVIYDRESSKCTLAYIFKSSLSP--AEMNTMRPSEGL--MVGVPGELRGFEKAWKKYGKLKWERLFQPAADLCKKGYKVHPSLATAIAKNALNITNSNSLGEIFTRNGKMLVEGDIVKRPVYGKTLEEIGKS---GGADIFYNGKMSKTVVKDINGEGGIFTLDDLKEYIAGDAKPVIAYLGHMNGAKIITPPPPAGGGAVMSEALQILSGYNFKPSDLKDHPGLTYHRMIEAFKFAHASLTYLGDPRYMKDADKVVKKMVDQTHSNNLRKFIDNRTH-PVKYYGPINYRTDVTSGT-THLSVVDADGNGVSLTSSINKYFGSKIRSKKLGIIYNDQLADSMNHWVNEYGLVP----------DNF-LPHRKPLSLACPAIIVD--KEDNLQMVIGAAGGRYIPTTLAQVIMNYYWFG---------LNLKNAVARPRLHSQLF 500          
BLAST of Gamma-glutamyltransferase 7 vs. Ensembl Nematostella
Match: EDO44635 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RVG5])

HSP 1 Score: 110.923 bits (276), Expect = 1.523e-25
Identity = 129/481 (26.82%), Postives = 211/481 (43.87%), Query Frame = 2
Query:  344 HAGISTDVTECTDLGLEICRQGGSAVDSAIGSFLCVSIARPDLASLGGCGXXXXXXXXXXXXXXIDFSCVAPPNA-----QPEPIPLGYGISKSVAMPGVLSGLKLAHKTYGKMNWTNILNLVTVKLQNGIKVTPEMQTVFKDPIFNSLSQNFRTNYQNWASG--SVFTPSKELL------------DILTALTKEGADSGITGSFANEMINLGFPWTGRLDTARELK--------PLTAVFGDYSLITAPLPSKGGLELAIAIEMLSKVVPMTALVKENTLF-YHRLIESLKVAQSTTSFLGDSD-----NGIEPKLLSTQSIQNLINMMGTSTALPNKNYGPYYSLSNIE---KGSGTHISIIDSSSLYVSLTVNLGSKFGSG-IATKSGIVLNDAMRLFTSNDSTSLVPGI--QIRNRTTSNNIAAPGKRPLNELAPLIVYNFKRKCG-VRFAVGGDRGPQSTTGNLQMIMGAIYLDQ 1666
            HA ++ D + C+++G ++ ++ G+AVD+AI + LCV +       +GG G ++V+N     +  IDF   AP  A     Q + I  G     +VA+PG L G+++A K YGK+ W ++        + G    P  +TV       S++ N    Y     G   +F P  +LL             +L+ +    +         +  I       G + T  +L+         L +  G  +L+T P P+ G + L++ + +LS     ++ +K++ +  YHR+IE+ K A    S LGD D      G+   +LS +  +   +M+     L NK   P Y  S      K   THIS++      VS+T  +   FG+  I+ K GIV N+ M  F++       PGI  +        N   P KRP +   P I+ +   K G V   VG   G   TT   Q+IM   + ++
Sbjct:   17 HAAVAADNSRCSEIGRDVLKKQGTAVDAAIATMLCVGVINLHSTGVGGGGFMLVYNSHLKKAEMIDFRETAPLQANRDLFQGDAIK-GIKGGLAVAVPGELKGMEVAWKKYGKLPWKDLFAPSIALAKEGF---PLPETV-------SIAINIWKKYLTKDKGFRKIFMPYGKLLKTGETVRRPNLAKVLSLIANANSSKPFYNGKLSHTIVSDVKAAGGVLTLSDLRHYKVKVKEALKSHIGSMTLMTGPPPTSGPV-LSMILNILSGYNFKSSDMKKHPVRTYHRIIEAFKFAYKYRSMLGDPDFEKSVPGVVNDMLSEKVAKYYRHMI-----LDNKTQTPSYYGSRYHVPVKTGTTHISVLSKEGDAVSVTSTVNGYFGAKFISPKLGIVYNNEMDDFSA-------PGITNEFGLLPAPVNFIKPNKRPQSSAVPAIILD---KFGHVNMVVGAAGGTIITTSVAQVIMNYFWFNK 470          
BLAST of Gamma-glutamyltransferase 7 vs. Ensembl Nematostella
Match: EDO37680 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SF26])

HSP 1 Score: 103.99 bits (258), Expect = 3.385e-23
Identity = 112/429 (26.11%), Postives = 194/429 (45.22%), Query Frame = 2
Query:  353 ISTDVTECTDLGLEICRQGGSAVDSAIGSFLCVSIARPDLASLGGCGXXXXXXXXXXXXXXIDFSCVAPPNA-------QPEPIPLGYGISKSVAMPGVLSGLKLAHKTYGKMNWTNILNLVTVKLQNGIKVTPEMQTVFKDPIFNSLSQNFRTNYQNWASGSVFTPSKELLDILTALT----KEGADSGITGSFANEMINLGFPWTGRLDTARELK---------PLTAVFGDYSLITAPLPSKGGLELAIAIEMLSKVVPMTALVKENT--LFYHRLIESLKVAQSTTSFLGDSD----NGIEPKLLSTQSIQNLINMMGTSTALPNKNYGPYYSLSNIEKGSGTHISIIDSSSLYVSLTVNLGSKFGSG-IATKSGIVLNDAMRLFTSNDSTSL--VPGIQIRNRTTSNNIAAPGKRPLNELAPLI 1552
            +S+D  EC++LG ++  +GGSAVDSA+ +  CV +       +GG G ++V+   +  +  +DF  VAP  A       Q E   LG     +VA+PG + GL  A   YGK+ W +++       + G K+   +    K  I   +S +         +G++   +  +     ALT    ++  +    GS A + I       G + TA +LK         P+    G  ++     PS G +   I   M    +   A   ++   L YHR++ES K A +  + LGD        I  KL S    + +   +  +    N +Y    +   ++ G+ TH+SI+ S+   VS+T  +  +FG+  +  ++GI+ N+ M  F++  +T+L  +P  ++       N   PGKRP + +AP+I
Sbjct:   55 VSSDADECSELGAKMLIKGGSAVDSAVATLFCVGLLNLHSTGIGGGGFMLVYQRDTKKAKFLDFREVAPGAANSTMYVNQTEKAQLG---GLAVAVPGEVRGLHTAWMEYGKLPWRDLVQPTIDMAKGGFKIIHALHDAMKGAI-PKISADPGLRALLMENGNLKPENSTIKHPAFALTLEKIRDNPNDFYEGSLAAD-IAKDIQDGGGIVTAEDLKNYTAQTNKVPIKNTLGGRTMFATTGPSGGPVVTLIMNIMKGYNLGPEARASDSASGLTYHRIVESFKFAFARRALLGDPAFENITEIMSKLTSPVYAEKIRQNIWDNQTHSNASYYGAETGQTVDGGT-THLSILASNGDAVSVTSTINYRFGAAYLGRRTGILFNNEMDDFSTPGATNLYGLPPSEV-------NFIKPGKRPQSSMAPVI 470          
BLAST of Gamma-glutamyltransferase 7 vs. Ensembl Nematostella
Match: EDO44572 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RVG4])

HSP 1 Score: 97.4413 bits (241), Expect = 3.518e-21
Identity = 131/524 (25.00%), Postives = 225/524 (42.94%), Query Frame = 2
Query:  323 GPPQIRPHAGISTDVTECTDLGLEICRQGGSAVDSAIGSFLCVSIARPDLASLGGCGXXXXXXXXXXXXXXIDFSCVAPPNAQPEPIPLGYGISK----SVAMPGVLSGLKLAHKTYGKMNWTNILNLVTVKLQNGI---KVTPEMQTVFKDPIFNSLSQN---FRTNYQNWASGSVFTPSKELLDILTALT-KEGADSGITGSFANEMIN-------LGFPWTGRLD--TARELKPLTAVFG-DYSLITAPLPSKGG-LELAIAIEMLSKVVPMTALVKE---NTLFYHRLIESLKVAQSTTSFLGDS--DNGIE---PKLLSTQSIQNLINMMGTSTALPNKNYGPYYSLSNIEKGSGTHISIIDSSSLYVSLTVNLGSKFGS-GIATKSGIVLNDAMRLFTSNDSTSLVPGIQIRNRTTSNNIAAPGKRPLNELAPLIVYNFKRKCGVRFAVGGDRGPQSTTGNLQMIMGAIYLDQKFCPSKDCMNLVKAGSRLRLYVNLLENTNQNNTATVYFDQNFPEN 1801
            G P  R    ++ D   C+ +G+ I ++ GSAVD+AI + LCV +       +GG G ++V+N +S  + +IDF   AP  A           +K    +V +PG + G   A + YG++ W +I+       +NG    K   +  +  KD I N+       F+T+ +        +P   L    T  T ++   S   G+ A  +I         G      L   TA   K L+   G +  + T P P+ G  + L + I         +  +K+   +TL YHR+ E+ K A +  S L D   D  +E    K+L   +   L   +  +    N +Y  Y +  + E    +H++++  +   VSLT ++  +FG+   +T +GI+ ND M  F  N  +    G+      +  N  APGKRP + + P+I+ +      V+   G   G Q  T   Q IM  ++  +         +L ++   LR++  L+ +        +Y + NFP +
Sbjct:   37 GGPYYR--GAVAADAKNCSAIGVNILKRKGSAVDAAIATMLCVGVINMHSTGVGGGGFMLVYNKTSNTTEAIDFREKAPVAANESMFVDKVRDAKFGGLAVGVPGEVRGYYKAWEKYGRLRWRDIVQPAIDIAKNGFYIGKPVHDAASELKDEIINNPGLRELLFKTDGKTLKDRD--SPITNLKYAATLKTIRDNPHSFYNGTLARNIIRDIQFMEPQGIMGLDDLKNYTAEIRKGLSGRLGPNLVMHTVPPPASGAVMHLLLDILKGYNFTESSRDLKDTNTSTLTYHRITEASKFAFAWRSRLADPAFDGSVEKYVEKMLDQSTADYLRAQIWDNQTHDNVSY--YANYFSYEDHGTSHLAVLAPNGDAVSLTSSINLRFGNQHRSTTTGIIYNDQMSDF-DNPGSKRHAGLS----PSELNFPAPGKRPFSSMTPVIITD--NNGNVKMVFGASGGKQIITATSQAIMNKLWFGR---------SLKQSIEDLRIHTQLIPDD------FLYHEANFPRD 532          
BLAST of Gamma-glutamyltransferase 7 vs. Ensembl Medaka
Match: ggt7 (gamma-glutamyltransferase 7 [Source:NCBI gene;Acc:100820717])

HSP 1 Score: 166.392 bits (420), Expect = 4.292e-43
Identity = 148/533 (27.77%), Postives = 244/533 (45.78%), Query Frame = 2
Query:  293 TVAMILCIFFGPPQIRPHAGISTDVTECTDLGLEICRQGGSAVDSAIGSFLCVSIARPDLASLGGCGXXXXXXXXXXXXXXIDFSCVAPPNAQPEPIPLGYGISKS--VAMPGVLSGLKLAHKTYGKMNWTNILNLVTVKLQNGIKVTPEMQTVFKDPIFNSLSQNFRTNY---QNWASGSVFTPSKELLDILTALTKEGADSGITGSFANEMINLGFPWTGRLDTAREL--------KPLTAVFGDYSLITAPLPSKGGLELAIAIEMLSKVVPMTALVKENTLFYHRLIESLKVAQSTTSFLGDS--DNGIEP---KLLSTQSIQNLINMMGTSTALPNKNYGPYYSLSNIEKG-SGTHISIIDSSSLYVSLTVNLGSKFGSGIATKSGIVLNDAMRLFTSNDSTSLVPGIQIRNRTTSNNIAAPGKRPLNELAPLIVYNFKRKCGVRFAVGGDRGPQSTTGNLQMIMGAIYLDQKFCPSKDCMNLVKAGSRLRLYVNLLENTNQNNTATVYFDQNFPENFKTELTTVYQH 1834
            TVA+I+ I+FG PQ+     + TD   CT LG ++  + GS+VD+A+ + LC+ I  P  + +GG G ++VHN     +  IDF   AP     + +     I+    V +PG+LSG+  AH+ YG+M+W N++ +     +NG  VT +      +   +++S+ F+  +    N     +F    +L DIL A+  +G     +G  A EM+       G + T  +L        +P    +  + ++ +  P   G+ L  A+ +L      + + + +T+  H + E+LK+A    S LGD   D+ +     K+LS      L  ++  S A P  +Y   +SL   EKG +   + ++      VS+  +L   FGSGI T SGI+LN  +  F+  + T       + +    +N   PGKRP++ L P  V      CG   AVG   G ++ +   Q++M  +        S+  MN   A  RL           Q    T+  D  F E+ + EL  V  H
Sbjct:  113 TVALIMQIYFGDPQVYSQGAVVTDAARCTSLGFDVLGKQGSSVDAAVAAALCLGIVHPHTSGIGGGGVMLVHNIRKNETRVIDFRETAPFAIHEDMLQTNLDINTGLLVGVPGMLSGMHQAHQLYGRMSWKNVVAMAADVARNGFNVTHDFAEALSNVKNDNMSEAFQNLFLPNGNVPPSGLFIQRHDLADILEAVAVKGISEFYSGKIAQEMVT-AVQKKGGVLTEEDLGNYSIVLQEPAEVTYQGHHVMASSAP-HAGVALIAALNILEGYNITSQMSRNSTV--HWIAEALKIALGLASGLGDPLYDSSVTETVDKMLSKSQASLLRQLISDSEANPVSHYTSAFSL---EKGAAAAQVMVMGPDDHIVSVMSSLNKPFGSGIVTSSGILLNSQILDFSWANKT-------LSSSPNPHNNLQPGKRPMSFLMPTAVRPAVGLCGTYVAVGSSNGEKALSAITQVLMNVL-------SSRKNMNDSLAYGRLH---------PQLQPDTLLVDSEFSED-EVELLQVKGH 614          
BLAST of Gamma-glutamyltransferase 7 vs. Ensembl Medaka
Match: ggt7 (gamma-glutamyltransferase 7 [Source:NCBI gene;Acc:100820717])

HSP 1 Score: 166.392 bits (420), Expect = 5.481e-43
Identity = 148/533 (27.77%), Postives = 244/533 (45.78%), Query Frame = 2
Query:  293 TVAMILCIFFGPPQIRPHAGISTDVTECTDLGLEICRQGGSAVDSAIGSFLCVSIARPDLASLGGCGXXXXXXXXXXXXXXIDFSCVAPPNAQPEPIPLGYGISKS--VAMPGVLSGLKLAHKTYGKMNWTNILNLVTVKLQNGIKVTPEMQTVFKDPIFNSLSQNFRTNY---QNWASGSVFTPSKELLDILTALTKEGADSGITGSFANEMINLGFPWTGRLDTAREL--------KPLTAVFGDYSLITAPLPSKGGLELAIAIEMLSKVVPMTALVKENTLFYHRLIESLKVAQSTTSFLGDS--DNGIEP---KLLSTQSIQNLINMMGTSTALPNKNYGPYYSLSNIEKG-SGTHISIIDSSSLYVSLTVNLGSKFGSGIATKSGIVLNDAMRLFTSNDSTSLVPGIQIRNRTTSNNIAAPGKRPLNELAPLIVYNFKRKCGVRFAVGGDRGPQSTTGNLQMIMGAIYLDQKFCPSKDCMNLVKAGSRLRLYVNLLENTNQNNTATVYFDQNFPENFKTELTTVYQH 1834
            TVA+I+ I+FG PQ+     + TD   CT LG ++  + GS+VD+A+ + LC+ I  P  + +GG G ++VHN     +  IDF   AP     + +     I+    V +PG+LSG+  AH+ YG+M+W N++ +     +NG  VT +      +   +++S+ F+  +    N     +F    +L DIL A+  +G     +G  A EM+       G + T  +L        +P    +  + ++ +  P   G+ L  A+ +L      + + + +T+  H + E+LK+A    S LGD   D+ +     K+LS      L  ++  S A P  +Y   +SL   EKG +   + ++      VS+  +L   FGSGI T SGI+LN  +  F+  + T       + +    +N   PGKRP++ L P  V      CG   AVG   G ++ +   Q++M  +        S+  MN   A  RL           Q    T+  D  F E+ + EL  V  H
Sbjct:  137 TVALIMQIYFGDPQVYSQGAVVTDAARCTSLGFDVLGKQGSSVDAAVAAALCLGIVHPHTSGIGGGGVMLVHNIRKNETRVIDFRETAPFAIHEDMLQTNLDINTGLLVGVPGMLSGMHQAHQLYGRMSWKNVVAMAADVARNGFNVTHDFAEALSNVKNDNMSEAFQNLFLPNGNVPPSGLFIQRHDLADILEAVAVKGISEFYSGKIAQEMVT-AVQKKGGVLTEEDLGNYSIVLQEPAEVTYQGHHVMASSAP-HAGVALIAALNILEGYNITSQMSRNSTV--HWIAEALKIALGLASGLGDPLYDSSVTETVDKMLSKSQASLLRQLISDSEANPVSHYTSAFSL---EKGAAAAQVMVMGPDDHIVSVMSSLNKPFGSGIVTSSGILLNSQILDFSWANKT-------LSSSPNPHNNLQPGKRPMSFLMPTAVRPAVGLCGTYVAVGSSNGEKALSAITQVLMNVL-------SSRKNMNDSLAYGRLH---------PQLQPDTLLVDSEFSED-EVELLQVKGH 638          
BLAST of Gamma-glutamyltransferase 7 vs. Ensembl Medaka
Match: ggt7 (gamma-glutamyltransferase 7 [Source:NCBI gene;Acc:100820717])

HSP 1 Score: 166.392 bits (420), Expect = 5.481e-43
Identity = 148/533 (27.77%), Postives = 244/533 (45.78%), Query Frame = 2
Query:  293 TVAMILCIFFGPPQIRPHAGISTDVTECTDLGLEICRQGGSAVDSAIGSFLCVSIARPDLASLGGCGXXXXXXXXXXXXXXIDFSCVAPPNAQPEPIPLGYGISKS--VAMPGVLSGLKLAHKTYGKMNWTNILNLVTVKLQNGIKVTPEMQTVFKDPIFNSLSQNFRTNY---QNWASGSVFTPSKELLDILTALTKEGADSGITGSFANEMINLGFPWTGRLDTAREL--------KPLTAVFGDYSLITAPLPSKGGLELAIAIEMLSKVVPMTALVKENTLFYHRLIESLKVAQSTTSFLGDS--DNGIEP---KLLSTQSIQNLINMMGTSTALPNKNYGPYYSLSNIEKG-SGTHISIIDSSSLYVSLTVNLGSKFGSGIATKSGIVLNDAMRLFTSNDSTSLVPGIQIRNRTTSNNIAAPGKRPLNELAPLIVYNFKRKCGVRFAVGGDRGPQSTTGNLQMIMGAIYLDQKFCPSKDCMNLVKAGSRLRLYVNLLENTNQNNTATVYFDQNFPENFKTELTTVYQH 1834
            TVA+I+ I+FG PQ+     + TD   CT LG ++  + GS+VD+A+ + LC+ I  P  + +GG G ++VHN     +  IDF   AP     + +     I+    V +PG+LSG+  AH+ YG+M+W N++ +     +NG  VT +      +   +++S+ F+  +    N     +F    +L DIL A+  +G     +G  A EM+       G + T  +L        +P    +  + ++ +  P   G+ L  A+ +L      + + + +T+  H + E+LK+A    S LGD   D+ +     K+LS      L  ++  S A P  +Y   +SL   EKG +   + ++      VS+  +L   FGSGI T SGI+LN  +  F+  + T       + +    +N   PGKRP++ L P  V      CG   AVG   G ++ +   Q++M  +        S+  MN   A  RL           Q    T+  D  F E+ + EL  V  H
Sbjct:  137 TVALIMQIYFGDPQVYSQGAVVTDAARCTSLGFDVLGKQGSSVDAAVAAALCLGIVHPHTSGIGGGGVMLVHNIRKNETRVIDFRETAPFAIHEDMLQTNLDINTGLLVGVPGMLSGMHQAHQLYGRMSWKNVVAMAADVARNGFNVTHDFAEALSNVKNDNMSEAFQNLFLPNGNVPPSGLFIQRHDLADILEAVAVKGISEFYSGKIAQEMVT-AVQKKGGVLTEEDLGNYSIVLQEPAEVTYQGHHVMASSAP-HAGVALIAALNILEGYNITSQMSRNSTV--HWIAEALKIALGLASGLGDPLYDSSVTETVDKMLSKSQASLLRQLISDSEANPVSHYTSAFSL---EKGAAAAQVMVMGPDDHIVSVMSSLNKPFGSGIVTSSGILLNSQILDFSWANKT-------LSSSPNPHNNLQPGKRPMSFLMPTAVRPAVGLCGTYVAVGSSNGEKALSAITQVLMNVL-------SSRKNMNDSLAYGRLH---------PQLQPDTLLVDSEFSED-EVELLQVKGH 638          
BLAST of Gamma-glutamyltransferase 7 vs. Ensembl Medaka
Match: ggt1a (gamma-glutamyl transferase 1a [Source:NCBI gene;Acc:100820714])

HSP 1 Score: 147.517 bits (371), Expect = 4.877e-37
Identity = 149/550 (27.09%), Postives = 254/550 (46.18%), Query Frame = 2
Query:  293 TVAMILCIFFG-------PPQIRPHAGISTDVTECTDLGLEICRQGGSAVDSAIGSFLCVSIARPDLASLGGCGXXXXXXXXXXXXXXIDFSCVAPPNAQPE----PIPLGYGISKSVAMPGVLSGLKLAHKTYGKMNWTNILNLVTVKLQNGIKVTPEMQTVFKDPIFNSLSQNFRTNYQNWASGSVFTPSK-----ELLDILTALTKEGADSGITGSFANEMINLGFPWTGRLDTARELKPLTAVF---------GDYSLITAPLPSKGGLELAIAIEMLSK---VVPMTALVKENTLFYHRLIESLKVAQSTTSFLGDSDNGIEPKLLSTQS-IQNLINM---------MGTSTALPNKNYGPYYSLSNIEKGSGT-HISII--DSSSLYVSLTVN--LGSKFGSGIATKSGIVLNDAMRLFTSNDSTSLVPGIQIRNRTTSNNIAAPGKRPLNELAPLIVYNFKRKCGVRFAVGGDRGPQSTTGNLQMIMGAIYLDQKFCPSKDCMNLVKAGSRLRLYVNLLENTNQNNTATVYFDQNFPENFKTE 1813
            +VA+ + +FFG         QI   A ++ D   C+++G +I  +GGSAVD+ I   LCV +       +GG   L ++N  +    +ID    AP NA  +       L      ++A+PG + G ++AH+ +GK+ W ++        + G  +   + +   D     L+            G V   +K     +L +    + +EG D+   GS A  ++N      G + T  +LK  TAV          G+Y+++    P+ G + L++ + +L+         A  ++  L +HR++E+ + A +  S LGD      P+ LS  + IQNL +          +  S+  P   YGP + L +     GT HIS++  D S++  + T+N  LGSK    ++  +G++ N+ M  F+    T+   G  +    +++N   PGKRP++ +AP I+++   K  V+ AVGG  G + TT   Q+I+ A++ D          +L KA S  RL+  LL NT +   A   FDQN     K +
Sbjct:   17 SVAVFVGVFFGVRRKSSADGQIYLKAAVAADAGPCSEIGRDILLKGGSAVDATIAGLLCVGLMNAHSMGIGGGLFLTIYNAKTGKVETIDARETAPHNATRDMFGNSTDLATTGGLAIAVPGEIRGYQMAHQRHGKLPWKDLFQPSIQLAEKGFPLGRALASAISDKRDIILNDKVLCEVFCGEDGDVLKENKTIKFTKLAETYRKIAEEGPDAFYEGSLAQNLVN-DIQAAGGIITMEDLKNYTAVLDESPLRVNVGEYAMVVPNAPASGPV-LSLILNILNGYNFTADSVASPEKKILTFHRIVEAYRFAYAKRSSLGD------PRFLSIDNLIQNLTSQSFADALREKISDSSTQPVNYYGPDFYLPD---NHGTAHISVVSEDGSAVAATSTINHYLGSKV---MSNSTGVIFNNEMDDFSFPLITN---GFGV--PPSNSNFVEPGKRPMSSMAPAILFDKDNK--VKMAVGGSGGTKITTAIAQVILNALFFD---------YDLEKAVSDPRLHNQLLPNTTE---AEPDFDQNILNGLKAK 533          
BLAST of Gamma-glutamyltransferase 7 vs. Ensembl Medaka
Match: ENSORLT00000043223.1 (glutathione hydrolase 5 proenzyme [Source:NCBI gene;Acc:101161114])

HSP 1 Score: 130.954 bits (328), Expect = 1.312e-31
Identity = 138/552 (25.00%), Postives = 243/552 (44.02%), Query Frame = 2
Query:  296 VAMILCI--FFGPPQIRPHAGISTDVTECTDLGLEICRQ-GGSAVDSAIGSFLCVSIARPDLASLGGCGXXXXXXXXXXXXXXIDFSCVAPPNAQPEPIPLGYGIS----KSVAMPGVLSGLKLAHKTYGKMNWTNILNLVTVKLQNGIKVTPEMQTVFKD-PIFN---SLSQNFRTNYQNWASGSVFTPSKELLDILTALTKEGADSGITGSFANEMINLGFPWTGRL---DTARELKPLTAVF----GDYSLITAPLPSKGG-LELAIAIEMLSKVVPMTALVKENTLFYHRLIESLKVAQSTTSFLGDSDNGIE--PKLLSTQSIQNLINMMGTSTALPNKNYGPYYSLSNIEKGSGTHISIIDSSSLYVSLTVNLGSKFGSGIAT-KSGIVLNDAMRLFTSNDSTSLVPGIQIRNRTTSNNIAAPGKRPLNELAPLIVYNFKRKCGVRFAVGGDRGPQSTTGNLQMIMGAIYLDQKFCPSKDCMNLVKAGSRLRLYVNLLENTNQNNTATVYFDQNFPENFKTELTTVYQHSNFNISKAQNSINSIGK 1885
            +++I+CI  F  P      A ++TD   C+ +G  I ++ GGSAVD+AI + LC  +A P  A +GG G++     SS     I+    +P   + + +      S    K + +PG + G + AHK YGK+ W ++        + GI ++  + +  ++ P  N   SL + F  N  N+     F   ++L D L  +  +G D   TG  A +++       G L   D A     LT  +    G+Y +   P P+ G  L L + I     + P +   KE TLFYHR IES K A     ++ D     E   K  + +S  N I    T        +  Y    +++    TH+S++      V++T  +   FGS + + ++GI+LN+ +R F     + L                 PG+RP + ++P+++ +  R       +GG  G + TT     ++  ++L +     KD            +Y ++    ++N    V F+++F ++    L  +  H++  + K  NS+N++ K
Sbjct:   20 ISVIVCIAVFTRPRCPFSKAAVATDSEICSGIGRAILKEKGGSAVDAAIAALLCTFVANPHSAGIGG-GTIFTVMDSSGDVRIINSREASPTKVKSDLLKSCPEESMTDVKWIGVPGEIRGYEAAHKLYGKLPWADLFQPAIKLAREGIPISDFLHSHIENIPNSNETQSLRKLFTDNNNNFLKAGDFVKFEKLADTLEMIANQGPDVFYTGKIAEDLVQDVKAAGGTLELQDLASYKATLTDAWNVSMGEYRMYFPPPPAAGSLLTLILNIMRGFPLNPDSLTGKEKTLFYHRYIESFKFANGLKKYIRDPRFTSEKRAKEFTEESFANYIRSFITDDKTHELQF--YNVTPHLDSTGTTHVSVLHEDGSAVAVTSTINYIFGSRVVSPRTGIILNNELRDFCGRADSIL-----------------PGERPPSSMSPVVLKSKSRT----LTIGGSGGGRITTAMASALINHLWLGKSL---KDA-----------IYTSIAVVDSEN---AVDFERDFDKDVIEGLKAL-GHNHTTLRKFYNSVNAVEK 529          
BLAST of Gamma-glutamyltransferase 7 vs. Planmine SMEST
Match: SMESG000022957.1 (SMESG000022957.1)

HSP 1 Score: 1157.9 bits (2994), Expect = 0.000e+0
Identity = 610/615 (99.19%), Postives = 613/615 (99.67%), Query Frame = 2
Query:   98 MSEKGSKVNLVDNDELSNVSDXXXXXXXXXXXLSSLLNNFKTKFDIEYNGXXXXXXXXXXXXXXXTVAMILCIFFGPPQIRPHAGISTDVTECTDLGLEICRQGGSAVDSAIGSFLCVSIARPDLASLGGCGXXXXXXXXXXXXXXIDFSCVAPPNAQPEPIPLGYGISKSVAMPGVLSGLKLAHKTYGKMNWTNILNLVTVKLQNGIKVTPEMQTVFKDPIFNSLSQNFRTNYQNWASGSVFTPSKELLDILTALTKEGADSGITGSFANEMINLGFPWTGRLDTARELKPLTAVFGDYSLITAPLPSKGGLELAIAIEMLSKVVPMTALVKENTLFYHRLIESLKVAQSTTSFLGDSDNGIEPKLLSTQSIQNLINMMGTSTALPNKNYGPYYSLSNIEKGSGTHISIIDSSSLYVSLTVNLGSKFGSGIATKSGIVLNDAMRLFTSNDSTSLVPGIQIRNRTTSNNIAAPGKRPLNELAPLIVYNFKRKCGVRFAVGGDRGPQSTTGNLQMIMGAIYLDQKFCPSKDCMNLVKAGSRLRLYVNLLENTNQNNTATVYFDQNFPENFKTELTTVYQHSNFNISKAQNSINSIGKVQYEIQGFASSPGGRFVYF 1942
            MSEKGSKVNLVDNDELSNVSDKNEKEKEKINELSSLLNNFKTKFDIEYNGLFFIILSIIVFAIAITVAMILCIFFGPPQIRPHAGISTDVTECTDLGLEICRQGGSAVD AIGSFLCVSIARPDLASLGGCGSLVVHNHSSMVSNSIDFSCVAPPNAQPEPIPLGYGISKSVAMPGVLSGLKLAHKTYGKMNWTNILNLVTVKLQNGIKVTPEMQTVFKDPIFNSLSQNFRTNYQNWASGSVFTPSKELLDILTALT+EGADSGITGS ANEMINLGFPWTGRLDTARELKPLTAVFGDYSLITAPLPSKGGLELAIAIEMLSKVVPMTALVKENTLFYHRLIESLKVAQSTTSFLGDSDNGIEPKLLSTQSIQNLINMMGTSTALPNKNYGPYYSLSNIEKGSGTHISIIDSSSLYVSLTVNLGSKFGSGIATKSGIVLNDAMRLFTSNDS+S+VPGIQIRNRTTSNNIAAPGKRPLNELAPLIVYNFKRKCGVRFAVGGDRGPQSTTGNLQMIMGAIYLDQKFCPSKDCMNLVKAGSRLRLYVNLLENTNQNNTATVYFDQNFPENFKTELTTVYQHSNFNISKAQNSINSIGKVQYEIQGFASSPGGRFVYF
Sbjct:    1 MSEKGSKVNLVDNDELSNVSDKNEKEKEKINELSSLLNNFKTKFDIEYNGLFFIILSIIVFAIAITVAMILCIFFGPPQIRPHAGISTDVTECTDLGLEICRQGGSAVDGAIGSFLCVSIARPDLASLGGCGSLVVHNHSSMVSNSIDFSCVAPPNAQPEPIPLGYGISKSVAMPGVLSGLKLAHKTYGKMNWTNILNLVTVKLQNGIKVTPEMQTVFKDPIFNSLSQNFRTNYQNWASGSVFTPSKELLDILTALTREGADSGITGSLANEMINLGFPWTGRLDTARELKPLTAVFGDYSLITAPLPSKGGLELAIAIEMLSKVVPMTALVKENTLFYHRLIESLKVAQSTTSFLGDSDNGIEPKLLSTQSIQNLINMMGTSTALPNKNYGPYYSLSNIEKGSGTHISIIDSSSLYVSLTVNLGSKFGSGIATKSGIVLNDAMRLFTSNDSSSVVPGIQIRNRTTSNNIAAPGKRPLNELAPLIVYNFKRKCGVRFAVGGDRGPQSTTGNLQMIMGAIYLDQKFCPSKDCMNLVKAGSRLRLYVNLLENTNQNNTATVYFDQNFPENFKTELTTVYQHSNFNISKAQNSINSIGKVQYEIQGFASSPGGRFVYF 615          
BLAST of Gamma-glutamyltransferase 7 vs. Planmine SMEST
Match: SMESG000000747.1 (SMESG000000747.1)

HSP 1 Score: 104.375 bits (259), Expect = 4.583e-23
Identity = 112/440 (25.45%), Postives = 193/440 (43.86%), Query Frame = 2
Query:  344 HAGISTDVTECTDLGLEI-CRQGGSAVDSAIGSFLCVSIARPDLASLGGCGXXXXXXXXXXXXXXIDFSCVAPP-------NAQPEPIPLGYGISKSVAMPGVLSGLKLAHKTYGKMNWTNILNLVTVKLQNGIKVTPEMQTVFKDPIFNSLSQNF---RTNYQNWASGSVFTPSKEL--------LDILTALTKEGADSGITGSFANEMINLGFPWTG---RLDTARELKP-LTAVFGDYSLITAPLPSKGGLELAIAIEMLSKVVPMTAL--VKENTLFYHRLIESLKVAQSTTSFLGDSDNGIEPKLLSTQS-------IQNLINMMGTSTALPNKNYGPYYSLSNIEKGSGT-HISIIDSSSLYVSLTVNLGSKFGSGI-ATKSGIVLNDAMRLFTSNDSTSLVPGIQIRNRTTSNNIAAPGKRPLNELAPLIVYN 1561
            H+ +++D   C  +   I   +GG+A+D AI   LC          +GG    + +N     S + D   +AP        ++Q   I  G    KS+A+ G++S     H+ +G++ W ++   +   L+ G  V+ +++T       N     F   R    N  +G  F    ++        L+IL+       +  +  +   E+   G   T     +   +  KP L  +    +L T P PS GGL +A  + +L            +   LFYHRL+E+ K + +  S LGD D     KL++  S       I++LIN   T+   P+  YGP     + ++  GT H S+I      VS+T ++  KFGS +   ++GI+ ND M  F+  +  ++      + R + +N   P KRP++ ++P+IV N
Sbjct:   28 HSAVASDANHCATISKNIMISKGGNAIDGAIAGILCTCSVNFHSCGIGGGAFFIYYNRLHKTSYAFDIREIAPGLASENMFHSQKSYIAGG----KSIAVMGLISSYYEIHQRFGRLKWNDLFKPIIELLRKGFLVSEDLETAIISFFQNQSPTEFKELREFLTNHKTGKHFRAGDKIRRLKFANTLEILSKEPYAMKNGSLVDTIITEITKAGGIITKNDLNIYQMKIRKPLLMKMESGKTLHTLPPPSSGGL-VAFNLNVLQYYHDPKFFKNCQNKILFYHRLVETFKFSYALRSRLGDMDFVDVHKLVNKMSSKTYAKLIKSLINDNKTN---PSSYYGP---PGDFKEDHGTSHFSLISDEGDAVSITSSINYKFGSLVLGNETGIIYNDQMDDFSYPNRINIY-----KLRPSKSNFVRPYKRPMSSMSPIIVVN 451          
BLAST of Gamma-glutamyltransferase 7 vs. Planmine SMEST
Match: SMESG000000747.1 (SMESG000000747.1)

HSP 1 Score: 104.375 bits (259), Expect = 4.649e-23
Identity = 112/440 (25.45%), Postives = 193/440 (43.86%), Query Frame = 2
Query:  344 HAGISTDVTECTDLGLEI-CRQGGSAVDSAIGSFLCVSIARPDLASLGGCGXXXXXXXXXXXXXXIDFSCVAPP-------NAQPEPIPLGYGISKSVAMPGVLSGLKLAHKTYGKMNWTNILNLVTVKLQNGIKVTPEMQTVFKDPIFNSLSQNF---RTNYQNWASGSVFTPSKEL--------LDILTALTKEGADSGITGSFANEMINLGFPWTG---RLDTARELKP-LTAVFGDYSLITAPLPSKGGLELAIAIEMLSKVVPMTAL--VKENTLFYHRLIESLKVAQSTTSFLGDSDNGIEPKLLSTQS-------IQNLINMMGTSTALPNKNYGPYYSLSNIEKGSGT-HISIIDSSSLYVSLTVNLGSKFGSGI-ATKSGIVLNDAMRLFTSNDSTSLVPGIQIRNRTTSNNIAAPGKRPLNELAPLIVYN 1561
            H+ +++D   C  +   I   +GG+A+D AI   LC          +GG    + +N     S + D   +AP        ++Q   I  G    KS+A+ G++S     H+ +G++ W ++   +   L+ G  V+ +++T       N     F   R    N  +G  F    ++        L+IL+       +  +  +   E+   G   T     +   +  KP L  +    +L T P PS GGL +A  + +L            +   LFYHRL+E+ K + +  S LGD D     KL++  S       I++LIN   T+   P+  YGP     + ++  GT H S+I      VS+T ++  KFGS +   ++GI+ ND M  F+  +  ++      + R + +N   P KRP++ ++P+IV N
Sbjct:   31 HSAVASDANHCATISKNIMISKGGNAIDGAIAGILCTCSVNFHSCGIGGGAFFIYYNRLHKTSYAFDIREIAPGLASENMFHSQKSYIAGG----KSIAVMGLISSYYEIHQRFGRLKWNDLFKPIIELLRKGFLVSEDLETAIISFFQNQSPTEFKELREFLTNHKTGKHFRAGDKIRRLKFANTLEILSKEPYAMKNGSLVDTIITEITKAGGIITKNDLNIYQMKIRKPLLMKMESGKTLHTLPPPSSGGL-VAFNLNVLQYYHDPKFFKNCQNKILFYHRLVETFKFSYALRSRLGDMDFVDVHKLVNKMSSKTYAKLIKSLINDNKTN---PSSYYGP---PGDFKEDHGTSHFSLISDEGDAVSITSSINYKFGSLVLGNETGIIYNDQMDDFSYPNRINIY-----KLRPSKSNFVRPYKRPMSSMSPIIVVN 454          
BLAST of Gamma-glutamyltransferase 7 vs. Planmine SMEST
Match: SMESG000000747.1 (SMESG000000747.1)

HSP 1 Score: 104.375 bits (259), Expect = 4.719e-23
Identity = 112/440 (25.45%), Postives = 193/440 (43.86%), Query Frame = 2
Query:  344 HAGISTDVTECTDLGLEI-CRQGGSAVDSAIGSFLCVSIARPDLASLGGCGXXXXXXXXXXXXXXIDFSCVAPP-------NAQPEPIPLGYGISKSVAMPGVLSGLKLAHKTYGKMNWTNILNLVTVKLQNGIKVTPEMQTVFKDPIFNSLSQNF---RTNYQNWASGSVFTPSKEL--------LDILTALTKEGADSGITGSFANEMINLGFPWTG---RLDTARELKP-LTAVFGDYSLITAPLPSKGGLELAIAIEMLSKVVPMTAL--VKENTLFYHRLIESLKVAQSTTSFLGDSDNGIEPKLLSTQS-------IQNLINMMGTSTALPNKNYGPYYSLSNIEKGSGT-HISIIDSSSLYVSLTVNLGSKFGSGI-ATKSGIVLNDAMRLFTSNDSTSLVPGIQIRNRTTSNNIAAPGKRPLNELAPLIVYN 1561
            H+ +++D   C  +   I   +GG+A+D AI   LC          +GG    + +N     S + D   +AP        ++Q   I  G    KS+A+ G++S     H+ +G++ W ++   +   L+ G  V+ +++T       N     F   R    N  +G  F    ++        L+IL+       +  +  +   E+   G   T     +   +  KP L  +    +L T P PS GGL +A  + +L            +   LFYHRL+E+ K + +  S LGD D     KL++  S       I++LIN   T+   P+  YGP     + ++  GT H S+I      VS+T ++  KFGS +   ++GI+ ND M  F+  +  ++      + R + +N   P KRP++ ++P+IV N
Sbjct:   40 HSAVASDANHCATISKNIMISKGGNAIDGAIAGILCTCSVNFHSCGIGGGAFFIYYNRLHKTSYAFDIREIAPGLASENMFHSQKSYIAGG----KSIAVMGLISSYYEIHQRFGRLKWNDLFKPIIELLRKGFLVSEDLETAIISFFQNQSPTEFKELREFLTNHKTGKHFRAGDKIRRLKFANTLEILSKEPYAMKNGSLVDTIITEITKAGGIITKNDLNIYQMKIRKPLLMKMESGKTLHTLPPPSSGGL-VAFNLNVLQYYHDPKFFKNCQNKILFYHRLVETFKFSYALRSRLGDMDFVDVHKLVNKMSSKTYAKLIKSLINDNKTN---PSSYYGP---PGDFKEDHGTSHFSLISDEGDAVSITSSINYKFGSLVLGNETGIIYNDQMDDFSYPNRINIY-----KLRPSKSNFVRPYKRPMSSMSPIIVVN 463          
BLAST of Gamma-glutamyltransferase 7 vs. Planmine SMEST
Match: SMESG000000747.1 (SMESG000000747.1)

HSP 1 Score: 104.375 bits (259), Expect = 4.803e-23
Identity = 112/440 (25.45%), Postives = 193/440 (43.86%), Query Frame = 2
Query:  344 HAGISTDVTECTDLGLEI-CRQGGSAVDSAIGSFLCVSIARPDLASLGGCGXXXXXXXXXXXXXXIDFSCVAPP-------NAQPEPIPLGYGISKSVAMPGVLSGLKLAHKTYGKMNWTNILNLVTVKLQNGIKVTPEMQTVFKDPIFNSLSQNF---RTNYQNWASGSVFTPSKEL--------LDILTALTKEGADSGITGSFANEMINLGFPWTG---RLDTARELKP-LTAVFGDYSLITAPLPSKGGLELAIAIEMLSKVVPMTAL--VKENTLFYHRLIESLKVAQSTTSFLGDSDNGIEPKLLSTQS-------IQNLINMMGTSTALPNKNYGPYYSLSNIEKGSGT-HISIIDSSSLYVSLTVNLGSKFGSGI-ATKSGIVLNDAMRLFTSNDSTSLVPGIQIRNRTTSNNIAAPGKRPLNELAPLIVYN 1561
            H+ +++D   C  +   I   +GG+A+D AI   LC          +GG    + +N     S + D   +AP        ++Q   I  G    KS+A+ G++S     H+ +G++ W ++   +   L+ G  V+ +++T       N     F   R    N  +G  F    ++        L+IL+       +  +  +   E+   G   T     +   +  KP L  +    +L T P PS GGL +A  + +L            +   LFYHRL+E+ K + +  S LGD D     KL++  S       I++LIN   T+   P+  YGP     + ++  GT H S+I      VS+T ++  KFGS +   ++GI+ ND M  F+  +  ++      + R + +N   P KRP++ ++P+IV N
Sbjct:   44 HSAVASDANHCATISKNIMISKGGNAIDGAIAGILCTCSVNFHSCGIGGGAFFIYYNRLHKTSYAFDIREIAPGLASENMFHSQKSYIAGG----KSIAVMGLISSYYEIHQRFGRLKWNDLFKPIIELLRKGFLVSEDLETAIISFFQNQSPTEFKELREFLTNHKTGKHFRAGDKIRRLKFANTLEILSKEPYAMKNGSLVDTIITEITKAGGIITKNDLNIYQMKIRKPLLMKMESGKTLHTLPPPSSGGL-VAFNLNVLQYYHDPKFFKNCQNKILFYHRLVETFKFSYALRSRLGDMDFVDVHKLVNKMSSKTYAKLIKSLINDNKTN---PSSYYGP---PGDFKEDHGTSHFSLISDEGDAVSITSSINYKFGSLVLGNETGIIYNDQMDDFSYPNRINIY-----KLRPSKSNFVRPYKRPMSSMSPIIVVN 467          
The following BLAST results are available for this feature:
BLAST of Gamma-glutamyltransferase 7 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GGT71.719e-3427.59gamma-glutamyltransferase 7 [Source:HGNC Symbol;Ac... [more]
GGT16.993e-2324.07gamma-glutamyltransferase 1 [Source:HGNC Symbol;Ac... [more]
GGT16.993e-2324.07gamma-glutamyltransferase 1 [Source:HGNC Symbol;Ac... [more]
GGT16.993e-2324.07gamma-glutamyltransferase 1 [Source:HGNC Symbol;Ac... [more]
GGT16.198e-2125.23gamma-glutamyltransferase 1 [Source:HGNC Symbol;Ac... [more]
back to top
BLAST of Gamma-glutamyltransferase 7 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
H14N18.43.063e-2424.54pep chromosome:WBcel235:V:8924264:8927853:-1 gene:... [more]
H14N18.43.063e-2424.54pep chromosome:WBcel235:V:8923900:8927853:-1 gene:... [more]
H14N18.44.101e-2424.54pep chromosome:WBcel235:V:8923900:8928938:-1 gene:... [more]
H14N18.44.101e-2424.54pep chromosome:WBcel235:V:8924264:8928978:-1 gene:... [more]
H14N18.46.588e-2424.77pep chromosome:WBcel235:V:8923900:8928938:-1 gene:... [more]
back to top
BLAST of Gamma-glutamyltransferase 7 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ggt-14.498e-2125.43gene:FBgn0030932 transcript:FBtr0074622[more]
Ggt-14.498e-2125.43gene:FBgn0030932 transcript:FBtr0340368[more]
CG176364.940e-1924.56gene:FBgn0025837 transcript:FBtr0112921[more]
CG176365.537e-1924.56gene:FBgn0025837 transcript:FBtr0307095[more]
CG48296.015e-1725.47gene:FBgn0030796 transcript:FBtr0112994[more]
back to top
BLAST of Gamma-glutamyltransferase 7 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GGT71.583e-3529.53gamma-glutamyltransferase 7 [Source:NCBI gene;Acc:... [more]
ggt1a4.729e-3225.95gamma-glutamyltransferase 1a [Source:ZFIN;Acc:ZDB-... [more]
ggt1l2.21.280e-3127.18gamma-glutamyltransferase 1 like 2.2 [Source:ZFIN;... [more]
si:ch73-236c18.31.575e-3026.00si:ch73-236c18.3 [Source:ZFIN;Acc:ZDB-GENE-121214-... [more]
ggt1b5.310e-3024.48gamma-glutamyltransferase 1b [Source:ZFIN;Acc:ZDB-... [more]
back to top
BLAST of Gamma-glutamyltransferase 7 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GGT78.979e-4128.68gamma-glutamyltransferase 7 [Source:NCBI gene;Acc:... [more]
GGT74.525e-4029.01gamma-glutamyltransferase 7 [Source:NCBI gene;Acc:... [more]
GGT76.498e-3929.04gamma-glutamyltransferase 7 [Source:NCBI gene;Acc:... [more]
ggt12.212e-2726.86gamma-glutamyltransferase 1 [Source:NCBI gene;Acc:... [more]
ggt19.594e-2727.12gamma-glutamyltransferase 1 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Gamma-glutamyltransferase 7 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ggt75.231e-3327.40gamma-glutamyltransferase 7 [Source:MGI Symbol;Acc... [more]
Ggt14.096e-2926.05gamma-glutamyltransferase 1 [Source:MGI Symbol;Acc... [more]
Ggt14.096e-2926.05gamma-glutamyltransferase 1 [Source:MGI Symbol;Acc... [more]
Ggt54.926e-1925.25gamma-glutamyltransferase 5 [Source:MGI Symbol;Acc... [more]
Ggt71.803e-1732.16gamma-glutamyltransferase 7 [Source:MGI Symbol;Acc... [more]
back to top
BLAST of Gamma-glutamyltransferase 7 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9UJ14|GGT7_HUMAN8.256e-3427.59Glutathione hydrolase 7 OS=Homo sapiens OX=9606 GN... [more]
sp|Q0V8L2|GGT7_BOVIN1.481e-3228.18Glutathione hydrolase 7 OS=Bos taurus OX=9913 GN=G... [more]
sp|Q99JP7|GGT7_MOUSE3.659e-3227.40Glutathione hydrolase 7 OS=Mus musculus OX=10090 G... [more]
sp|Q99MZ4|GGT7_RAT1.227e-3127.50Glutathione hydrolase 7 OS=Rattus norvegicus OX=10... [more]
sp|P0DPU3|TX14A_SCODE4.082e-3025.67Scoloptoxin SSD14 OS=Scolopendra dehaani OX=260977... [more]
back to top
BLAST of Gamma-glutamyltransferase 7 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5J4N9335.766e-4932.14Gamma-glutamyltranspeptidase / glutathione hydrola... [more]
A0A1D1UY367.620e-4828.90Uncharacterized protein OS=Ramazzottius varieornat... [more]
A0A210Q1U82.806e-4627.47Gamma-glutamyltranspeptidase 1 OS=Mizuhopecten yes... [more]
A0A310U8P01.116e-4528.98Uncharacterized protein OS=Xenopus laevis OX=8355 ... [more]
A0A1S3JS091.717e-4530.48glutathione hydrolase 1 proenzyme-like OS=Lingula ... [more]
back to top
BLAST of Gamma-glutamyltransferase 7 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GGT71.309e-3429.43gamma-glutamyltransferase 7 [Source:HGNC Symbol;Ac... [more]
si:ch73-59p9.21.091e-3025.00gamma-glutamyltranspeptidase 1 [Source:NCBI gene;A... [more]
ggt1b1.735e-2525.51gamma-glutamyltranspeptidase 1-like [Source:NCBI g... [more]
ggt5a1.321e-2425.22gamma-glutamyltransferase 5a [Source:ZFIN;Acc:ZDB-... [more]
ggt5a1.770e-2425.22gamma-glutamyltransferase 5a [Source:ZFIN;Acc:ZDB-... [more]
back to top
BLAST of Gamma-glutamyltransferase 7 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSPMAT00000001319.16.568e-3227.86pep scaffold:Pmarinus_7.0:GL476337:669740:697940:-... [more]
ENSPMAT00000005677.11.959e-2925.30pep scaffold:Pmarinus_7.0:GL478518:21750:45518:-1 ... [more]
ENSPMAT00000005618.12.600e-1623.70pep scaffold:Pmarinus_7.0:GL478518:2729:14084:1 ge... [more]
ENSPMAT00000006210.16.442e-1027.27pep scaffold:Pmarinus_7.0:GL492264:524:3304:1 gene... [more]
back to top
BLAST of Gamma-glutamyltransferase 7 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
ECM387.372e-1033.50Gamma-glutamyltranspeptidase; major glutathione-de... [more]
back to top
BLAST of Gamma-glutamyltransferase 7 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO483554.771e-4729.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO425871.810e-3127.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO446351.523e-2526.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO376803.385e-2326.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO445723.518e-2125.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Gamma-glutamyltransferase 7 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ggt74.292e-4327.77gamma-glutamyltransferase 7 [Source:NCBI gene;Acc:... [more]
ggt75.481e-4327.77gamma-glutamyltransferase 7 [Source:NCBI gene;Acc:... [more]
ggt75.481e-4327.77gamma-glutamyltransferase 7 [Source:NCBI gene;Acc:... [more]
ggt1a4.877e-3727.09gamma-glutamyl transferase 1a [Source:NCBI gene;Ac... [more]
ENSORLT00000043223.11.312e-3125.00glutathione hydrolase 5 proenzyme [Source:NCBI gen... [more]
back to top
BLAST of Gamma-glutamyltransferase 7 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000022957.10.000e+099.19SMESG000022957.1[more]
SMESG000000747.14.583e-2325.45SMESG000000747.1[more]
SMESG000000747.14.649e-2325.45SMESG000000747.1[more]
SMESG000000747.14.719e-2325.45SMESG000000747.1[more]
SMESG000000747.14.803e-2325.45SMESG000000747.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027931 ID=SMED30027931|Name=Gamma-glutamyltransferase 7|organism=Schmidtea mediterranea sexual|type=transcript|length=2126bp
ACTACACAAAGTCAATTTTTAAAATTTCTATTTTGAGAAAAAATTTATTA
TAAAGTTAATTTAAAGAGAAAGCAAATTTTGACTGAAATTATTAAAAATG
TCGGAAAAAGGTAGTAAAGTCAATTTGGTAGACAACGATGAATTGAGTAA
CGTCAGTGATAAGAATGAAAAAGAAAAAGAGAAAATAAATGAATTGAGTA
GTTTATTGAATAATTTTAAAACCAAATTCGACATCGAATACAATGGATTG
TTTTTCATAATTTTGAGTATTATCGTTTTTGCAATCGCCATCACAGTTGC
AATGATTCTTTGCATATTTTTTGGACCTCCACAAATACGGCCACATGCGG
GAATTAGTACGGATGTGACGGAATGCACAGATTTGGGATTGGAAATCTGC
CGACAAGGCGGTAGCGCTGTCGACAGTGCGATTGGTTCTTTTCTTTGTGT
TTCTATCGCCCGGCCGGATTTAGCCAGCCTTGGAGGTTGTGGATCATTAG
TTGTCCATAACCATTCATCAATGGTGTCCAATTCGATTGATTTCTCTTGC
GTTGCGCCCCCAAATGCTCAACCGGAACCGATTCCTTTGGGCTATGGAAT
TTCTAAATCGGTTGCCATGCCTGGTGTCTTGTCCGGTCTAAAATTGGCTC
ACAAAACATACGGGAAAATGAATTGGACAAATATTTTAAATTTGGTTACT
GTCAAACTTCAAAATGGAATCAAAGTTACTCCAGAAATGCAAACCGTATT
CAAAGATCCAATATTCAACTCGCTGTCTCAAAATTTCCGTACCAATTATC
AAAACTGGGCATCTGGATCGGTATTCACACCCTCTAAAGAATTGTTGGAC
ATTCTAACCGCTCTCACTAAGGAGGGAGCAGATAGTGGGATAACTGGGTC
ATTCGCTAATGAAATGATCAACTTGGGATTCCCGTGGACTGGGCGATTGG
ACACTGCCAGAGAACTGAAGCCATTAACAGCAGTTTTTGGTGATTATTCG
TTGATAACTGCCCCATTGCCATCGAAAGGCGGCTTGGAGTTAGCTATTGC
CATTGAAATGTTGAGTAAAGTCGTTCCAATGACAGCCTTGGTGAAGGAGA
ACACATTGTTTTACCACCGATTAATAGAATCACTAAAAGTAGCTCAAAGC
ACAACATCTTTCCTTGGAGATTCAGATAATGGAATCGAACCTAAATTACT
TTCCACCCAATCCATCCAGAATCTCATCAACATGATGGGTACATCGACGG
CGCTACCGAATAAAAACTATGGCCCCTACTATAGTTTATCAAATATAGAA
AAGGGCAGCGGAACTCACATTTCAATTATAGATTCCAGCAGTCTCTATGT
GTCTTTGACAGTTAATCTTGGATCAAAATTTGGATCAGGAATCGCCACGA
AATCCGGAATAGTTTTGAATGATGCAATGAGACTGTTTACATCGAACGAT
TCCACATCGCTTGTGCCGGGAATACAGATCCGCAACAGGACAACCTCCAA
CAATATAGCCGCTCCGGGAAAACGGCCGCTCAATGAGTTGGCTCCTTTAA
TCGTTTATAATTTTAAAAGAAAATGCGGAGTTCGTTTTGCAGTTGGAGGT
GATCGAGGCCCCCAATCGACTACTGGGAATCTACAGATGATAATGGGAGC
AATTTATCTGGACCAGAAATTCTGTCCCAGTAAAGATTGTATGAATCTGG
TGAAGGCCGGCTCCCGTCTGCGTTTGTACGTAAATCTCCTTGAGAACACA
AATCAAAACAACACAGCGACGGTTTATTTCGACCAGAATTTCCCAGAGAA
TTTCAAGACAGAATTAACCACCGTTTATCAGCATTCGAATTTCAACATTT
CCAAAGCTCAAAATTCGATAAATTCAATTGGAAAAGTGCAGTATGAAATT
CAAGGTTTTGCCAGTTCTCCTGGTGGCCGATTTGTTTATTTTTAATGATA
AAATAATTGACAGTGATTTGACTTGTTGGTGGTGATATTTTATTCCGTGG
CCTTTGGCGTTATTTTCTTTTTGTTTTCATTCAATTCCACTCATAGATTA
AATGGAAGGAAAGTTTTTGACATTTTTTAATAATATTGAATTTGTTATAA
TCAATGTTTTCAGTTTTTATGCTGGC
back to top

protein sequence of SMED30027931-orf-1

>SMED30027931-orf-1 ID=SMED30027931-orf-1|Name=SMED30027931-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=616bp
MSEKGSKVNLVDNDELSNVSDKNEKEKEKINELSSLLNNFKTKFDIEYNG
LFFIILSIIVFAIAITVAMILCIFFGPPQIRPHAGISTDVTECTDLGLEI
CRQGGSAVDSAIGSFLCVSIARPDLASLGGCGSLVVHNHSSMVSNSIDFS
CVAPPNAQPEPIPLGYGISKSVAMPGVLSGLKLAHKTYGKMNWTNILNLV
TVKLQNGIKVTPEMQTVFKDPIFNSLSQNFRTNYQNWASGSVFTPSKELL
DILTALTKEGADSGITGSFANEMINLGFPWTGRLDTARELKPLTAVFGDY
SLITAPLPSKGGLELAIAIEMLSKVVPMTALVKENTLFYHRLIESLKVAQ
STTSFLGDSDNGIEPKLLSTQSIQNLINMMGTSTALPNKNYGPYYSLSNI
EKGSGTHISIIDSSSLYVSLTVNLGSKFGSGIATKSGIVLNDAMRLFTSN
DSTSLVPGIQIRNRTTSNNIAAPGKRPLNELAPLIVYNFKRKCGVRFAVG
GDRGPQSTTGNLQMIMGAIYLDQKFCPSKDCMNLVKAGSRLRLYVNLLEN
TNQNNTATVYFDQNFPENFKTELTTVYQHSNFNISKAQNSINSIGKVQYE
IQGFASSPGGRFVYF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR043137GGT_ssub
IPR043138GGT_lsub_C
IPR000101GGT_peptidase
IPR029055Ntn_hydrolases_N
Vocabulary: molecular function
TermDefinition
GO:0003840gamma-glutamyltransferase activity
GO:0036374glutathione hydrolase activity
Vocabulary: biological process
TermDefinition
GO:0006749glutathione metabolic process
GO:0006508proteolysis
GO:0006751glutathione catabolic process
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 16..43
NoneNo IPR availablePRINTSPR01210GGTRANSPTASEcoord: 106..131
score: 31.47
coord: 306..325
score: 25.68
coord: 500..517
score: 25.51
coord: 428..446
score: 25.6
coord: 473..488
score: 46.88
coord: 405..423
score: 35.17
coord: 171..189
score: 42.82
NoneNo IPR availablePFAMPF01019G_glu_transpeptcoord: 99..579
e-value: 2.6E-57
score: 194.8
NoneNo IPR availableTMHMMTMhelixcoord: 49..71
IPR043137Gamma-glutamyltranspeptidase, small subunitGENE3DG3DSA:3.60.20.40coord: 400..608
e-value: 1.3E-21
score: 79.1
IPR043138Gamma-glutamyltranspeptidase, large subunit, C-terminal domainGENE3DG3DSA:1.10.246.130coord: 292..395
e-value: 1.1E-7
score: 33.7
IPR000101Gamma-glutamyltranspeptidasePANTHERPTHR11686GAMMA GLUTAMYL TRANSPEPTIDASEcoord: 50..581
IPR029055Nucleophile aminohydrolases, N-terminalSUPERFAMILYSSF56235N-terminal nucleophile aminohydrolases (Ntn hydrolases)coord: 76..575