Polypyrimidine tract-binding protein 1

Overview
NamePolypyrimidine tract-binding protein 1
Smed IDSMED30027927
Length (bp)1794
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Polypyrimidine tract-binding protein 1 (SMED30027927) t-SNE clustered cells

Violin plots show distribution of expression levels for Polypyrimidine tract-binding protein 1 (SMED30027927) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Polypyrimidine tract-binding protein 1 (SMED30027927) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Polypyrimidine tract-binding protein 1 (SMED30027927) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027927

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30027927SMESG000022463.1 SmedASXL_012304SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30027927SMESG000022463.1 SmedASXL_012304SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
epidermisSMED30027927SMESG000022463.1 dd_Smed_v4_1868_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30027927SMESG000022463.1 dd_Smed_v4_1868_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30027927SMESG000022463.1 dd_Smed_v4_1868_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30027927SMESG000022463.1 Contig39707newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30027927SMESG000022463.1 Contig39707uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Human
Match: PTBP1 (polypyrimidine tract binding protein 1 [Source:HGNC Symbol;Acc:HGNC:9583])

HSP 1 Score: 280.026 bits (715), Expect = 1.725e-86
Identity = 188/543 (34.62%), Postives = 284/543 (52.30%), Query Frame = 1
Query:  199 SRVLHIRNVSSDVTERDIANLAIPFGLISYLVLTRKTGQALMEMHHEESAQAMVDYYSKCLPHFYGKNIVIQFSRYETLSGSGMHPEAET---------AVKGAN--------EDVRKLCEGEPKLVLHVTIEN-WEGSRLGHLHFYKLFQRYGTICRIIVFVQNQSPQALIEFENEVAAHVAKLQLGGSNAFYG-RPVRIEFSTRKSLDIKHESDTGRDYTISPVRKDELNSIPSFNSSYGMDDHGNANYSQHHDYPVSRQGGSMNNGQMTXXXXXXXXXXXXXXXSNNPNDTLPMLQSLA-PTLTSLLNQSQMGSMNSRESSRMNYSNENLNNTSSSRKSQGNANSVVIVANLNEDRISPDALFILFGVYGDVQRVKILYNKKNTALIQFVDGEHAARAVTNLNNVNLYGKPMRVNFSKHTSISMPKPEEQNSVHLNKDYSNSRLHRFKRATSRTVQNIYPPGTVLHLAGLPESYEEEEIKNLF-DDYAITKVKMINPNQRKMALVQLETIDMAIDALIKLHDCDVGLS-KLRVSFSKGFI 1761
            SRV+HIR +  DVTE ++ +L +PFG ++ L++ +   QA +EM+ EE+A  MV+YY+   P   G+ I IQFS ++ L  +   P             +V+  N             +       VL + +EN +    L  LH  ++F ++GT+ +II F +N   QAL+++ + V+A  AKL L G N +     +RI+FS   SL++K+ +D  RDYT    R D    +PS +S   +D    A +        S   G+                         P   +P    L+ P +   L    + S  +  ++    +   L    +S         V++V+NLN +R++P +LFILFGVYGDVQRVKIL+NKK  AL+Q  DG  A  A+++LN   L+GKP+R+  SKH ++ +P+ E Q    L KDY NS LHRFK+  S+  QNI+PP   LHL+ +P S  EE++K LF  +  + K        RKMAL+Q+ +++ A+ ALI LH+ D+G +  LRVSFSK  I
Sbjct:   28 SRVIHIRKLPIDVTEGEVISLGLPFGKVTNLLMLKGKNQAFIEMNTEEAANTMVNYYTSVTPVLRGQPIYIQFSNHKELK-TDSSPNQARAQAALQAVNSVQSGNLALAASAAAVDAGMAMAGQSPVLRIIVENLFYPVTLDVLH--QIFSKFGTVLKIITFTKNNQFQALLQYADPVSAQHAKLSLDGQNIYNACCTLRIDFSKLTSLNVKYNNDKSRDYT----RPD----LPSGDSQPSLDQTMAAAFGAPGIISASPYAGA----------------------GFPPTFAIPQAAGLSVPNVHGALAPLAIPSAAAAAAAAGRIAIPGLAGAGNS---------VLLVSNLNPERVTPQSLFILFGVYGDVQRVKILFNKKENALVQMADGNQAQLAMSHLNGHKLHGKPIRITLSKHQNVQLPR-EGQEDQGLTKDYGNSPLHRFKKPGSKNFQNIFPPSATLHLSNIPPSVSEEDLKVLFSSNGGVVKGFKFFQKDRKMALIQMGSVEEAVQALIDLHNHDLGENHHLRVSFSKSTI 527          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Human
Match: PTBP1 (polypyrimidine tract binding protein 1 [Source:HGNC Symbol;Acc:HGNC:9583])

HSP 1 Score: 280.411 bits (716), Expect = 3.617e-86
Identity = 188/543 (34.62%), Postives = 284/543 (52.30%), Query Frame = 1
Query:  199 SRVLHIRNVSSDVTERDIANLAIPFGLISYLVLTRKTGQALMEMHHEESAQAMVDYYSKCLPHFYGKNIVIQFSRYETLSGSGMHPEAET---------AVKGAN--------EDVRKLCEGEPKLVLHVTIEN-WEGSRLGHLHFYKLFQRYGTICRIIVFVQNQSPQALIEFENEVAAHVAKLQLGGSNAFYG-RPVRIEFSTRKSLDIKHESDTGRDYTISPVRKDELNSIPSFNSSYGMDDHGNANYSQHHDYPVSRQGGSMNNGQMTXXXXXXXXXXXXXXXSNNPNDTLPMLQSLA-PTLTSLLNQSQMGSMNSRESSRMNYSNENLNNTSSSRKSQGNANSVVIVANLNEDRISPDALFILFGVYGDVQRVKILYNKKNTALIQFVDGEHAARAVTNLNNVNLYGKPMRVNFSKHTSISMPKPEEQNSVHLNKDYSNSRLHRFKRATSRTVQNIYPPGTVLHLAGLPESYEEEEIKNLF-DDYAITKVKMINPNQRKMALVQLETIDMAIDALIKLHDCDVGLS-KLRVSFSKGFI 1761
            SRV+HIR +  DVTE ++ +L +PFG ++ L++ +   QA +EM+ EE+A  MV+YY+   P   G+ I IQFS ++ L  +   P             +V+  N             +       VL + +EN +    L  LH  ++F ++GT+ +II F +N   QAL+++ + V+A  AKL L G N +     +RI+FS   SL++K+ +D  RDYT    R D    +PS +S   +D    A +        S   G+                         P   +P    L+ P +   L    + S  +  ++    +   L    +S         V++V+NLN +R++P +LFILFGVYGDVQRVKIL+NKK  AL+Q  DG  A  A+++LN   L+GKP+R+  SKH ++ +P+ E Q    L KDY NS LHRFK+  S+  QNI+PP   LHL+ +P S  EE++K LF  +  + K        RKMAL+Q+ +++ A+ ALI LH+ D+G +  LRVSFSK  I
Sbjct:   58 SRVIHIRKLPIDVTEGEVISLGLPFGKVTNLLMLKGKNQAFIEMNTEEAANTMVNYYTSVTPVLRGQPIYIQFSNHKELK-TDSSPNQARAQAALQAVNSVQSGNLALAASAAAVDAGMAMAGQSPVLRIIVENLFYPVTLDVLH--QIFSKFGTVLKIITFTKNNQFQALLQYADPVSAQHAKLSLDGQNIYNACCTLRIDFSKLTSLNVKYNNDKSRDYT----RPD----LPSGDSQPSLDQTMAAAFGAPGIISASPYAGA----------------------GFPPTFAIPQAAGLSVPNVHGALAPLAIPSAAAAAAAAGRIAIPGLAGAGNS---------VLLVSNLNPERVTPQSLFILFGVYGDVQRVKILFNKKENALVQMADGNQAQLAMSHLNGHKLHGKPIRITLSKHQNVQLPR-EGQEDQGLTKDYGNSPLHRFKKPGSKNFQNIFPPSATLHLSNIPPSVSEEDLKVLFSSNGGVVKGFKFFQKDRKMALIQMGSVEEAVQALIDLHNHDLGENHHLRVSFSKSTI 557          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Human
Match: PTBP1 (polypyrimidine tract binding protein 1 [Source:HGNC Symbol;Acc:HGNC:9583])

HSP 1 Score: 278.1 bits (710), Expect = 4.948e-85
Identity = 191/573 (33.33%), Postives = 288/573 (50.26%), Query Frame = 1
Query:  199 SRVLHIRNVSSDVTERDIANLAIPFGLISYLVLTRKTGQALMEMHHEESAQAMVDYYSKCLPHFYGKNIVIQFSRYETL--------------------SGSGMHP-------------EAETAVKGANE--------------DVRKLCEGEPKLVLHVTIEN-WEGSRLGHLHFYKLFQRYGTICRIIVFVQNQSPQALIEFENEVAAHVAKLQLGGSNAFYG-RPVRIEFSTRKSLDIKHESDTGRDYTISPVRKDELNSIPSFNSSYGMDDHGNANYSQHHDYPVSRQGGSMNNGQMTXXXXXXXXXXXXXXXSNNPNDTLPMLQSLA-PTLTSLLNQSQMGSMNSRESSRMNYSNENLNNTSSSRKSQGNANSVVIVANLNEDRISPDALFILFGVYGDVQRVKILYNKKNTALIQFVDGEHAARAVTNLNNVNLYGKPMRVNFSKHTSISMPKPEEQNSVHLNKDYSNSRLHRFKRATSRTVQNIYPPGTVLHLAGLPESYEEEEIKNLF-DDYAITKVKMINPNQRKMALVQLETIDMAIDALIKLHDCDVGLS-KLRVSFSKGFI 1761
            SRV+HIR +  DVTE ++ +L +PFG ++ L++ +   QA +EM+ EE+A  MV+YY+   P   G+ I IQFS ++ L                      SG+ P              A+ A++  N                   +       VL + +EN +    L  LH  ++F ++GT+ +II F +N   QAL+++ + V+A  AKL L G N +     +RI+FS   SL++K+ +D  RDYT    R D    +PS +S   +D    A +        S   G+                         P   +P    L+ P +   L    + S  +  ++    +   L    +S         V++V+NLN +R++P +LFILFGVYGDVQRVKIL+NKK  AL+Q  DG  A  A+++LN   L+GKP+R+  SKH ++ +P+ E Q    L KDY NS LHRFK+  S+  QNI+PP   LHL+ +P S  EE++K LF  +  + K        RKMAL+Q+ +++ A+ ALI LH+ D+G +  LRVSFSK  I
Sbjct:   58 SRVIHIRKLPIDVTEGEVISLGLPFGKVTNLLMLKGKNQAFIEMNTEEAANTMVNYYTSVTPVLRGQPIYIQFSNHKELKTDSSPNQAVRGPAADPSSPGTSGVGPAAGAGDSRLCLPQRAQAALQAVNSVQSGNLALAASAAAVDAGMAMAGQSPVLRIIVENLFYPVTLDVLH--QIFSKFGTVLKIITFTKNNQFQALLQYADPVSAQHAKLSLDGQNIYNACCTLRIDFSKLTSLNVKYNNDKSRDYT----RPD----LPSGDSQPSLDQTMAAAFGAPGIISASPYAGA----------------------GFPPTFAIPQAAGLSVPNVHGALAPLAIPSAAAAAAAAGRIAIPGLAGAGNS---------VLLVSNLNPERVTPQSLFILFGVYGDVQRVKILFNKKENALVQMADGNQAQLAMSHLNGHKLHGKPIRITLSKHQNVQLPR-EGQEDQGLTKDYGNSPLHRFKKPGSKNFQNIFPPSATLHLSNIPPSVSEEDLKVLFSSNGGVVKGFKFFQKDRKMALIQMGSVEEAVQALIDLHNHDLGENHHLRVSFSKSTI 588          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Human
Match: PTBP1 (polypyrimidine tract binding protein 1 [Source:HGNC Symbol;Acc:HGNC:9583])

HSP 1 Score: 196.438 bits (498), Expect = 6.331e-55
Identity = 100/200 (50.00%), Postives = 137/200 (68.50%), Query Frame = 1
Query: 1168 GNANSVVIVANLNEDRISPDALFILFGVYGDVQRVKILYNKKNTALIQFVDGEHAARAVTNLNNVNLYGKPMRVNFSKHTSISMPKPEEQNSVHLNKDYSNSRLHRFKRATSRTVQNIYPPGTVLHLAGLPESYEEEEIKNLF-DDYAITKVKMINPNQRKMALVQLETIDMAIDALIKLHDCDVGLS-KLRVSFSKGFI 1761
            G  NSV++V+NLN +R++P +LFILFGVYGDVQRVKIL+NKK  AL+Q  DG  A  A+++LN   L+GKP+R+  SKH ++ +P+ E Q    L KDY NS LHRFK+  S+  QNI+PP   LHL+ +P S  EE++K LF  +  + K        RKMAL+Q+ +++ A+ ALI LH+ D+G +  LRVSFSK  I
Sbjct:  333 GAGNSVLLVSNLNPERVTPQSLFILFGVYGDVQRVKILFNKKENALVQMADGNQAQLAMSHLNGHKLHGKPIRITLSKHQNVQLPR-EGQEDQGLTKDYGNSPLHRFKKPGSKNFQNIFPPSATLHLSNIPPSVSEEDLKVLFSSNGGVVKGFKFFQKDRKMALIQMGSVEEAVQALIDLHNHDLGENHHLRVSFSKSTI 531          

HSP 2 Score: 118.242 bits (295), Expect = 1.512e-27
Identity = 80/244 (32.79%), Postives = 128/244 (52.46%), Query Frame = 1
Query:  199 SRVLHIRNVSSDVTERDIANLAIPFGLISYLVLTRKTGQALMEMHHEESAQAMVDYYSKCLPHFYGKNIVIQFSRYETLSGSGMHPEAET---------AVKGAN--------EDVRKLCEGEPKLVLHVTIEN-WEGSRLGHLHFYKLFQRYGTICRIIVFVQNQSPQALIEFENEVAAHVAKLQLGGSNAFYG-RPVRIEFSTRKSLDIKHESDTGRDYTISPVRKDELNSIPSFNSSYGMD 873
            SRV+HIR +  DVTE ++ +L +PFG ++ L++ +   QA +EM+ EE+A  MV+YY+   P   G+ I IQFS ++ L  +   P             +V+  N             +       VL + +EN +    L  LH  ++F ++GT+ +II F +N   QAL+++ + V+A  AKL L G N +     +RI+FS   SL++K+ +D  RDYT    R D    +PS +S   +D
Sbjct:   58 SRVIHIRKLPIDVTEGEVISLGLPFGKVTNLLMLKGKNQAFIEMNTEEAANTMVNYYTSVTPVLRGQPIYIQFSNHKELK-TDSSPNQARAQAALQAVNSVQSGNLALAASAAAVDAGMAMAGQSPVLRIIVENLFYPVTLDVLH--QIFSKFGTVLKIITFTKNNQFQALLQYADPVSAQHAKLSLDGQNIYNACCTLRIDFSKLTSLNVKYNNDKSRDYT----RPD----LPSGDSQPSLD 290          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Human
Match: PTBP1 (polypyrimidine tract binding protein 1 [Source:HGNC Symbol;Acc:HGNC:9583])

HSP 1 Score: 196.438 bits (498), Expect = 7.511e-55
Identity = 100/200 (50.00%), Postives = 137/200 (68.50%), Query Frame = 1
Query: 1168 GNANSVVIVANLNEDRISPDALFILFGVYGDVQRVKILYNKKNTALIQFVDGEHAARAVTNLNNVNLYGKPMRVNFSKHTSISMPKPEEQNSVHLNKDYSNSRLHRFKRATSRTVQNIYPPGTVLHLAGLPESYEEEEIKNLF-DDYAITKVKMINPNQRKMALVQLETIDMAIDALIKLHDCDVGLS-KLRVSFSKGFI 1761
            G  NSV++V+NLN +R++P +LFILFGVYGDVQRVKIL+NKK  AL+Q  DG  A  A+++LN   L+GKP+R+  SKH ++ +P+ E Q    L KDY NS LHRFK+  S+  QNI+PP   LHL+ +P S  EE++K LF  +  + K        RKMAL+Q+ +++ A+ ALI LH+ D+G +  LRVSFSK  I
Sbjct:  352 GAGNSVLLVSNLNPERVTPQSLFILFGVYGDVQRVKILFNKKENALVQMADGNQAQLAMSHLNGHKLHGKPIRITLSKHQNVQLPR-EGQEDQGLTKDYGNSPLHRFKKPGSKNFQNIFPPSATLHLSNIPPSVSEEDLKVLFSSNGGVVKGFKFFQKDRKMALIQMGSVEEAVQALIDLHNHDLGENHHLRVSFSKSTI 550          

HSP 2 Score: 118.627 bits (296), Expect = 1.701e-27
Identity = 81/252 (32.14%), Postives = 131/252 (51.98%), Query Frame = 1
Query:  199 SRVLHIRNVSSDVTERDIANLAIPFGLISYLVLTRKTGQALMEMHHEESAQAMVDYYSKCLPHFYGKNIVIQFSRYETLSGSGMHPEAET---------AVKGAN--------EDVRKLCEGEPKLVLHVTIEN-WEGSRLGHLHFYKLFQRYGTICRIIVFVQNQSPQALIEFENEVAAHVAKLQLGGSNAFYG-RPVRIEFSTRKSLDIKHESDTGRDYTISPVRKDELNSIPSFNSSYGMDDHGNANYS 897
            SRV+HIR +  DVTE ++ +L +PFG ++ L++ +   QA +EM+ EE+A  MV+YY+   P   G+ I IQFS ++ L  +   P             +V+  N             +       VL + +EN +    L  LH  ++F ++GT+ +II F +N   QAL+++ + V+A  AKL L G N +     +RI+FS   SL++K+ +D  RDYT    R D    +PS +S   +D    A ++
Sbjct:   58 SRVIHIRKLPIDVTEGEVISLGLPFGKVTNLLMLKGKNQAFIEMNTEEAANTMVNYYTSVTPVLRGQPIYIQFSNHKELK-TDSSPNQARAQAALQAVNSVQSGNLALAASAAAVDAGMAMAGQSPVLRIIVENLFYPVTLDVLH--QIFSKFGTVLKIITFTKNNQFQALLQYADPVSAQHAKLSLDGQNIYNACCTLRIDFSKLTSLNVKYNNDKSRDYT----RPD----LPSGDSQPSLDQTMAAAFA 298          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Celegans
Match: ptb-1 (PTB (HnRNP) homolog; Putative RNA-binding protein PTB-1a [Source:UniProtKB/TrEMBL;Acc:Q18999])

HSP 1 Score: 182.185 bits (461), Expect = 7.661e-51
Identity = 100/208 (48.08%), Postives = 137/208 (65.87%), Query Frame = 1
Query: 1147 SSSRKSQGNANSVVIVANLNEDRISPDALFILFGVYGDVQRVKILYNKKNTALIQFVDGEHAARAVTNLNNVNLYGKPMRVNFSKHTSISMPKPEEQNSVHLNKDYSNSRLHRFKRATSRTVQNIYPPGTVLHLAGLPESYEEEEIKNLFDD--YAITKVKMINPNQRKMALVQLETIDMAIDALIKLHDCDVGL-SKLRVSFSKGFI 1761
            SS R    N   V++V+NL+E +++ DALF LFGVYGDV RVKILYNKK+ ALIQ+ + + A  A+T+L+ V  + + +RV  SKHT++ MPK E Q    L +DY++S LHRFK+  S+   NIYPP   LHL+ +P S  EE++K +F +  +A+   K   P   KMAL QLE I+ AIDALI +H+  +   + LRVSFSK  I
Sbjct:  248 SSMRFPMINLTPVILVSNLHEMKVTTDALFTLFGVYGDVMRVKILYNKKDNALIQYSEPQQAQLALTHLDKVKWHDRLIRVAPSKHTNVQMPK-EGQPDAGLTRDYAHSTLHRFKKPGSKNYLNIYPPCATLHLSNIPTSVSEEKLKEMFAEAGFAVKAFKFF-PKDHKMALCQLEDIETAIDALIAMHNHKLAENAHLRVSFSKSGI 453          

HSP 2 Score: 61.2326 bits (147), Expect = 1.184e-9
Identity = 36/101 (35.64%), Postives = 56/101 (55.45%), Query Frame = 1
Query:  508 EGEPKLVLHVTIENWEGSRLGHLHFYKLFQRYGTICRIIVFVQNQSPQALIEFENEVAAHVAKLQLGGSNAFYG-RPVRIEFSTRKSLDIKHESDTGRDYT 807
            + +P  VL   IEN        +  Y+LF RYG + RII F +N + QAL++     +A +AK  L   N + G   +RI++S   +L++K+ +D  RDYT
Sbjct:   63 QQQPNSVLRTIIENMMFPVSLDV-LYQLFTRYGKVLRIITFNKNNTFQALVQMSEANSAQLAKQGLENQNVYNGCCTLRIDYSKLSTLNVKYNNDKSRDYT 162          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Celegans
Match: ptb-1 (PTB (HnRNP) homolog; Putative RNA-binding protein PTB-1a [Source:UniProtKB/TrEMBL;Acc:Q18999])

HSP 1 Score: 182.185 bits (461), Expect = 7.661e-51
Identity = 100/208 (48.08%), Postives = 137/208 (65.87%), Query Frame = 1
Query: 1147 SSSRKSQGNANSVVIVANLNEDRISPDALFILFGVYGDVQRVKILYNKKNTALIQFVDGEHAARAVTNLNNVNLYGKPMRVNFSKHTSISMPKPEEQNSVHLNKDYSNSRLHRFKRATSRTVQNIYPPGTVLHLAGLPESYEEEEIKNLFDD--YAITKVKMINPNQRKMALVQLETIDMAIDALIKLHDCDVGL-SKLRVSFSKGFI 1761
            SS R    N   V++V+NL+E +++ DALF LFGVYGDV RVKILYNKK+ ALIQ+ + + A  A+T+L+ V  + + +RV  SKHT++ MPK E Q    L +DY++S LHRFK+  S+   NIYPP   LHL+ +P S  EE++K +F +  +A+   K   P   KMAL QLE I+ AIDALI +H+  +   + LRVSFSK  I
Sbjct:  248 SSMRFPMINLTPVILVSNLHEMKVTTDALFTLFGVYGDVMRVKILYNKKDNALIQYSEPQQAQLALTHLDKVKWHDRLIRVAPSKHTNVQMPK-EGQPDAGLTRDYAHSTLHRFKKPGSKNYLNIYPPCATLHLSNIPTSVSEEKLKEMFAEAGFAVKAFKFF-PKDHKMALCQLEDIETAIDALIAMHNHKLAENAHLRVSFSKSGI 453          

HSP 2 Score: 61.2326 bits (147), Expect = 1.184e-9
Identity = 36/101 (35.64%), Postives = 56/101 (55.45%), Query Frame = 1
Query:  508 EGEPKLVLHVTIENWEGSRLGHLHFYKLFQRYGTICRIIVFVQNQSPQALIEFENEVAAHVAKLQLGGSNAFYG-RPVRIEFSTRKSLDIKHESDTGRDYT 807
            + +P  VL   IEN        +  Y+LF RYG + RII F +N + QAL++     +A +AK  L   N + G   +RI++S   +L++K+ +D  RDYT
Sbjct:   63 QQQPNSVLRTIIENMMFPVSLDV-LYQLFTRYGKVLRIITFNKNNTFQALVQMSEANSAQLAKQGLENQNVYNGCCTLRIDYSKLSTLNVKYNNDKSRDYT 162          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Celegans
Match: ptb-1 (PTB (HnRNP) homolog; Putative RNA-binding protein PTB-1a [Source:UniProtKB/TrEMBL;Acc:Q18999])

HSP 1 Score: 182.57 bits (462), Expect = 9.520e-50
Identity = 100/208 (48.08%), Postives = 137/208 (65.87%), Query Frame = 1
Query: 1147 SSSRKSQGNANSVVIVANLNEDRISPDALFILFGVYGDVQRVKILYNKKNTALIQFVDGEHAARAVTNLNNVNLYGKPMRVNFSKHTSISMPKPEEQNSVHLNKDYSNSRLHRFKRATSRTVQNIYPPGTVLHLAGLPESYEEEEIKNLFDD--YAITKVKMINPNQRKMALVQLETIDMAIDALIKLHDCDVGL-SKLRVSFSKGFI 1761
            SS R    N   V++V+NL+E +++ DALF LFGVYGDV RVKILYNKK+ ALIQ+ + + A  A+T+L+ V  + + +RV  SKHT++ MPK E Q    L +DY++S LHRFK+  S+   NIYPP   LHL+ +P S  EE++K +F +  +A+   K   P   KMAL QLE I+ AIDALI +H+  +   + LRVSFSK  I
Sbjct:  410 SSMRFPMINLTPVILVSNLHEMKVTTDALFTLFGVYGDVMRVKILYNKKDNALIQYSEPQQAQLALTHLDKVKWHDRLIRVAPSKHTNVQMPK-EGQPDAGLTRDYAHSTLHRFKKPGSKNYLNIYPPCATLHLSNIPTSVSEEKLKEMFAEAGFAVKAFKFF-PKDHKMALCQLEDIETAIDALIAMHNHKLAENAHLRVSFSKSGI 615          

HSP 2 Score: 86.2705 bits (212), Expect = 1.971e-17
Identity = 60/207 (28.99%), Postives = 105/207 (50.72%), Query Frame = 1
Query:  196 ISRVLHIRNVSSDVTERDIANLAIPFGLISYLVLTRKTGQALMEMHHEESAQAMVDYYSKCLPHFYGKNIVIQFSRYETLS--GSGMHPEAETAVKGANEDVRKLCEGEPKLVLHVTIENWEGSRLGHLHFYKLFQRYGTICRIIVFVQNQSPQALIEFENEVAAHVAKLQLGGSNAFYG-RPVRIEFSTRKSLDIKHESDTGRDYT 807
            +S+V+H+RN+  D+ + ++  L I +G +S  ++ +   QA +E   E SA A V   +       G+ +  Q+S +  L    +    + E+   G+  +     + +P  VL   IEN        +  Y+LF RYG + RII F +N + QAL++     +A +AK  L   N + G   +RI++S   +L++K+ +D  RDYT
Sbjct:  119 VSKVVHVRNIPPDLVDVELMQLCIQYGPVSNYMMLKGKSQAFVEYEEEASAAAFVSGMTAVPIQIRGRTLFAQYSTHRELKFDKNKAISDTESVANGSVSNFEVGTQQQPNSVLRTIIENMMFPVSLDV-LYQLFTRYGKVLRIITFNKNNTFQALVQMSEANSAQLAKQGLENQNVYNGCCTLRIDYSKLSTLNVKYNNDKSRDYT 324          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Celegans
Match: hrpl-1 (Heterogeneous nuclear RibonucleoProtein (HnRNP) L homolog [Source:UniProtKB/TrEMBL;Acc:Q95QR5])

HSP 1 Score: 77.7962 bits (190), Expect = 7.646e-15
Identity = 113/524 (21.56%), Postives = 197/524 (37.60%), Query Frame = 1
Query:  199 SRVLHIRNVSSDVTERDIANLAIPFGLISYLVLTRKTGQALMEMHHEESAQAMVDYYSKCLPHFYGKNIVIQFSRYETLSGSGMHPEAETAVKGANEDVRKLCEGEPKLVLHVTIENWEGSRLGHLHFYKLFQRYGTICRIIVFVQNQSPQALIEFENEVAAHVAKLQLGGSNAFYGR-PVRIEFSTRKSLDIKHESDTGRDY--------------TISPVRKDELNSIPSFNSSYGMDDHGNANYSQHHDYPVSRQGGSMNNGQMTXXXXXXXXXXXXXXXSNNPNDTLPMLQSLAPTLTSLLNQSQMGSMNSRESSRMNYSNENLNNTSSSRKSQGNANSVVIVANLNEDRISPDALFILFGVYGDVQRVKILYNKKNTALIQFVDGEHAARAVTNLNNVNLYG-----KPMRVNFSKHTSISMPKPEEQNSVHLNKDYSNSRLHRFKRATSRTVQNIYPPGTVLHLAGLPESYEEEEIKNLFDDYAITK-VKM-INP--NQRKMA-LVQLETIDMAIDAL 1695
            S V+H+RN+   VTE D+      FG ++Y      +  AL+E    E A+A V++ +    +  G+  +  +S  + +   G     E+A               P  VL VT+ N +      +  Y++    G + R+ V  +    QAL+EFE+   A  AK  + G++ + G   +++EF+    + ++ +    RD+              T+ P + D+    P  +     D H   +Y     Y  S +GG  ++                                              G       SR     ++  +   ++ + G    V+++  L   +I+ D LF +   YG+V R+  +  K  T +I+    E     +  L    L+G     KP       H       P+   S    KDYS+SR  RF          I  P   LH    P + +E+ + +L  +    K VK+ I P  N+R  A   + ET+++A + L
Sbjct:   31 SIVVHVRNLHQKVTEADLLEALSNFGPVAYATCIPHSRMALVEFEDIEGAKACVNFATSNQINVGGQGALFNYSTSQCIERMGF----ESAT--------------PNKVLVVTVLNAQYPIDADV-IYQISNAQGKVLRVAVMHKPTVVQALVEFESMEVAKAAKHAMNGADIYSGCCTLKVEFAKPDRVRVQRQDKDQRDFTLPDNESFQDTGRKTLIPAKPDDHYRRPYEDDRNHYDRH---DYQAPSSYGYSSRGGGHSD----------------------------------------YYGGDRGGPPHPPPSRYR---DDYEDRGYAQPAGGGPGCVMMIYGLEHGKINCDMLFNILCQYGNVLRISFMRTKTETGIIELGTPEERQNVLDFLQGSALFGLTLEFKPSHQECVHHLRDPFLLPDGSPSF---KDYSSSRNQRFSTPELAAKNRIIFPTNTLHWFNAPGTMDEQALLDLMAEKTEHKPVKIDIFPSRNERSAAGTAEFETVEIANEVL 486          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Celegans
Match: hrpl-1 (Heterogeneous nuclear RibonucleoProtein (HnRNP) L homolog [Source:UniProtKB/TrEMBL;Acc:Q95QR5])

HSP 1 Score: 77.7962 bits (190), Expect = 7.646e-15
Identity = 113/524 (21.56%), Postives = 197/524 (37.60%), Query Frame = 1
Query:  199 SRVLHIRNVSSDVTERDIANLAIPFGLISYLVLTRKTGQALMEMHHEESAQAMVDYYSKCLPHFYGKNIVIQFSRYETLSGSGMHPEAETAVKGANEDVRKLCEGEPKLVLHVTIENWEGSRLGHLHFYKLFQRYGTICRIIVFVQNQSPQALIEFENEVAAHVAKLQLGGSNAFYGR-PVRIEFSTRKSLDIKHESDTGRDY--------------TISPVRKDELNSIPSFNSSYGMDDHGNANYSQHHDYPVSRQGGSMNNGQMTXXXXXXXXXXXXXXXSNNPNDTLPMLQSLAPTLTSLLNQSQMGSMNSRESSRMNYSNENLNNTSSSRKSQGNANSVVIVANLNEDRISPDALFILFGVYGDVQRVKILYNKKNTALIQFVDGEHAARAVTNLNNVNLYG-----KPMRVNFSKHTSISMPKPEEQNSVHLNKDYSNSRLHRFKRATSRTVQNIYPPGTVLHLAGLPESYEEEEIKNLFDDYAITK-VKM-INP--NQRKMA-LVQLETIDMAIDAL 1695
            S V+H+RN+   VTE D+      FG ++Y      +  AL+E    E A+A V++ +    +  G+  +  +S  + +   G     E+A               P  VL VT+ N +      +  Y++    G + R+ V  +    QAL+EFE+   A  AK  + G++ + G   +++EF+    + ++ +    RD+              T+ P + D+    P  +     D H   +Y     Y  S +GG  ++                                              G       SR     ++  +   ++ + G    V+++  L   +I+ D LF +   YG+V R+  +  K  T +I+    E     +  L    L+G     KP       H       P+   S    KDYS+SR  RF          I  P   LH    P + +E+ + +L  +    K VK+ I P  N+R  A   + ET+++A + L
Sbjct:   31 SIVVHVRNLHQKVTEADLLEALSNFGPVAYATCIPHSRMALVEFEDIEGAKACVNFATSNQINVGGQGALFNYSTSQCIERMGF----ESAT--------------PNKVLVVTVLNAQYPIDADV-IYQISNAQGKVLRVAVMHKPTVVQALVEFESMEVAKAAKHAMNGADIYSGCCTLKVEFAKPDRVRVQRQDKDQRDFTLPDNESFQDTGRKTLIPAKPDDHYRRPYEDDRNHYDRH---DYQAPSSYGYSSRGGGHSD----------------------------------------YYGGDRGGPPHPPPSRYR---DDYEDRGYAQPAGGGPGCVMMIYGLEHGKINCDMLFNILCQYGNVLRISFMRTKTETGIIELGTPEERQNVLDFLQGSALFGLTLEFKPSHQECVHHLRDPFLLPDGSPSF---KDYSSSRNQRFSTPELAAKNRIIFPTNTLHWFNAPGTMDEQALLDLMAEKTEHKPVKIDIFPSRNERSAAGTAEFETVEIANEVL 486          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Fly
Match: heph (gene:FBgn0011224 transcript:FBtr0112865)

HSP 1 Score: 265.003 bits (676), Expect = 1.282e-80
Identity = 190/576 (32.99%), Postives = 288/576 (50.00%), Query Frame = 1
Query:  187 VDKISRVLHIRNVSSDVTERDIANLAIPFGLISYLVLTRKTGQALMEMHHEESAQAMVDYYSKCLPHFYGKNIVIQFSRYETL---------------------SGS-------------------------GMHPEAETAVKGANEDVRKLCEGEPKLVLHVTIENWE-GSRLGHLHFYKLFQRYGTICRIIVFVQNQSPQALIEFENEVAAHVAKLQLGGSNAFYG-RPVRIEFSTRKSLDIKHESDTGRDYTISPVRKDELNSIPSFNSSYGMDDHGNANYSQHHDYPVSRQGGSMNNGQMTXXXXXXXXXXXXXXXSNNPNDTLPMLQSLAPTLTSLLNQSQMGSMNSRESSRMNYSNENLNNTSSSRKSQGNANSVVIVANLNEDRISPDALFILFGVYGDVQRVKILYNKKNTALIQFVDGEHAARAVTNLNNVNLYGKPMRVNFSKHTSISMPKPEEQNSVHLNKDYSNSRLHRFKRATSRTVQNIYPPGTVLHLAGLPESYEEEEIKNLF--DDYAITKVKMINPNQRKMALVQLETIDMAIDALIKLHDCDVGLSK-LRVSFSKGFI 1761
            + K S+V+H+RN+ ++  E D+  L IPFG ++ +++ +   QA +EM  E SA +MV  Y+   P   G+ + +QFS +  L                     SGS                         G+         G N +      G P  VL V +E+      L  LH  ++FQRYG + +I+ F +N S QALI++ +  +A  AK  L G N + G   +RI+ S   +L++K+ +D  RD+T +P        +    ++ G+ +  +         P S  G  + NG             L    +   N+ LP L +      SL N    G++ +   +   YSN                  V++V+NLNE+ ++PDALF LFGVYGDVQRVKILYNKK++ALIQ  + + A  A+++L+ + L+GKP+RV  SKH ++ +PK E Q    L +DYS + LHRFK+  S+  QNIYPP   LHL+ +P S  E++IK  F  + + +   K   P  RKMAL+QL +++ A+ ALIK+H+  +  S  LRVSFSK  I
Sbjct:   29 IAKASKVIHLRNIPNESGEADVIALGIPFGRVTNVLVLKGKNQAFIEMADEISATSMVSCYTVTPPQMRGRMVYVQFSNHRELKTDQGHNNSTAHSDYSVQSPASGSPLPLSAAANATSNNANSSSDSNSAMGILQNTSAVNAGGNTN----AAGGPNTVLRVIVESLMYPVSLDILH--QIFQRYGKVLKIVTFTKNNSFQALIQYPDANSAQHAKSLLDGQNIYNGCCTLRIDNSKLTALNVKYNNDKSRDFT-NPALPPGEPGVDIMPTAGGLMNTNDLLLIAARQRP-SLSGDKIVNGLGAPGVLPPFALGLGTPLTGGYNNALPNLAAF-----SLANS---GALQTTAPAMRGYSN------------------VLLVSNLNEEMVTPDALFTLFGVYGDVQRVKILYNKKDSALIQMAEPQQAYLAMSHLDKLRLWGKPIRVMASKHQAVQLPK-EGQPDAGLTRDYSQNPLHRFKKPGSKNYQNIYPPSATLHLSNIPSSCSEDDIKEAFTSNSFEVKAFKFF-PKDRKMALLQLLSVEEAVLALIKMHNHQLSESNHLRVSFSKSNI 568          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Fly
Match: heph (gene:FBgn0011224 transcript:FBtr0300268)

HSP 1 Score: 264.618 bits (675), Expect = 2.508e-80
Identity = 190/576 (32.99%), Postives = 288/576 (50.00%), Query Frame = 1
Query:  187 VDKISRVLHIRNVSSDVTERDIANLAIPFGLISYLVLTRKTGQALMEMHHEESAQAMVDYYSKCLPHFYGKNIVIQFSRYETL---------------------SGS-------------------------GMHPEAETAVKGANEDVRKLCEGEPKLVLHVTIENWE-GSRLGHLHFYKLFQRYGTICRIIVFVQNQSPQALIEFENEVAAHVAKLQLGGSNAFYG-RPVRIEFSTRKSLDIKHESDTGRDYTISPVRKDELNSIPSFNSSYGMDDHGNANYSQHHDYPVSRQGGSMNNGQMTXXXXXXXXXXXXXXXSNNPNDTLPMLQSLAPTLTSLLNQSQMGSMNSRESSRMNYSNENLNNTSSSRKSQGNANSVVIVANLNEDRISPDALFILFGVYGDVQRVKILYNKKNTALIQFVDGEHAARAVTNLNNVNLYGKPMRVNFSKHTSISMPKPEEQNSVHLNKDYSNSRLHRFKRATSRTVQNIYPPGTVLHLAGLPESYEEEEIKNLF--DDYAITKVKMINPNQRKMALVQLETIDMAIDALIKLHDCDVGLSK-LRVSFSKGFI 1761
            + K S+V+H+RN+ ++  E D+  L IPFG ++ +++ +   QA +EM  E SA +MV  Y+   P   G+ + +QFS +  L                     SGS                         G+         G N +      G P  VL V +E+      L  LH  ++FQRYG + +I+ F +N S QALI++ +  +A  AK  L G N + G   +RI+ S   +L++K+ +D  RD+T +P        +    ++ G+ +  +         P S  G  + NG             L    +   N+ LP L +      SL N    G++ +   +   YSN                  V++V+NLNE+ ++PDALF LFGVYGDVQRVKILYNKK++ALIQ  + + A  A+++L+ + L+GKP+RV  SKH ++ +PK E Q    L +DYS + LHRFK+  S+  QNIYPP   LHL+ +P S  E++IK  F  + + +   K   P  RKMAL+QL +++ A+ ALIK+H+  +  S  LRVSFSK  I
Sbjct:   42 IAKASKVIHLRNIPNESGEADVIALGIPFGRVTNVLVLKGKNQAFIEMADEISATSMVSCYTVTPPQMRGRMVYVQFSNHRELKTDQGHNNSTAHSDYSVQSPASGSPLPLSAAANATSNNANSSSDSNSAMGILQNTSAVNAGGNTN----AAGGPNTVLRVIVESLMYPVSLDILH--QIFQRYGKVLKIVTFTKNNSFQALIQYPDANSAQHAKSLLDGQNIYNGCCTLRIDNSKLTALNVKYNNDKSRDFT-NPALPPGEPGVDIMPTAGGLMNTNDLLLIAARQRP-SLSGDKIVNGLGAPGVLPPFALGLGTPLTGGYNNALPNLAAF-----SLANS---GALQTTAPAMRGYSN------------------VLLVSNLNEEMVTPDALFTLFGVYGDVQRVKILYNKKDSALIQMAEPQQAYLAMSHLDKLRLWGKPIRVMASKHQAVQLPK-EGQPDAGLTRDYSQNPLHRFKKPGSKNYQNIYPPSATLHLSNIPSSCSEDDIKEAFTSNSFEVKAFKFF-PKDRKMALLQLLSVEEAVLALIKMHNHQLSESNHLRVSFSKSNI 581          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Fly
Match: heph (gene:FBgn0011224 transcript:FBtr0300269)

HSP 1 Score: 264.618 bits (675), Expect = 2.508e-80
Identity = 190/576 (32.99%), Postives = 288/576 (50.00%), Query Frame = 1
Query:  187 VDKISRVLHIRNVSSDVTERDIANLAIPFGLISYLVLTRKTGQALMEMHHEESAQAMVDYYSKCLPHFYGKNIVIQFSRYETL---------------------SGS-------------------------GMHPEAETAVKGANEDVRKLCEGEPKLVLHVTIENWE-GSRLGHLHFYKLFQRYGTICRIIVFVQNQSPQALIEFENEVAAHVAKLQLGGSNAFYG-RPVRIEFSTRKSLDIKHESDTGRDYTISPVRKDELNSIPSFNSSYGMDDHGNANYSQHHDYPVSRQGGSMNNGQMTXXXXXXXXXXXXXXXSNNPNDTLPMLQSLAPTLTSLLNQSQMGSMNSRESSRMNYSNENLNNTSSSRKSQGNANSVVIVANLNEDRISPDALFILFGVYGDVQRVKILYNKKNTALIQFVDGEHAARAVTNLNNVNLYGKPMRVNFSKHTSISMPKPEEQNSVHLNKDYSNSRLHRFKRATSRTVQNIYPPGTVLHLAGLPESYEEEEIKNLF--DDYAITKVKMINPNQRKMALVQLETIDMAIDALIKLHDCDVGLSK-LRVSFSKGFI 1761
            + K S+V+H+RN+ ++  E D+  L IPFG ++ +++ +   QA +EM  E SA +MV  Y+   P   G+ + +QFS +  L                     SGS                         G+         G N +      G P  VL V +E+      L  LH  ++FQRYG + +I+ F +N S QALI++ +  +A  AK  L G N + G   +RI+ S   +L++K+ +D  RD+T +P        +    ++ G+ +  +         P S  G  + NG             L    +   N+ LP L +      SL N    G++ +   +   YSN                  V++V+NLNE+ ++PDALF LFGVYGDVQRVKILYNKK++ALIQ  + + A  A+++L+ + L+GKP+RV  SKH ++ +PK E Q    L +DYS + LHRFK+  S+  QNIYPP   LHL+ +P S  E++IK  F  + + +   K   P  RKMAL+QL +++ A+ ALIK+H+  +  S  LRVSFSK  I
Sbjct:   42 IAKASKVIHLRNIPNESGEADVIALGIPFGRVTNVLVLKGKNQAFIEMADEISATSMVSCYTVTPPQMRGRMVYVQFSNHRELKTDQGHNNSTAHSDYSVQSPASGSPLPLSAAANATSNNANSSSDSNSAMGILQNTSAVNAGGNTN----AAGGPNTVLRVIVESLMYPVSLDILH--QIFQRYGKVLKIVTFTKNNSFQALIQYPDANSAQHAKSLLDGQNIYNGCCTLRIDNSKLTALNVKYNNDKSRDFT-NPALPPGEPGVDIMPTAGGLMNTNDLLLIAARQRP-SLSGDKIVNGLGAPGVLPPFALGLGTPLTGGYNNALPNLAAF-----SLANS---GALQTTAPAMRGYSN------------------VLLVSNLNEEMVTPDALFTLFGVYGDVQRVKILYNKKDSALIQMAEPQQAYLAMSHLDKLRLWGKPIRVMASKHQAVQLPK-EGQPDAGLTRDYSQNPLHRFKKPGSKNYQNIYPPSATLHLSNIPSSCSEDDIKEAFTSNSFEVKAFKFF-PKDRKMALLQLLSVEEAVLALIKMHNHQLSESNHLRVSFSKSNI 581          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Fly
Match: heph (gene:FBgn0011224 transcript:FBtr0300267)

HSP 1 Score: 264.618 bits (675), Expect = 2.508e-80
Identity = 190/576 (32.99%), Postives = 288/576 (50.00%), Query Frame = 1
Query:  187 VDKISRVLHIRNVSSDVTERDIANLAIPFGLISYLVLTRKTGQALMEMHHEESAQAMVDYYSKCLPHFYGKNIVIQFSRYETL---------------------SGS-------------------------GMHPEAETAVKGANEDVRKLCEGEPKLVLHVTIENWE-GSRLGHLHFYKLFQRYGTICRIIVFVQNQSPQALIEFENEVAAHVAKLQLGGSNAFYG-RPVRIEFSTRKSLDIKHESDTGRDYTISPVRKDELNSIPSFNSSYGMDDHGNANYSQHHDYPVSRQGGSMNNGQMTXXXXXXXXXXXXXXXSNNPNDTLPMLQSLAPTLTSLLNQSQMGSMNSRESSRMNYSNENLNNTSSSRKSQGNANSVVIVANLNEDRISPDALFILFGVYGDVQRVKILYNKKNTALIQFVDGEHAARAVTNLNNVNLYGKPMRVNFSKHTSISMPKPEEQNSVHLNKDYSNSRLHRFKRATSRTVQNIYPPGTVLHLAGLPESYEEEEIKNLF--DDYAITKVKMINPNQRKMALVQLETIDMAIDALIKLHDCDVGLSK-LRVSFSKGFI 1761
            + K S+V+H+RN+ ++  E D+  L IPFG ++ +++ +   QA +EM  E SA +MV  Y+   P   G+ + +QFS +  L                     SGS                         G+         G N +      G P  VL V +E+      L  LH  ++FQRYG + +I+ F +N S QALI++ +  +A  AK  L G N + G   +RI+ S   +L++K+ +D  RD+T +P        +    ++ G+ +  +         P S  G  + NG             L    +   N+ LP L +      SL N    G++ +   +   YSN                  V++V+NLNE+ ++PDALF LFGVYGDVQRVKILYNKK++ALIQ  + + A  A+++L+ + L+GKP+RV  SKH ++ +PK E Q    L +DYS + LHRFK+  S+  QNIYPP   LHL+ +P S  E++IK  F  + + +   K   P  RKMAL+QL +++ A+ ALIK+H+  +  S  LRVSFSK  I
Sbjct:   42 IAKASKVIHLRNIPNESGEADVIALGIPFGRVTNVLVLKGKNQAFIEMADEISATSMVSCYTVTPPQMRGRMVYVQFSNHRELKTDQGHNNSTAHSDYSVQSPASGSPLPLSAAANATSNNANSSSDSNSAMGILQNTSAVNAGGNTN----AAGGPNTVLRVIVESLMYPVSLDILH--QIFQRYGKVLKIVTFTKNNSFQALIQYPDANSAQHAKSLLDGQNIYNGCCTLRIDNSKLTALNVKYNNDKSRDFT-NPALPPGEPGVDIMPTAGGLMNTNDLLLIAARQRP-SLSGDKIVNGLGAPGVLPPFALGLGTPLTGGYNNALPNLAAF-----SLANS---GALQTTAPAMRGYSN------------------VLLVSNLNEEMVTPDALFTLFGVYGDVQRVKILYNKKDSALIQMAEPQQAYLAMSHLDKLRLWGKPIRVMASKHQAVQLPK-EGQPDAGLTRDYSQNPLHRFKKPGSKNYQNIYPPSATLHLSNIPSSCSEDDIKEAFTSNSFEVKAFKFF-PKDRKMALLQLLSVEEAVLALIKMHNHQLSESNHLRVSFSKSNI 581          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Fly
Match: heph (gene:FBgn0011224 transcript:FBtr0085880)

HSP 1 Score: 264.618 bits (675), Expect = 2.508e-80
Identity = 190/576 (32.99%), Postives = 288/576 (50.00%), Query Frame = 1
Query:  187 VDKISRVLHIRNVSSDVTERDIANLAIPFGLISYLVLTRKTGQALMEMHHEESAQAMVDYYSKCLPHFYGKNIVIQFSRYETL---------------------SGS-------------------------GMHPEAETAVKGANEDVRKLCEGEPKLVLHVTIENWE-GSRLGHLHFYKLFQRYGTICRIIVFVQNQSPQALIEFENEVAAHVAKLQLGGSNAFYG-RPVRIEFSTRKSLDIKHESDTGRDYTISPVRKDELNSIPSFNSSYGMDDHGNANYSQHHDYPVSRQGGSMNNGQMTXXXXXXXXXXXXXXXSNNPNDTLPMLQSLAPTLTSLLNQSQMGSMNSRESSRMNYSNENLNNTSSSRKSQGNANSVVIVANLNEDRISPDALFILFGVYGDVQRVKILYNKKNTALIQFVDGEHAARAVTNLNNVNLYGKPMRVNFSKHTSISMPKPEEQNSVHLNKDYSNSRLHRFKRATSRTVQNIYPPGTVLHLAGLPESYEEEEIKNLF--DDYAITKVKMINPNQRKMALVQLETIDMAIDALIKLHDCDVGLSK-LRVSFSKGFI 1761
            + K S+V+H+RN+ ++  E D+  L IPFG ++ +++ +   QA +EM  E SA +MV  Y+   P   G+ + +QFS +  L                     SGS                         G+         G N +      G P  VL V +E+      L  LH  ++FQRYG + +I+ F +N S QALI++ +  +A  AK  L G N + G   +RI+ S   +L++K+ +D  RD+T +P        +    ++ G+ +  +         P S  G  + NG             L    +   N+ LP L +      SL N    G++ +   +   YSN                  V++V+NLNE+ ++PDALF LFGVYGDVQRVKILYNKK++ALIQ  + + A  A+++L+ + L+GKP+RV  SKH ++ +PK E Q    L +DYS + LHRFK+  S+  QNIYPP   LHL+ +P S  E++IK  F  + + +   K   P  RKMAL+QL +++ A+ ALIK+H+  +  S  LRVSFSK  I
Sbjct:   42 IAKASKVIHLRNIPNESGEADVIALGIPFGRVTNVLVLKGKNQAFIEMADEISATSMVSCYTVTPPQMRGRMVYVQFSNHRELKTDQGHNNSTAHSDYSVQSPASGSPLPLSAAANATSNNANSSSDSNSAMGILQNTSAVNAGGNTN----AAGGPNTVLRVIVESLMYPVSLDILH--QIFQRYGKVLKIVTFTKNNSFQALIQYPDANSAQHAKSLLDGQNIYNGCCTLRIDNSKLTALNVKYNNDKSRDFT-NPALPPGEPGVDIMPTAGGLMNTNDLLLIAARQRP-SLSGDKIVNGLGAPGVLPPFALGLGTPLTGGYNNALPNLAAF-----SLANS---GALQTTAPAMRGYSN------------------VLLVSNLNEEMVTPDALFTLFGVYGDVQRVKILYNKKDSALIQMAEPQQAYLAMSHLDKLRLWGKPIRVMASKHQAVQLPK-EGQPDAGLTRDYSQNPLHRFKKPGSKNYQNIYPPSATLHLSNIPSSCSEDDIKEAFTSNSFEVKAFKFF-PKDRKMALLQLLSVEEAVLALIKMHNHQLSESNHLRVSFSKSNI 581          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Zebrafish
Match: ptbp1a (polypyrimidine tract binding protein 1a [Source:ZFIN;Acc:ZDB-GENE-050522-492])

HSP 1 Score: 191.045 bits (484), Expect = 7.105e-53
Identity = 97/198 (48.99%), Postives = 133/198 (67.17%), Query Frame = 1
Query: 1174 ANSVVIVANLNEDRISPDALFILFGVYGDVQRVKILYNKKNTALIQFVDGEHAARAVTNLNNVNLYGKPMRVNFSKHTSISMPKPEEQNSVHLNKDYSNSRLHRFKRATSRTVQNIYPPGTVLHLAGLPESYEEEEIKNLF-DDYAITKVKMINPNQRKMALVQLETIDMAIDALIKLHDCDVGLS-KLRVSFSKGFI 1761
             NSV++V+NLN + ++P  LFILFGVYGDV RVKIL+NKK  AL+Q  DG  A  A+++LN   LYGK +R   SKHT++ +P+ E      L KDYSNS LHRFK+  S+   NI+PP + LHL+ +P S  E++++ LF    A+ K        RKMAL+QL +++ AI++LIK H+ D+G +  LRVSFSK  I
Sbjct:  378 GNSVLLVSNLNPESVTPQCLFILFGVYGDVMRVKILFNKKENALVQMSDGTQAQLAMSHLNGQKLYGKALRATLSKHTTVQLPR-EGHEDQGLTKDYSNSPLHRFKKPGSKNYSNIFPPSSTLHLSNIPPSVTEDDLRGLFLSSGAVVKAFKFFQKDRKMALIQLASVEEAIESLIKFHNHDLGENHHLRVSFSKSTI 574          

HSP 2 Score: 120.168 bits (300), Expect = 2.951e-28
Identity = 79/235 (33.62%), Postives = 126/235 (53.62%), Query Frame = 1
Query:  199 SRVLHIRNVSSDVTERDIANLAIPFGLISYLVLTRKTGQALMEMHHEESAQAMVDYYSKCLPHFYGKNIVIQFSRYETLS--GSGMHPEAETAVKGAN---------EDVRKLCEGEPKLVLHVTIEN-WEGSRLGHLHFYKLFQRYGTICRIIVFVQNQSPQALIEFENEVAAHVAKLQLGGSNAFYG-RPVRIEFSTRKSLDIKHESDTGRDYTISPVRKD--ELNSIPSFNS 858
            SRV+H+R + +D+ E ++ +L +PFG ++ L++ +   QA +EM+ EESAQ MV YYS   P      I +Q+S ++ L    S     A+ A++  N           +     G    VL V +EN +    L  LH  ++F ++GT+ +II F +N   QAL+++ + + A  AKL L G N +     +RI FS   SL++K+ +D  RDYT    R D    +S PSF++
Sbjct:   73 SRVIHVRKLPNDINEAEVISLGLPFGKVTNLLMLKGKNQAFLEMNTEESAQTMVSYYSSVTPVIRNHPIFMQYSNHKELKTDNSPNQVRAQAALQAVNAVQTGGMSLAAIDGAGMGSQSPVLRVIVENLFYPVTLDVLH--QIFSKFGTVLKIITFTKNNQFQALVQYSDGMTAQHAKLSLDGQNIYNACCTLRISFSKLTSLNVKYNNDKSRDYT----RPDLPTGDSQPSFDA 301          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Zebrafish
Match: ptbp1b (polypyrimidine tract binding protein 1b [Source:ZFIN;Acc:ZDB-GENE-030131-9796])

HSP 1 Score: 187.963 bits (476), Expect = 6.804e-52
Identity = 96/195 (49.23%), Postives = 134/195 (68.72%), Query Frame = 1
Query: 1183 VVIVANLNEDRISPDALFILFGVYGDVQRVKILYNKKNTALIQFVDGEHAARAVTNLNNVNLYGKPMRVNFSKHTSISMPKPEEQNSVHLNKDYSNSRLHRFKRATSRTVQNIYPPGTVLHLAGLPESYEEEEIKNLFDDY-AITKVKMINPNQRKMALVQLETIDMAIDALIKLHDCDVGLS-KLRVSFSKGFI 1761
            V++V+NLN +R++P  LFILFGVYGDV RVKI++NKK  ALIQ  DG  A  A+++LN   LYG+P+R+  SKHT++ MP+ E      L KDYSNS LHRFK+  S+   NI+PP + LHL+ +P S  E+++K LF    A+ K        RKMAL+Q+ +++ AI++LI+ H+ D+G +  LRVSFSK  I
Sbjct:  362 VMLVSNLNPERVTPHCLFILFGVYGDVLRVKIMFNKKENALIQMSDGTQAQLAMSHLNGQKLYGRPLRITLSKHTTVQMPR-EGHEDQGLTKDYSNSPLHRFKKPGSKNYSNIFPPSSTLHLSNIPPSVVEDDLKLLFGSSGALVKNFKFFQKDRKMALIQMSSVEEAIESLIQFHNHDLGENHHLRVSFSKSTI 555          

HSP 2 Score: 121.709 bits (304), Expect = 9.509e-29
Identity = 84/264 (31.82%), Postives = 134/264 (50.76%), Query Frame = 1
Query:  199 SRVLHIRNVSSDVTERDIANLAIPFGLISYLVLTRKTGQALMEMHHEESAQAMVDYYSKCLPHFYGKNIVIQFSRYETLS--GSGMHPEAETAVKGANE-DVRKLCEG--------EPKLVLHVTIEN-WEGSRLGHLHFYKLFQRYGTICRIIVFVQNQSPQALIEFENEVAAHVAKLQLGGSNAFYG-RPVRIEFSTRKSLDIKHESDTGRDYTISPVRKDELNSIPSFNSSYGMDDH------------GNANYSQHHDYP 915
            SRV+H+R + +D+ E ++  L +PFG ++ L++ +   QA +EM+ EE+AQ MV YYS   P      I +Q+S ++ L    S     A+ A++  N      L  G         P  VL V +EN +    L  LH  ++F ++GT+ ++I F +N   QAL++F + + A  AKL L G N + G   +RI FS   SL++K+ +D  RDYT    R D    +P+ +S   ++ H              A Y+  H +P
Sbjct:   61 SRVIHVRKLPNDINEAEVIALGLPFGKVTNLLMLKGKNQAFLEMNSEEAAQTMVTYYSSVTPVIRNHPIFMQYSNHKELKTDNSPNQVRAQAALQAVNAVQTGSLTLGGVDPSGMTGPSPVLRVIVENLFYPVTLDVLH--QIFSKFGTVLKVITFTKNNQFQALLQFTDGLTAQHAKLALDGQNIYNGCCTLRISFSKLTSLNVKYNNDKSRDYT----RPD----LPTGDSQPALEHHAVAAAFAAPGIISAAPYASAHAFP 314          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Zebrafish
Match: ptbp1b (polypyrimidine tract binding protein 1b [Source:ZFIN;Acc:ZDB-GENE-030131-9796])

HSP 1 Score: 187.963 bits (476), Expect = 7.120e-52
Identity = 96/195 (49.23%), Postives = 134/195 (68.72%), Query Frame = 1
Query: 1183 VVIVANLNEDRISPDALFILFGVYGDVQRVKILYNKKNTALIQFVDGEHAARAVTNLNNVNLYGKPMRVNFSKHTSISMPKPEEQNSVHLNKDYSNSRLHRFKRATSRTVQNIYPPGTVLHLAGLPESYEEEEIKNLFDDY-AITKVKMINPNQRKMALVQLETIDMAIDALIKLHDCDVGLS-KLRVSFSKGFI 1761
            V++V+NLN +R++P  LFILFGVYGDV RVKI++NKK  ALIQ  DG  A  A+++LN   LYG+P+R+  SKHT++ MP+ E      L KDYSNS LHRFK+  S+   NI+PP + LHL+ +P S  E+++K LF    A+ K        RKMAL+Q+ +++ AI++LI+ H+ D+G +  LRVSFSK  I
Sbjct:  371 VMLVSNLNPERVTPHCLFILFGVYGDVLRVKIMFNKKENALIQMSDGTQAQLAMSHLNGQKLYGRPLRITLSKHTTVQMPR-EGHEDQGLTKDYSNSPLHRFKKPGSKNYSNIFPPSSTLHLSNIPPSVVEDDLKLLFGSSGALVKNFKFFQKDRKMALIQMSSVEEAIESLIQFHNHDLGENHHLRVSFSKSTI 564          

HSP 2 Score: 122.094 bits (305), Expect = 8.421e-29
Identity = 84/264 (31.82%), Postives = 134/264 (50.76%), Query Frame = 1
Query:  199 SRVLHIRNVSSDVTERDIANLAIPFGLISYLVLTRKTGQALMEMHHEESAQAMVDYYSKCLPHFYGKNIVIQFSRYETLS--GSGMHPEAETAVKGANE-DVRKLCEG--------EPKLVLHVTIEN-WEGSRLGHLHFYKLFQRYGTICRIIVFVQNQSPQALIEFENEVAAHVAKLQLGGSNAFYG-RPVRIEFSTRKSLDIKHESDTGRDYTISPVRKDELNSIPSFNSSYGMDDH------------GNANYSQHHDYP 915
            SRV+H+R + +D+ E ++  L +PFG ++ L++ +   QA +EM+ EE+AQ MV YYS   P      I +Q+S ++ L    S     A+ A++  N      L  G         P  VL V +EN +    L  LH  ++F ++GT+ ++I F +N   QAL++F + + A  AKL L G N + G   +RI FS   SL++K+ +D  RDYT    R D    +P+ +S   ++ H              A Y+  H +P
Sbjct:   70 SRVIHVRKLPNDINEAEVIALGLPFGKVTNLLMLKGKNQAFLEMNSEEAAQTMVTYYSSVTPVIRNHPIFMQYSNHKELKTDNSPNQVRAQAALQAVNAVQTGSLTLGGVDPSGMTGPSPVLRVIVENLFYPVTLDVLH--QIFSKFGTVLKVITFTKNNQFQALLQFTDGLTAQHAKLALDGQNIYNGCCTLRISFSKLTSLNVKYNNDKSRDYT----RPD----LPTGDSQPALEHHAVAAAFAAPGIISAAPYASAHAFP 323          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Zebrafish
Match: ptbp3 (polypyrimidine tract binding protein 3 [Source:ZFIN;Acc:ZDB-GENE-091116-1])

HSP 1 Score: 187.193 bits (474), Expect = 8.632e-52
Identity = 100/198 (50.51%), Postives = 131/198 (66.16%), Query Frame = 1
Query: 1177 NSVVIVANLNEDRISPDALFILFGVYGDVQRVKILYNKKNTALIQFVDGEHAARAVTNLNNVNLYGKPMRVNFSKHTSISMPKPEEQNSVHLNKDYSNSRLHRFKRATSRTVQNIYPPGTVLHLAGLPESYEEEEIKNLF--DDYAITKVKMINPNQRKMALVQLETIDMAIDALIKLHDCDVGLS-KLRVSFSKGFI 1761
            +SV++V+NLN D ISP  LFILFGVYGDV RVKIL+NKK  ALIQ  D   A  A+++LN   LYGK +RV  SKH ++ +P+ E Q    L KD+S S LHRFK+  S+  QNI+PP   LHL+ +P S  ++ +K+LF    Y +   K      RKMAL+QL +++ AI ALI LH+ D+G +  LRVSFSK  I
Sbjct:  327 HSVLLVSNLNPDSISPHELFILFGVYGDVHRVKILFNKKENALIQMADATQAQLAMSHLNGQRLYGKVIRVTISKHQTVQLPR-EGQEDQGLTKDFSGSPLHRFKKPGSKNFQNIFPPSATLHLSNIPPSTTDDFLKDLFASSGYTVKAFKFFQ-KDRKMALIQLGSVEEAIQALIHLHNHDLGENHHLRVSFSKSTI 522          

HSP 2 Score: 121.324 bits (303), Expect = 8.685e-29
Identity = 74/232 (31.90%), Postives = 124/232 (53.45%), Query Frame = 1
Query:  169 GGKRVCVDKISRVLHIRNVSSDVTERDIANLAIPFGLISYLVLTRKTGQALMEMHHEESAQAMVDYYSKCLPHFYGKNIVIQFSRYETLSGSGM--HPEAETAVKGAN---------------EDVRKLCEGEPKLVLHVTIEN-WEGSRLGHLHFYKLFQRYGTICRIIVFVQNQSPQALIEFENEVAAHVAKLQLGGSNAFYG-RPVRIEFSTRKSLDIKHESDTGRDYT 807
            G +  C    SRVLH+R V  +V+E ++ +L +PFG ++ L++ +   QA +EM  EE+A  MV+YY+   PH   + + IQ+S +  L    +     A+ A++  N                D   +    P  VL + +EN +    L  LH  ++F ++GT+ +II F +N   QAL+++ + + AH AK+ L G N + G   +R+EFS   SL++K+ +D  RD+T
Sbjct:   20 GDRSPCAP--SRVLHVRKVPIEVSEAEVVSLGVPFGKVTNLLMLKGKNQAFIEMASEEAAMTMVNYYTTATPHVRNQPVYIQYSNHRELKTDNLPNQGRAQAALQAVNAVHTGNMSLSGTATASDGGMMPGQSP--VLRIIVENLYYPVSLEVLH--QIFSKFGTVLKIITFTKNNQFQALLQYADPMNAHHAKVALDGQNIYNGCCTLRVEFSKLTSLNVKYNNDKSRDFT 245          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Zebrafish
Match: ptbp3 (polypyrimidine tract binding protein 3 [Source:ZFIN;Acc:ZDB-GENE-091116-1])

HSP 1 Score: 187.193 bits (474), Expect = 8.632e-52
Identity = 100/198 (50.51%), Postives = 131/198 (66.16%), Query Frame = 1
Query: 1177 NSVVIVANLNEDRISPDALFILFGVYGDVQRVKILYNKKNTALIQFVDGEHAARAVTNLNNVNLYGKPMRVNFSKHTSISMPKPEEQNSVHLNKDYSNSRLHRFKRATSRTVQNIYPPGTVLHLAGLPESYEEEEIKNLF--DDYAITKVKMINPNQRKMALVQLETIDMAIDALIKLHDCDVGLS-KLRVSFSKGFI 1761
            +SV++V+NLN D ISP  LFILFGVYGDV RVKIL+NKK  ALIQ  D   A  A+++LN   LYGK +RV  SKH ++ +P+ E Q    L KD+S S LHRFK+  S+  QNI+PP   LHL+ +P S  ++ +K+LF    Y +   K      RKMAL+QL +++ AI ALI LH+ D+G +  LRVSFSK  I
Sbjct:  327 HSVLLVSNLNPDSISPHELFILFGVYGDVHRVKILFNKKENALIQMADATQAQLAMSHLNGQRLYGKVIRVTISKHQTVQLPR-EGQEDQGLTKDFSGSPLHRFKKPGSKNFQNIFPPSATLHLSNIPPSTTDDFLKDLFASSGYTVKAFKFFQ-KDRKMALIQLGSVEEAIQALIHLHNHDLGENHHLRVSFSKSTI 522          

HSP 2 Score: 121.324 bits (303), Expect = 8.685e-29
Identity = 74/232 (31.90%), Postives = 124/232 (53.45%), Query Frame = 1
Query:  169 GGKRVCVDKISRVLHIRNVSSDVTERDIANLAIPFGLISYLVLTRKTGQALMEMHHEESAQAMVDYYSKCLPHFYGKNIVIQFSRYETLSGSGM--HPEAETAVKGAN---------------EDVRKLCEGEPKLVLHVTIEN-WEGSRLGHLHFYKLFQRYGTICRIIVFVQNQSPQALIEFENEVAAHVAKLQLGGSNAFYG-RPVRIEFSTRKSLDIKHESDTGRDYT 807
            G +  C    SRVLH+R V  +V+E ++ +L +PFG ++ L++ +   QA +EM  EE+A  MV+YY+   PH   + + IQ+S +  L    +     A+ A++  N                D   +    P  VL + +EN +    L  LH  ++F ++GT+ +II F +N   QAL+++ + + AH AK+ L G N + G   +R+EFS   SL++K+ +D  RD+T
Sbjct:   20 GDRSPCAP--SRVLHVRKVPIEVSEAEVVSLGVPFGKVTNLLMLKGKNQAFIEMASEEAAMTMVNYYTTATPHVRNQPVYIQYSNHRELKTDNLPNQGRAQAALQAVNAVHTGNMSLSGTATASDGGMMPGQSP--VLRIIVENLYYPVSLEVLH--QIFSKFGTVLKIITFTKNNQFQALLQYADPMNAHHAKVALDGQNIYNGCCTLRVEFSKLTSLNVKYNNDKSRDFT 245          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Xenopus
Match: ptbp1 (polypyrimidine tract binding protein 1 [Source:NCBI gene;Acc:496557])

HSP 1 Score: 195.282 bits (495), Expect = 2.630e-54
Identity = 99/199 (49.75%), Postives = 138/199 (69.35%), Query Frame = 1
Query: 1174 ANSVVIVANLNEDRISPDALFILFGVYGDVQRVKILYNKKNTALIQFVDGEHAARAVTNLNNVNLYGKPMRVNFSKHTSISMPKPEEQNSVHLNKDYSNSRLHRFKRATSRTVQNIYPPGTVLHLAGLPESYEEEEIKNLFDD--YAITKVKMINPNQRKMALVQLETIDMAIDALIKLHDCDVGLS-KLRVSFSKGFI 1761
             NSV++V+NLN +R++P  LFILFGVYGDV RVKIL+NKK  AL+Q  DG  A  A+++LN   L+GKP+R+  SKH ++ +P+ E Q    L KDYS S LHRFK+  S+  QNI+PP   LHL+ +P S  EE++K LF +  Y +   K    + RKMAL+Q+ +++ AI++LI+LH+ D+G +  LRVSFSK  I
Sbjct:  373 GNSVLLVSNLNPERVTPQCLFILFGVYGDVHRVKILFNKKENALVQMADGNQAQLAMSHLNGQRLHGKPLRITVSKHQTVQLPR-EGQEDQGLTKDYSTSPLHRFKKPGSKNFQNIFPPSATLHLSNIPPSVSEEDLKMLFSNNGYTVKGFKFFQKD-RKMALIQMGSVEEAIESLIELHNHDMGENHHLRVSFSKSTI 569          

HSP 2 Score: 110.538 bits (275), Expect = 6.410e-25
Identity = 68/221 (30.77%), Postives = 115/221 (52.04%), Query Frame = 1
Query:  199 SRVLHIRNVSSDVTERDIANLAIPFGLISYLVLTRKTGQALMEMHHEESAQAMVDYYSKCLPHFYGKNIVIQFSRYETLSGSG---------MHPEAETAVKGANEDVRKLCEGEPKL-------VLHVTIEN-WEGSRLGHLHFYKLFQRYGTICRIIVFVQNQSPQALIEFENEVAAHVAKLQLGGSNAFYG-RPVRIEFSTRKSLDIKHESDTGRDYT 807
            SRV+H+R +  DVTE ++ +L +PFG ++ L++ +   QA +EM+ EE+A  M++YY+   P    + I IQ+S ++ L                   + V G           +  +       VL + +EN +    L  L   ++F ++GT+ +II F +N   QAL+++ + V+A  AKL L G N +     +RI+FS   SL++K+ +D  RDYT
Sbjct:   62 SRVIHVRKLPGDVTEAEVISLGLPFGKVTNLLMLKGKNQAFLEMNTEEAANTMINYYTNVAPVLRSQPIYIQYSNHKELKTDNSPNQARAQAALQAVNSVVSGTTALSASAAAVDAGMAMSGQSPVLRIIVENLFYPVTLDVLQ--QIFSKFGTVLKIITFTKNNQFQALLQYGDPVSAQHAKLSLDGQNIYNACCTLRIDFSKLTSLNVKYNNDKSRDYT 280          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Xenopus
Match: htr4 (5-hydroxytryptamine (serotonin) receptor 4, G protein-coupled [Source:Xenbase;Acc:XB-GENE-993770])

HSP 1 Score: 186.808 bits (473), Expect = 2.030e-51
Identity = 97/198 (48.99%), Postives = 138/198 (69.70%), Query Frame = 1
Query: 1174 ANSVVIVANLNEDRISPDALFILFGVYGDVQRVKILYNKKNTALIQFVDGEHAARAVTNLNNVNLYGKPMRVNFSKHTSISMPKPEEQNSVHLNKDYSNSRLHRFKRATSRTVQNIYPPGTVLHLAGLPESYEEEEIKNLFDDYAITKVKMINPNQ-RKMALVQLETIDMAIDALIKLHDCDVGLS-KLRVSFSKGFI 1761
             N+V++V+NLNE+ +SP +LF LFGVYGDVQRVKILYNKK++ALIQ  DG  +  A+++LN   +YGK +RV  SKH ++ +P+ E  +   L KD+SNS LHRFK+  S+  QNI+PP   LHL+ +P++  E++++ LF +     VK     Q  KMAL+Q+ T++ AI ALI LH+ ++G +  LRVSFSK  I
Sbjct:  336 GNTVLLVSNLNEEMVSPQSLFTLFGVYGDVQRVKILYNKKDSALIQMADGNQSQLAMSHLNGQKMYGKIIRVTLSKHQTVQLPR-EGLDDQGLTKDFSNSPLHRFKKPGSKNFQNIFPPSATLHLSNIPQNITEDDLRTLFTNTG-GNVKAFKFFQDHKMALLQMSTVEEAIQALIDLHNYNIGDNHHLRVSFSKSTI 531          

HSP 2 Score: 126.331 bits (316), Expect = 3.622e-30
Identity = 75/218 (34.40%), Postives = 124/218 (56.88%), Query Frame = 1
Query:  199 SRVLHIRNVSSDVTERDIANLAIPFGLISYLVLTRKTGQALMEMHHEESAQAMVDYYSKCLPHFYGKNIVIQFSRYETL-SGSGMHPEAE------TAVKGANEDVRKLCEGEPKL------VLHVTIEN-WEGSRLGHLHFYKLFQRYGTICRIIVFVQNQSPQALIEFENEVAAHVAKLQLGGSNAFYG-RPVRIEFSTRKSLDIKHESDTGRDYT 807
            SRVLHIR +  +VTE ++  L +PFG ++ +++ +   QA +E+  EE+A  MV+YY+   PH   + I IQ+S ++ L + S ++  A+      TAV+ +N  V      E  +      VL + I+N +    L  LH  ++F ++GT+ +II F +N   QAL+++ + V A  AKL L G N +     +RI+FS   +L++K+ +D  RDYT
Sbjct:   58 SRVLHIRKLPGEVTETEVIALGLPFGKVTNILMLKGKNQAFLELATEEAASTMVNYYTTITPHLRNQPIYIQYSNHKELKTDSALNQRAQAVLQAVTAVQTSNSSVTSTAANENTVSSAQSPVLRIIIDNMYYPVTLDVLH--QIFSKFGTVLKIITFTKNNQFQALLQYGDPVNAQQAKLALDGQNIYNACCTLRIDFSKLVNLNVKYNNDKSRDYT 273          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Xenopus
Match: taco1 (translational activator of mitochondrially encoded cytochrome c oxidase I [Source:Xenbase;Acc:XB-GENE-986962])

HSP 1 Score: 181.03 bits (458), Expect = 1.955e-49
Identity = 96/199 (48.24%), Postives = 131/199 (65.83%), Query Frame = 1
Query: 1174 ANSVVIVANLNEDRISPDALFILFGVYGDVQRVKILYNKKNTALIQFVDGEHAARAVTNLNNVNLYGKPMRVNFSKHTSISMPKPEEQNSVHLNKDYSNSRLHRFKRATSRTVQNIYPPGTVLHLAGLPESYEEEEIKNLF--DDYAITKVKMINPNQRKMALVQLETIDMAIDALIKLHDCDVGLS-KLRVSFSKGFI 1761
             +SV++V+NLN D I P  LFILFGVYGDVQRVKIL+NKK  AL+Q  D   A  A+++LN   L+G+ +R+  SKH S+ +P+ E      L KDY+NS LHRFK+  S+  QNI+PP   LHL+ +P    +E++K LF     ++   K      RKMAL+QL +++ AI ALI+LH+ D+G +  LRVSFSK  I
Sbjct:  323 GHSVLLVSNLNPDAILPHGLFILFGVYGDVQRVKILFNKKENALVQMTDATQAQLAMSHLNGQRLHGRVLRITLSKHQSVQLPR-EGHEDQGLTKDYTNSPLHRFKKPGSKNFQNIFPPSATLHLSNIPPLVTDEDLKRLFASTGCSVKGFKFFQ-KDRKMALIQLGSVEEAILALIELHNHDLGENHHLRVSFSKSMI 519          

HSP 2 Score: 120.553 bits (301), Expect = 2.599e-28
Identity = 78/226 (34.51%), Postives = 122/226 (53.98%), Query Frame = 1
Query:  199 SRVLHIRNVSSDVTERDIANLAIPFGLISYLVLTRKTGQALMEMHHEESAQAMVDYYSKCLPHFYGKNIVIQFSRYE---------------------TLSGSGMHPEAETAVKGANEDVRKLCEGEPKLVLHVTIEN-WEGSRLGHLHFYKLFQRYGTICRIIVFVQNQSPQALIEFENEVAAHVAKLQLGGSNAFYG-RPVRIEFSTRKSLDIKHESDTGRDYT 807
            SRVLHIR + +DVTE +I +L +PFG ++ L++ +   QA +EM  EE+A +MV+YY+   PH   + + IQ+S +                      TL   G+     T+V G    V  L    P  VL + +EN +    L  LH  ++F ++GT+ +II F +N   QAL+++ + + AH AK+ L G N +     +RIEFS   SL++K+ +D  RD+T
Sbjct:   27 SRVLHIRKIPNDVTESEIISLGLPFGKVTNLLMLKGKSQAFLEMASEEAAVSMVNYYTPVPPHVRSQPVYIQYSNHRELKTDNLPNQARAQAALQAVNTLQSGGL---TLTSVPGGEGLV--LSGQSP--VLRIIVENLFYPVTLEVLH--QIFSKFGTVIKIITFTKNNQFQALLQYADPMNAHHAKVALDGQNIYNACCTLRIEFSKLTSLNVKYNNDKSRDFT 243          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Xenopus
Match: taco1 (translational activator of mitochondrially encoded cytochrome c oxidase I [Source:Xenbase;Acc:XB-GENE-986962])

HSP 1 Score: 181.03 bits (458), Expect = 2.070e-49
Identity = 96/199 (48.24%), Postives = 131/199 (65.83%), Query Frame = 1
Query: 1174 ANSVVIVANLNEDRISPDALFILFGVYGDVQRVKILYNKKNTALIQFVDGEHAARAVTNLNNVNLYGKPMRVNFSKHTSISMPKPEEQNSVHLNKDYSNSRLHRFKRATSRTVQNIYPPGTVLHLAGLPESYEEEEIKNLF--DDYAITKVKMINPNQRKMALVQLETIDMAIDALIKLHDCDVGLS-KLRVSFSKGFI 1761
             +SV++V+NLN D I P  LFILFGVYGDVQRVKIL+NKK  AL+Q  D   A  A+++LN   L+G+ +R+  SKH S+ +P+ E      L KDY+NS LHRFK+  S+  QNI+PP   LHL+ +P    +E++K LF     ++   K      RKMAL+QL +++ AI ALI+LH+ D+G +  LRVSFSK  I
Sbjct:  334 GHSVLLVSNLNPDAILPHGLFILFGVYGDVQRVKILFNKKENALVQMTDATQAQLAMSHLNGQRLHGRVLRITLSKHQSVQLPR-EGHEDQGLTKDYTNSPLHRFKKPGSKNFQNIFPPSATLHLSNIPPLVTDEDLKRLFASTGCSVKGFKFFQ-KDRKMALIQLGSVEEAILALIELHNHDLGENHHLRVSFSKSMI 530          

HSP 2 Score: 120.553 bits (301), Expect = 2.571e-28
Identity = 78/226 (34.51%), Postives = 122/226 (53.98%), Query Frame = 1
Query:  199 SRVLHIRNVSSDVTERDIANLAIPFGLISYLVLTRKTGQALMEMHHEESAQAMVDYYSKCLPHFYGKNIVIQFSRYE---------------------TLSGSGMHPEAETAVKGANEDVRKLCEGEPKLVLHVTIEN-WEGSRLGHLHFYKLFQRYGTICRIIVFVQNQSPQALIEFENEVAAHVAKLQLGGSNAFYG-RPVRIEFSTRKSLDIKHESDTGRDYT 807
            SRVLHIR + +DVTE +I +L +PFG ++ L++ +   QA +EM  EE+A +MV+YY+   PH   + + IQ+S +                      TL   G+     T+V G    V  L    P  VL + +EN +    L  LH  ++F ++GT+ +II F +N   QAL+++ + + AH AK+ L G N +     +RIEFS   SL++K+ +D  RD+T
Sbjct:   38 SRVLHIRKIPNDVTESEIISLGLPFGKVTNLLMLKGKSQAFLEMASEEAAVSMVNYYTPVPPHVRSQPVYIQYSNHRELKTDNLPNQARAQAALQAVNTLQSGGL---TLTSVPGGEGLV--LSGQSP--VLRIIVENLFYPVTLEVLH--QIFSKFGTVIKIITFTKNNQFQALLQYADPMNAHHAKVALDGQNIYNACCTLRIEFSKLTSLNVKYNNDKSRDFT 254          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Xenopus
Match: taco1 (translational activator of mitochondrially encoded cytochrome c oxidase I [Source:Xenbase;Acc:XB-GENE-986962])

HSP 1 Score: 181.03 bits (458), Expect = 2.107e-49
Identity = 96/199 (48.24%), Postives = 131/199 (65.83%), Query Frame = 1
Query: 1174 ANSVVIVANLNEDRISPDALFILFGVYGDVQRVKILYNKKNTALIQFVDGEHAARAVTNLNNVNLYGKPMRVNFSKHTSISMPKPEEQNSVHLNKDYSNSRLHRFKRATSRTVQNIYPPGTVLHLAGLPESYEEEEIKNLF--DDYAITKVKMINPNQRKMALVQLETIDMAIDALIKLHDCDVGLS-KLRVSFSKGFI 1761
             +SV++V+NLN D I P  LFILFGVYGDVQRVKIL+NKK  AL+Q  D   A  A+++LN   L+G+ +R+  SKH S+ +P+ E      L KDY+NS LHRFK+  S+  QNI+PP   LHL+ +P    +E++K LF     ++   K      RKMAL+QL +++ AI ALI+LH+ D+G +  LRVSFSK  I
Sbjct:  326 GHSVLLVSNLNPDAILPHGLFILFGVYGDVQRVKILFNKKENALVQMTDATQAQLAMSHLNGQRLHGRVLRITLSKHQSVQLPR-EGHEDQGLTKDYTNSPLHRFKKPGSKNFQNIFPPSATLHLSNIPPLVTDEDLKRLFASTGCSVKGFKFFQ-KDRKMALIQLGSVEEAILALIELHNHDLGENHHLRVSFSKSMI 522          

HSP 2 Score: 120.168 bits (300), Expect = 3.549e-28
Identity = 78/226 (34.51%), Postives = 122/226 (53.98%), Query Frame = 1
Query:  199 SRVLHIRNVSSDVTERDIANLAIPFGLISYLVLTRKTGQALMEMHHEESAQAMVDYYSKCLPHFYGKNIVIQFSRYE---------------------TLSGSGMHPEAETAVKGANEDVRKLCEGEPKLVLHVTIEN-WEGSRLGHLHFYKLFQRYGTICRIIVFVQNQSPQALIEFENEVAAHVAKLQLGGSNAFYG-RPVRIEFSTRKSLDIKHESDTGRDYT 807
            SRVLHIR + +DVTE +I +L +PFG ++ L++ +   QA +EM  EE+A +MV+YY+   PH   + + IQ+S +                      TL   G+     T+V G    V  L    P  VL + +EN +    L  LH  ++F ++GT+ +II F +N   QAL+++ + + AH AK+ L G N +     +RIEFS   SL++K+ +D  RD+T
Sbjct:   30 SRVLHIRKIPNDVTESEIISLGLPFGKVTNLLMLKGKSQAFLEMASEEAAVSMVNYYTPVPPHVRSQPVYIQYSNHRELKTDNLPNQARAQAALQAVNTLQSGGL---TLTSVPGGEGLV--LSGQSP--VLRIIVENLFYPVTLEVLH--QIFSKFGTVIKIITFTKNNQFQALLQYADPMNAHHAKVALDGQNIYNACCTLRIEFSKLTSLNVKYNNDKSRDFT 246          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Mouse
Match: Ptbp1 (polypyrimidine tract binding protein 1 [Source:MGI Symbol;Acc:MGI:97791])

HSP 1 Score: 278.87 bits (712), Expect = 8.747e-86
Identity = 185/543 (34.07%), Postives = 283/543 (52.12%), Query Frame = 1
Query:  199 SRVLHIRNVSSDVTERDIANLAIPFGLISYLVLTRKTGQALMEMHHEESAQAMVDYYSKCLPHFYGKNIVIQFSRYETLSGSGMHPEAET---------AVKGAN--------EDVRKLCEGEPKLVLHVTIEN-WEGSRLGHLHFYKLFQRYGTICRIIVFVQNQSPQALIEFENEVAAHVAKLQLGGSNAFYG-RPVRIEFSTRKSLDIKHESDTGRDYTISPVRKDELNSIPSFNSSYGMDDHGNANYSQHHDYPVSRQGGSMNNGQMTXXXXXXXXXXXXXXXSNNPNDTLPMLQSLA-PTLTSLLNQSQMGSMNSRESSRMNYSNENLNNTSSSRKSQGNANSVVIVANLNEDRISPDALFILFGVYGDVQRVKILYNKKNTALIQFVDGEHAARAVTNLNNVNLYGKPMRVNFSKHTSISMPKPEEQNSVHLNKDYSNSRLHRFKRATSRTVQNIYPPGTVLHLAGLPESYEEEEIKNLF-DDYAITKVKMINPNQRKMALVQLETIDMAIDALIKLHDCDVGLS-KLRVSFSKGFI 1761
            SRV+H+R + SDVTE ++ +L +PFG ++ L++ +   QA +EM+ EE+A  MV+YY+   P   G+ I IQFS ++ L  +   P             +V+  N             +       VL + +EN +    L  LH  ++F ++GT+ +II F +N   QAL+++ + V+A  AKL L G N +     +RI+FS   SL++K+ +D  RDYT    R D    +PS +S   +D    A +        S   G+                         P   +P    L+ P +         G++          +              GN+  V++V+NLN +R++P +LFILFGVYGDVQRVKIL+NKK  AL+Q  DG  A  A+++LN   L+GK +R+  SKH S+ +P+ E Q    L KDY +S LHRFK+  S+  QNI+PP   LHL+ +P S  E+++K+LF  +  + K        RKMAL+Q+ +++ A+ ALI+LH+ D+G +  LRVSFSK  I
Sbjct:   57 SRVIHVRKLPSDVTEGEVISLGLPFGKVTNLLMLKGKNQAFIEMNTEEAANTMVNYYTSVAPVLRGQPIYIQFSNHKELK-TDSSPNQARAQAALQAVNSVQSGNLALAASAAAVDAGMAMAGQSPVLRIIVENLFYPVTLDVLH--QIFSKFGTVLKIITFTKNNQFQALLQYADPVSAQHAKLSLDGQNIYNACCTLRIDFSKLTSLNVKYNNDKSRDYT----RPD----LPSGDSQPSLDQTMAAAFGAPGIMSASPYAGA----------------------GFPPTFAIPQAAGLSVPNV--------HGALAPLAIPSAAAAAAASRIAIPGLAGAGNS--VLLVSNLNPERVTPQSLFILFGVYGDVQRVKILFNKKENALVQMADGSQAQLAMSHLNGHKLHGKSVRITLSKHQSVQLPR-EGQEDQGLTKDYGSSPLHRFKKPGSKNFQNIFPPSATLHLSNIPPSVSEDDLKSLFSSNGGVVKGFKFFQKDRKMALIQMGSVEEAVQALIELHNHDLGENHHLRVSFSKSTI 555          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Mouse
Match: Ptbp1 (polypyrimidine tract binding protein 1 [Source:MGI Symbol;Acc:MGI:97791])

HSP 1 Score: 193.356 bits (490), Expect = 2.235e-54
Identity = 98/200 (49.00%), Postives = 138/200 (69.00%), Query Frame = 1
Query: 1168 GNANSVVIVANLNEDRISPDALFILFGVYGDVQRVKILYNKKNTALIQFVDGEHAARAVTNLNNVNLYGKPMRVNFSKHTSISMPKPEEQNSVHLNKDYSNSRLHRFKRATSRTVQNIYPPGTVLHLAGLPESYEEEEIKNLF-DDYAITKVKMINPNQRKMALVQLETIDMAIDALIKLHDCDVGLS-KLRVSFSKGFI 1761
            G  NSV++V+NLN +R++P +LFILFGVYGDVQRVKIL+NKK  AL+Q  DG  A  A+++LN   L+GK +R+  SKH S+ +P+ E Q    L KDY +S LHRFK+  S+  QNI+PP   LHL+ +P S  E+++K+LF  +  + K        RKMAL+Q+ +++ A+ ALI+LH+ D+G +  LRVSFSK  I
Sbjct:  291 GAGNSVLLVSNLNPERVTPQSLFILFGVYGDVQRVKILFNKKENALVQMADGSQAQLAMSHLNGHKLHGKSVRITLSKHQSVQLPR-EGQEDQGLTKDYGSSPLHRFKKPGSKNFQNIFPPSATLHLSNIPPSVSEDDLKSLFSSNGGVVKGFKFFQKDRKMALIQMGSVEEAVQALIELHNHDLGENHHLRVSFSKSTI 489          

HSP 2 Score: 97.0561 bits (240), Expect = 7.936e-21
Identity = 70/226 (30.97%), Postives = 114/226 (50.44%), Query Frame = 1
Query:  253 ANLAIPFGLISYLVLTRKTGQALMEMHHEESAQAMVDYYSKCLPHFYGKNIVIQFSRYETLSGSGMHPEAET---------AVKGAN--------EDVRKLCEGEPKLVLHVTIEN-WEGSRLGHLHFYKLFQRYGTICRIIVFVQNQSPQALIEFENEVAAHVAKLQLGGSNAFYG-RPVRIEFSTRKSLDIKHESDTGRDYTISPVRKDELNSIPSFNSSYGMD 873
            A+  +PFG ++ L++ +   QA +EM+ EE+A  MV+YY+   P   G+ I IQFS ++ L  +   P             +V+  N             +       VL + +EN +    L  LH  ++F ++GT+ +II F +N   QAL+++ + V+A  AKL L G N +     +RI+FS   SL++K+ +D  RDYT    R D    +PS +S   +D
Sbjct:   35 ASAGLPFGKVTNLLMLKGKNQAFIEMNTEEAANTMVNYYTSVAPVLRGQPIYIQFSNHKELK-TDSSPNQARAQAALQAVNSVQSGNLALAASAAAVDAGMAMAGQSPVLRIIVENLFYPVTLDVLH--QIFSKFGTVLKIITFTKNNQFQALLQYADPVSAQHAKLSLDGQNIYNACCTLRIDFSKLTSLNVKYNNDKSRDYT----RPD----LPSGDSQPSLD 249          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Mouse
Match: Ptbp1 (polypyrimidine tract binding protein 1 [Source:MGI Symbol;Acc:MGI:97791])

HSP 1 Score: 193.356 bits (490), Expect = 5.204e-54
Identity = 98/200 (49.00%), Postives = 138/200 (69.00%), Query Frame = 1
Query: 1168 GNANSVVIVANLNEDRISPDALFILFGVYGDVQRVKILYNKKNTALIQFVDGEHAARAVTNLNNVNLYGKPMRVNFSKHTSISMPKPEEQNSVHLNKDYSNSRLHRFKRATSRTVQNIYPPGTVLHLAGLPESYEEEEIKNLF-DDYAITKVKMINPNQRKMALVQLETIDMAIDALIKLHDCDVGLS-KLRVSFSKGFI 1761
            G  NSV++V+NLN +R++P +LFILFGVYGDVQRVKIL+NKK  AL+Q  DG  A  A+++LN   L+GK +R+  SKH S+ +P+ E Q    L KDY +S LHRFK+  S+  QNI+PP   LHL+ +P S  E+++K+LF  +  + K        RKMAL+Q+ +++ A+ ALI+LH+ D+G +  LRVSFSK  I
Sbjct:  331 GAGNSVLLVSNLNPERVTPQSLFILFGVYGDVQRVKILFNKKENALVQMADGSQAQLAMSHLNGHKLHGKSVRITLSKHQSVQLPR-EGQEDQGLTKDYGSSPLHRFKKPGSKNFQNIFPPSATLHLSNIPPSVSEDDLKSLFSSNGGVVKGFKFFQKDRKMALIQMGSVEEAVQALIELHNHDLGENHHLRVSFSKSTI 529          

HSP 2 Score: 120.168 bits (300), Expect = 2.952e-28
Identity = 80/244 (32.79%), Postives = 129/244 (52.87%), Query Frame = 1
Query:  199 SRVLHIRNVSSDVTERDIANLAIPFGLISYLVLTRKTGQALMEMHHEESAQAMVDYYSKCLPHFYGKNIVIQFSRYETLSGSGMHPEAET---------AVKGAN--------EDVRKLCEGEPKLVLHVTIEN-WEGSRLGHLHFYKLFQRYGTICRIIVFVQNQSPQALIEFENEVAAHVAKLQLGGSNAFYG-RPVRIEFSTRKSLDIKHESDTGRDYTISPVRKDELNSIPSFNSSYGMD 873
            SRV+H+R + SDVTE ++ +L +PFG ++ L++ +   QA +EM+ EE+A  MV+YY+   P   G+ I IQFS ++ L  +   P             +V+  N             +       VL + +EN +    L  LH  ++F ++GT+ +II F +N   QAL+++ + V+A  AKL L G N +     +RI+FS   SL++K+ +D  RDYT    R D    +PS +S   +D
Sbjct:   57 SRVIHVRKLPSDVTEGEVISLGLPFGKVTNLLMLKGKNQAFIEMNTEEAANTMVNYYTSVAPVLRGQPIYIQFSNHKELK-TDSSPNQARAQAALQAVNSVQSGNLALAASAAAVDAGMAMAGQSPVLRIIVENLFYPVTLDVLH--QIFSKFGTVLKIITFTKNNQFQALLQYADPVSAQHAKLSLDGQNIYNACCTLRIDFSKLTSLNVKYNNDKSRDYT----RPD----LPSGDSQPSLD 289          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Mouse
Match: Ptbp2 (polypyrimidine tract binding protein 2 [Source:MGI Symbol;Acc:MGI:1860489])

HSP 1 Score: 187.963 bits (476), Expect = 5.260e-52
Identity = 99/199 (49.75%), Postives = 137/199 (68.84%), Query Frame = 1
Query: 1174 ANSVVIVANLNEDRISPDALFILFGVYGDVQRVKILYNKKNTALIQFVDGEHAARAVTNLNNVNLYGKPMRVNFSKHTSISMPKPEEQNSVHLNKDYSNSRLHRFKRATSRTVQNIYPPGTVLHLAGLPESYEEEEIKNLFDDYAITKVKMINPNQR--KMALVQLETIDMAIDALIKLHDCDVGLS-KLRVSFSKGFI 1761
             N+V++V+NLNE+ ++P +LF LFGVYGDVQRVKILYNKK++ALIQ  DG  +  A+ +LN   +YGK +RV  SKH ++ +P+ E  +   L KD+ NS LHRFK+  S+  QNI+PP   LHL+ +P S  EE+++ LF +   T VK     QR  KMAL+Q+ T++ AI ALI LH+ ++G +  LRVSFSK  I
Sbjct:  336 GNTVLLVSNLNEEMVTPQSLFTLFGVYGDVQRVKILYNKKDSALIQMADGNQSQLAMNHLNGQKMYGKIIRVTLSKHQTVQLPR-EGLDDQGLTKDFGNSPLHRFKKPGSKNFQNIFPPSATLHLSNIPPSVAEEDLRTLFANTGGT-VKAFKFFQRDHKMALLQMATVEEAIQALIDLHNYNLGENHHLRVSFSKSTI 532          

HSP 2 Score: 120.939 bits (302), Expect = 1.368e-28
Identity = 74/218 (33.94%), Postives = 121/218 (55.50%), Query Frame = 1
Query:  199 SRVLHIRNVSSDVTERDIANLAIPFGLISYLVLTRKTGQALMEMHHEESAQAMVDYYSKCLPHFYGKNIVIQFSRYETLSG-------SGMHPEAETAVKGANEDVRKLCEGEPKL------VLHVTIEN-WEGSRLGHLHFYKLFQRYGTICRIIVFVQNQSPQALIEFENEVAAHVAKLQLGGSNAFYG-RPVRIEFSTRKSLDIKHESDTGRDYT 807
            SRVLHIR +  +VTE ++  L +PFG ++ +++ +   QA +E+  EE+A  MV+YYS   PH   + I IQ+S ++ L         + +  +A TAV+ AN  +      E  +      VL + I+N +    L  LH  ++F ++G + +II F +N   QAL+++ + V A  AKL L G N +     +RI+FS   +L++K+ +D  RDYT
Sbjct:   58 SRVLHIRKLPGEVTETEVIALGLPFGKVTNILMLKGKNQAFLELATEEAAITMVNYYSAVTPHLRNQPIYIQYSNHKELKTDNTLNQRAQVVLQAVTAVQTANTPLSGTTVSESAVTPAQSPVLRIIIDNMYYPVTLDVLH--QIFSKFGAVLKIITFTKNNQFQALLQYGDPVNAQQAKLALDGQNIYNACCTLRIDFSKLVNLNVKYNNDKSRDYT 273          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Mouse
Match: Ptbp3 (polypyrimidine tract binding protein 3 [Source:MGI Symbol;Acc:MGI:1923334])

HSP 1 Score: 185.652 bits (470), Expect = 8.686e-52
Identity = 97/198 (48.99%), Postives = 130/198 (65.66%), Query Frame = 1
Query: 1174 ANSVVIVANLNEDRISPDALFILFGVYGDVQRVKILYNKKNTALIQFVDGEHAARAVTNLNNVNLYGKPMRVNFSKHTSISMPKPEEQNSVHLNKDYSNSRLHRFKRATSRTVQNIYPPGTVLHLAGLPESYEEEEIKNLFDDYAIT-KVKMINPNQRKMALVQLETIDMAIDALIKLHDCDVGLS-KLRVSFSKGFI 1761
             NSV++V NLN D I+P  LFILFGVYGDV RVKI++NKK  AL+Q  D   A  A+ +L+   LYGK +R   SKH ++ +P+ E Q    L KD+SNS LHRFK+  S+  QNI+PP   LHL+ +P S   +++KNLF +   + K        RKMAL+QL +++ AI ALI+LH+ D+G +  LRVSFSK  I
Sbjct:  261 GNSVLLVTNLNPDFITPHGLFILFGVYGDVHRVKIMFNKKENALVQMADASQAQLAMNHLSGQRLYGKVLRATLSKHQAVQLPR-EGQEDQGLTKDFSNSPLHRFKKPGSKNFQNIFPPSATLHLSNIPPSVTMDDLKNLFTEAGCSVKAFKFFQKDRKMALIQLGSVEEAIQALIELHNHDLGENHHLRVSFSKSTI 457          

HSP 2 Score: 85.5001 bits (210), Expect = 3.866e-17
Identity = 55/181 (30.39%), Postives = 91/181 (50.28%), Query Frame = 1
Query:  316 ALMEMHHEESAQAMVDYYSKCLPHFYGKNIVIQFSRYETLSGSGMH---------------PEAETAVKGANEDVRKLCEGEPKLVLHVTIEN-WEGSRLGHLHFYKLFQRYGTICRIIVFVQNQSPQALIEFENEVAAHVAKLQLGGSNAFYG-RPVRIEFSTRKSLDIKHESDTGRDYT 807
            A +EM  EE+A  M++YY+   PH   + + IQ+S +  L    +                     ++ GA  +   L  G+   VL + IEN +    L  LH  ++F ++GT+ +II F +N   QAL+++ + V A  AK+ L G N +     +RI+FS   SL++K+ +D  RD+T
Sbjct:    2 AFLEMASEEAAVTMINYYTPVTPHLRSQPVYIQYSNHRELKTDNLPNQARAQAALQAVSAVQSGNLSLPGATANEGTLLPGQSP-VLRIIIENLFYPVTLEVLH--QIFSKFGTVLKIITFTKNNQFQALLQYADPVNAQYAKMALDGQNIYNACCTLRIDFSKLTSLNVKYNNDKSRDFT 179          
BLAST of Polypyrimidine tract-binding protein 1 vs. UniProt/SwissProt
Match: sp|Q8WN55|PTBP1_BOVIN (Polypyrimidine tract-binding protein 1 OS=Bos taurus OX=9913 GN=PTBP1 PE=2 SV=1)

HSP 1 Score: 197.208 bits (500), Expect = 1.537e-54
Identity = 101/200 (50.50%), Postives = 137/200 (68.50%), Query Frame = 1
Query: 1168 GNANSVVIVANLNEDRISPDALFILFGVYGDVQRVKILYNKKNTALIQFVDGEHAARAVTNLNNVNLYGKPMRVNFSKHTSISMPKPEEQNSVHLNKDYSNSRLHRFKRATSRTVQNIYPPGTVLHLAGLPESYEEEEIKNLF-DDYAITKVKMINPNQRKMALVQLETIDMAIDALIKLHDCDVGLS-KLRVSFSKGFI 1761
            G  NSV++V+NLN +R++P +LFILFGVYGDVQRVK+L+NKK  AL+Q  DG  A  A+++LN   L+GKP+R+  SKH S+ +P+ E Q    L KDY NS LHRFK+  S+  QNI+PP   LHL+ +P S  E+++K LF  +  I K        RKMAL+Q+ +++ AI ALI LH+ D+G +  LRVSFSK  I
Sbjct:  333 GAGNSVLLVSNLNPERVTPQSLFILFGVYGDVQRVKVLFNKKENALVQMADGSQAQLAMSHLNGHKLHGKPVRITLSKHQSVQLPR-EGQEDQGLTKDYGNSPLHRFKKPGSKNFQNIFPPSATLHLSNIPPSISEDDLKILFSSNGGIVKGFKFFQKDRKMALIQMGSVEEAIQALIDLHNHDLGENHHLRVSFSKSTI 531          

HSP 2 Score: 121.709 bits (304), Expect = 6.038e-28
Identity = 81/244 (33.20%), Postives = 128/244 (52.46%), Query Frame = 1
Query:  199 SRVLHIRNVSSDVTERDIANLAIPFGLISYLVLTRKTGQALMEMHHEESAQAMVDYYSKCLPHFYGKNIVIQFSRYETLSGSGMHPEAET---------AVKGAN--------EDVRKLCEGEPKLVLHVTIEN-WEGSRLGHLHFYKLFQRYGTICRIIVFVQNQSPQALIEFENEVAAHVAKLQLGGSNAFYG-RPVRIEFSTRKSLDIKHESDTGRDYTISPVRKDELNSIPSFNSSYGMD 873
            SRV+HIR +  DVTE ++ +L +PFG ++ L++ +   QA +EMH EE+A  MV+YY+   P   G+ I IQFS ++ L  +   P             +V+  N             +       VL + +EN +    L  LH  ++F ++GT+ +II F +N   QAL+++ + V+A  AKL L G N +     +RI+FS   SL++K+ +D  RDYT    R D    +PS +S   +D
Sbjct:   58 SRVIHIRKLPGDVTEGEVISLGLPFGKVTNLLMLKGKNQAFIEMHTEEAANTMVNYYTSVTPVLRGQPIYIQFSNHKELK-TDSSPNQARAQAALQAVNSVQSGNLALAASAAAVDAGMAMAGQSPVLRIIVENLFYPVTLDVLH--QIFSKFGTVLKIITFTKNNQFQALLQYADPVSAQHAKLSLDGQNIYNACCTLRIDFSKLTSLNVKYNNDKSRDYT----RPD----LPSGDSQPSLD 290          
BLAST of Polypyrimidine tract-binding protein 1 vs. UniProt/SwissProt
Match: sp|P26599|PTBP1_HUMAN (Polypyrimidine tract-binding protein 1 OS=Homo sapiens OX=9606 GN=PTBP1 PE=1 SV=1)

HSP 1 Score: 196.438 bits (498), Expect = 3.040e-54
Identity = 100/200 (50.00%), Postives = 137/200 (68.50%), Query Frame = 1
Query: 1168 GNANSVVIVANLNEDRISPDALFILFGVYGDVQRVKILYNKKNTALIQFVDGEHAARAVTNLNNVNLYGKPMRVNFSKHTSISMPKPEEQNSVHLNKDYSNSRLHRFKRATSRTVQNIYPPGTVLHLAGLPESYEEEEIKNLF-DDYAITKVKMINPNQRKMALVQLETIDMAIDALIKLHDCDVGLS-KLRVSFSKGFI 1761
            G  NSV++V+NLN +R++P +LFILFGVYGDVQRVKIL+NKK  AL+Q  DG  A  A+++LN   L+GKP+R+  SKH ++ +P+ E Q    L KDY NS LHRFK+  S+  QNI+PP   LHL+ +P S  EE++K LF  +  + K        RKMAL+Q+ +++ A+ ALI LH+ D+G +  LRVSFSK  I
Sbjct:  333 GAGNSVLLVSNLNPERVTPQSLFILFGVYGDVQRVKILFNKKENALVQMADGNQAQLAMSHLNGHKLHGKPIRITLSKHQNVQLPR-EGQEDQGLTKDYGNSPLHRFKKPGSKNFQNIFPPSATLHLSNIPPSVSEEDLKVLFSSNGGVVKGFKFFQKDRKMALIQMGSVEEAVQALIDLHNHDLGENHHLRVSFSKSTI 531          

HSP 2 Score: 118.242 bits (295), Expect = 7.262e-27
Identity = 80/244 (32.79%), Postives = 128/244 (52.46%), Query Frame = 1
Query:  199 SRVLHIRNVSSDVTERDIANLAIPFGLISYLVLTRKTGQALMEMHHEESAQAMVDYYSKCLPHFYGKNIVIQFSRYETLSGSGMHPEAET---------AVKGAN--------EDVRKLCEGEPKLVLHVTIEN-WEGSRLGHLHFYKLFQRYGTICRIIVFVQNQSPQALIEFENEVAAHVAKLQLGGSNAFYG-RPVRIEFSTRKSLDIKHESDTGRDYTISPVRKDELNSIPSFNSSYGMD 873
            SRV+HIR +  DVTE ++ +L +PFG ++ L++ +   QA +EM+ EE+A  MV+YY+   P   G+ I IQFS ++ L  +   P             +V+  N             +       VL + +EN +    L  LH  ++F ++GT+ +II F +N   QAL+++ + V+A  AKL L G N +     +RI+FS   SL++K+ +D  RDYT    R D    +PS +S   +D
Sbjct:   58 SRVIHIRKLPIDVTEGEVISLGLPFGKVTNLLMLKGKNQAFIEMNTEEAANTMVNYYTSVTPVLRGQPIYIQFSNHKELK-TDSSPNQARAQAALQAVNSVQSGNLALAASAAAVDAGMAMAGQSPVLRIIVENLFYPVTLDVLH--QIFSKFGTVLKIITFTKNNQFQALLQYADPVSAQHAKLSLDGQNIYNACCTLRIDFSKLTSLNVKYNNDKSRDYT----RPD----LPSGDSQPSLD 290          
BLAST of Polypyrimidine tract-binding protein 1 vs. UniProt/SwissProt
Match: sp|Q29099|PTBP1_PIG (Polypyrimidine tract-binding protein 1 OS=Sus scrofa OX=9823 GN=PTBP1 PE=2 SV=1)

HSP 1 Score: 194.512 bits (493), Expect = 2.471e-53
Identity = 101/200 (50.50%), Postives = 136/200 (68.00%), Query Frame = 1
Query: 1168 GNANSVVIVANLNEDRISPDALFILFGVYGDVQRVKILYNKKNTALIQFVDGEHAARAVTNLNNVNLYGKPMRVNFSKHTSISMPKPEEQNSVHLNKDYSNSRLHRFKRATSRTVQNIYPPGTVLHLAGLPESYEEEEIKNLF-DDYAITKVKMINPNQRKMALVQLETIDMAIDALIKLHDCDVGLS-KLRVSFSKGFI 1761
            G  NSV++V+NLN +R++P +LFILFGVY DVQRVKIL+NKK  AL+Q  DG  A  A+++LN   L+GKP+R+  SKH ++ +P+ E Q    L KDY NS LHRFK+  S+  QNI+PP   LHL+ +P S  EE++K LF  +  I K        RKMAL+Q+ +++ AI ALI LH+ D+G +  LRVSFSK  I
Sbjct:  359 GAGNSVLLVSNLNPERVTPQSLFILFGVYCDVQRVKILFNKKENALVQMADGSQAQLAMSHLNGHKLHGKPVRITLSKHQNVQLPR-EGQEDQGLTKDYGNSPLHRFKKPGSKNFQNIFPPSATLHLSNIPPSISEEDLKILFSSNGGIVKGFKFFQKDRKMALIQMGSVEEAIQALIDLHNHDLGENHHLRVSFSKSTI 557          

HSP 2 Score: 120.168 bits (300), Expect = 2.016e-27
Identity = 75/222 (33.78%), Postives = 120/222 (54.05%), Query Frame = 1
Query:  199 SRVLHIRNVSSDVTERDIANLAIPFGLISYLVLTRKTGQALMEMHHEESAQAMVDYYSKCLPHFYGKNIVIQFSRYETLSGSGMHPEAET---------AVKGAN--------EDVRKLCEGEPKLVLHVTIEN-WEGSRLGHLHFYKLFQRYGTICRIIVFVQNQSPQALIEFENEVAAHVAKLQLGGSNAFYG-RPVRIEFSTRKSLDIKHESDTGRDYT 807
            SRV+HIR + SDVTE ++ +L +PFG ++ L++ +   QA +EM+ EE+A  MV+YY+   P   G+ I IQFS ++ L  +   P             +V+  N             +       VL + +EN +    L  LH  ++F ++GT+ +II F +N   QAL+++ + V+A  AKL L G N +     +RI+FS   SL++K+ +D  RDYT
Sbjct:   58 SRVIHIRKLPSDVTEGEVISLGLPFGKVTNLLMLKGKNQAFIEMNTEEAANTMVNYYTSVTPVLRGQPIYIQFSNHKELK-TDSSPNQARAQAALQAVNSVQSGNLALAASAAAVDAGMAMAGQSPVLRIIVENLFYPVTLDVLH--QIFSKFGTVLKIITFTKNNQFQALLQYADPVSAQHAKLSLDGQNIYNACCTLRIDFSKLTSLNVKYNNDKSRDYT 276          
BLAST of Polypyrimidine tract-binding protein 1 vs. UniProt/SwissProt
Match: sp|Q00438|PTBP1_RAT (Polypyrimidine tract-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Ptbp1 PE=1 SV=1)

HSP 1 Score: 192.2 bits (487), Expect = 1.372e-52
Identity = 97/200 (48.50%), Postives = 138/200 (69.00%), Query Frame = 1
Query: 1168 GNANSVVIVANLNEDRISPDALFILFGVYGDVQRVKILYNKKNTALIQFVDGEHAARAVTNLNNVNLYGKPMRVNFSKHTSISMPKPEEQNSVHLNKDYSNSRLHRFKRATSRTVQNIYPPGTVLHLAGLPESYEEEEIKNLF-DDYAITKVKMINPNQRKMALVQLETIDMAIDALIKLHDCDVGLS-KLRVSFSKGFI 1761
            G  NSV++V+NLN +R++P +LFILFGVYGDVQRVKIL+NKK  AL++  DG  A  A+++LN   L+GK +R+  SKH S+ +P+ E Q    L KDY +S LHRFK+  S+  QNI+PP   LHL+ +P S  E+++K+LF  +  + K        RKMAL+Q+ +++ A+ ALI+LH+ D+G +  LRVSFSK  I
Sbjct:  357 GAGNSVLLVSNLNPERVTPQSLFILFGVYGDVQRVKILFNKKENALVEMADGSQAQLAMSHLNGHKLHGKSVRITLSKHQSVQLPR-EGQEDQGLTKDYGSSPLHRFKKPGSKNFQNIFPPSATLHLSNIPPSVSEDDLKSLFSSNGGVVKGFKFFQKDRKMALIQMGSVEEAVQALIELHNHDLGENHHLRVSFSKSTI 555          

HSP 2 Score: 119.398 bits (298), Expect = 4.703e-27
Identity = 80/244 (32.79%), Postives = 128/244 (52.46%), Query Frame = 1
Query:  199 SRVLHIRNVSSDVTERDIANLAIPFGLISYLVLTRKTGQALMEMHHEESAQAMVDYYSKCLPHFYGKNIVIQFSRYETLSGSGMHPEAET---------AVKGAN--------EDVRKLCEGEPKLVLHVTIEN-WEGSRLGHLHFYKLFQRYGTICRIIVFVQNQSPQALIEFENEVAAHVAKLQLGGSNAFYG-RPVRIEFSTRKSLDIKHESDTGRDYTISPVRKDELNSIPSFNSSYGMD 873
            SRV+H+R + SDVTE ++ +L +PFG ++ L++ +   QA +EM  EE+A  MV+YY+   P   G+ I IQFS ++ L  +   P             +V+  N             +       VL + +EN +    L  LH  ++F ++GT+ +II F +N   QAL+++ + V+A  AKL L G N +     +RI+FS   SL++K+ +D  RDYT    R D    +PS +S   +D
Sbjct:   57 SRVIHVRKLPSDVTEGEVISLGLPFGKVTNLLMLKGKNQAFIEMSTEEAANTMVNYYTSVAPVLRGQPIYIQFSNHKELK-TDSSPNQARAQAALQAVNSVQSGNLALAASAAAVDAGMAMAGQSPVLRIIVENLFYPVTLDVLH--QIFSKFGTVLKIITFTKNNQFQALLQYADPVSAQHAKLSLDGQNIYNACCTLRIDFSKLTSLNVKYNNDKSRDYT----RPD----LPSGDSQPSLD 289          
BLAST of Polypyrimidine tract-binding protein 1 vs. UniProt/SwissProt
Match: sp|Q9UKA9|PTBP2_HUMAN (Polypyrimidine tract-binding protein 2 OS=Homo sapiens OX=9606 GN=PTBP2 PE=1 SV=1)

HSP 1 Score: 186.037 bits (471), Expect = 1.516e-50
Identity = 95/197 (48.22%), Postives = 133/197 (67.51%), Query Frame = 1
Query: 1174 ANSVVIVANLNEDRISPDALFILFGVYGDVQRVKILYNKKNTALIQFVDGEHAARAVTNLNNVNLYGKPMRVNFSKHTSISMPKPEEQNSVHLNKDYSNSRLHRFKRATSRTVQNIYPPGTVLHLAGLPESYEEEEIKNLFDDYAITKVKMINPNQRKMALVQLETIDMAIDALIKLHDCDVGLS-KLRVSFSKGFI 1761
             N+V++V+NLNE+ ++P +LF LFGVYGDVQRVKILYNKK++ALIQ  DG  +  A+ +LN   +YGK +RV  SKH ++ +P+ E  +   L KD+ NS LHRFK+  S+  QNI+PP   LHL+ +P S  EE+++ LF +   T          KMAL+Q+ T++ AI ALI LH+ ++G +  LRVSFSK  I
Sbjct:  336 GNTVLLVSNLNEEMVTPQSLFTLFGVYGDVQRVKILYNKKDSALIQMADGNQSQLAMNHLNGQKMYGKIIRVTLSKHQTVQLPR-EGLDDQGLTKDFGNSPLHRFKKPGSKNFQNIFPPSATLHLSNIPPSVAEEDLRTLFANTGGTVKAFKFFQDHKMALLQMATVEEAIQALIDLHNYNLGENHHLRVSFSKSTI 531          

HSP 2 Score: 120.168 bits (300), Expect = 1.793e-27
Identity = 74/218 (33.94%), Postives = 120/218 (55.05%), Query Frame = 1
Query:  199 SRVLHIRNVSSDVTERDIANLAIPFGLISYLVLTRKTGQALMEMHHEESAQAMVDYYSKCLPHFYGKNIVIQFSRYETLSG-------SGMHPEAETAVKGANEDVRKLCEGEPKL------VLHVTIEN-WEGSRLGHLHFYKLFQRYGTICRIIVFVQNQSPQALIEFENEVAAHVAKLQLGGSNAFYG-RPVRIEFSTRKSLDIKHESDTGRDYT 807
            SRVLHIR +  +VTE ++  L +PFG ++ +++ +   QA +E+  EE+A  MV+YYS   PH   + I IQ+S ++ L         +    +A TAV+ AN  +      E  +      VL + I+N +    L  LH  ++F ++G + +II F +N   QAL+++ + V A  AKL L G N +     +RI+FS   +L++K+ +D  RDYT
Sbjct:   58 SRVLHIRKLPGEVTETEVIALGLPFGKVTNILMLKGKNQAFLELATEEAAITMVNYYSAVTPHLRNQPIYIQYSNHKELKTDNTLNQRAQAVLQAVTAVQTANTPLSGTTVSESAVTPAQSPVLRIIIDNMYYPVTLDVLH--QIFSKFGAVLKIITFTKNNQFQALLQYGDPVNAQQAKLALDGQNIYNACCTLRIDFSKLVNLNVKYNNDKSRDYT 273          
BLAST of Polypyrimidine tract-binding protein 1 vs. TrEMBL
Match: A0A3Q0KMW9 (Polypyrimidine tract binding protein, putative OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 351.288 bits (900), Expect = 1.056e-109
Identity = 217/572 (37.94%), Postives = 320/572 (55.94%), Query Frame = 1
Query:  175 KRVCVDKI----SRVLHIRNVSSDVTERDIANLAIPFGLISYLVLTRKTGQALMEMHHEESAQAMVDYYSKCLPHFYGKNIVIQFSRYETLSGSGMHPEAETAVKGAN----EDVRKLCEGEPKLVLHVTIENWEGSRLGHLHFYKLFQRYGTICRIIVFVQNQSPQALIEFENEVAAHVAKLQLGGSNAFYGR-PVRIEF-STRKSLDIKHESDTGRDYTISPVRKDELNS----------------------------IPSFNSSYGMDDHGNANYSQHHDYPVSRQGGSMNNGQMTXXXXXXXXXXXXXXXSNNPNDTLPMLQSLAPTLTSLLNQSQMGSMNSRESSRMNYSN--ENLNNTSSSRKSQGNANSVVIVANLNEDRISPDALFILFGVYGDVQRVKILYNKKNTALIQFVDGEHAARAVTNLNNVNLYGKPMRVNFSKHTSISMPKPEEQNSVHLNKDYSNSRLHRFKRATSRTVQNIYPPGTVLHLAGLPESYEEEEIKNLFDD--YAITKVKMINPNQRKMALVQLETIDMAIDALIKLHDCDVGL-SKLRVSFSKGFI 1761
            K+  VD++    SRV+HIRN+  D TE +IA  AIPFGL+  +VL+++  QAL+EMH  E A  +V +Y K     +GK+++ QFS +  L     +     A+K AN    +D+     G P  VLHV I+N  G ++ H+  YK+F R+GTI R+++F++N   + L+EF+N + A VA L L G N + G   +++EF   R  L+++ E+D  RDYTISP+  DELNS                            IP  N +        A  S  +D  +     +  +G      A A     +   +   N       ++ PT  ++LN + +    +   +  N +    NL N S S   Q  A++V+IV+NLNE+++ PDALF LFGVYGDV RVKI++NKK+TAL+QF D + A  A+ +LN   LYGKP+++  S+   + +PK  E N V L KDY+NS LHRF++  S+   NIY P  VLHL+ +P +  EEE++ +F+   Y +T  K +  + +KMAL+QLE +DMAI ALI LH+C +   S LR+SFSK  I
Sbjct:   41 KKSRVDRLEASPSRVIHIRNMPGDATENEIALFAIPFGLLKNMVLSKRNNQALIEMHVLEEAVQLVAHYLKYPVTLHGKHLIFQFSTHSHLELISENDAIVNAIKNANRVVQQDLPGAQTGVPNTVLHVVIDNIMGQQINHVILYKIFHRFGTILRVLIFLRNNQYRCLLEFQNHIQAFVAMLLLNGQNIYTGCCSLQVEFWKARGPLEVRRENDKCRDYTISPLTDDELNSLQALPGGVTASTNNSTINSISQPSIGQNIPLGNPTAAFTAVPQAAASGINDLAIQLTLLAQQSGLALTPAAAAATASFMALTAQGGNS------AINPTPGTVLNAASLQGPRAALPTVQNQTQLLPNLINQSVSNLGQTGASTVLIVSNLNEEKVYPDALFTLFGVYGDVTRVKIMFNKKSTALVQFSDPQQALTALYHLNGQPLYGKPLKIAVSRFNIVQLPK--EDNDVGLTKDYTNSPLHRFRKPNSKNFTNIYAPNHVLHLSNIPSAITEEEVRMIFETKGYHVTDFKFMMKD-KKMALIQLENVDMAIQALIDLHNCQLTENSHLRISFSKTAI 603          
BLAST of Polypyrimidine tract-binding protein 1 vs. TrEMBL
Match: A0A183QYD0 (Uncharacterized protein OS=Schistosoma rodhaini OX=6188 PE=4 SV=1)

HSP 1 Score: 345.125 bits (884), Expect = 1.612e-107
Identity = 215/572 (37.59%), Postives = 316/572 (55.24%), Query Frame = 1
Query:  175 KRVCVDKI----SRVLHIRNVSSDVTERDIANLAIPFGLISYLVLTRKTGQALMEMHHEESAQAMVDYYSKCLPHFYGKNIVIQFSRYETLSGSGMHPEAETAVKGAN----EDVRKLCEGEPKLVLHVTIENWEGSRLGHLHFYKLFQRYGTICRIIVFVQNQSPQALIEFENEVAAHVAKLQLGGSNAFYGR-PVRIEF-STRKSLDIKHESDTGRDYTISPVRKDELNS----------------------------IPSFNSSYGMDDHGNANYSQHHDYPVSRQGGSMNNGQMTXXXXXXXXXXXXXXXSNNPNDTLPMLQSLAPTLTSLLNQSQMGSMNSRESSRMNYSN--ENLNNTSSSRKSQGNANSVVIVANLNEDRISPDALFILFGVYGDVQRVKILYNKKNTALIQFVDGEHAARAVTNLNNVNLYGKPMRVNFSKHTSISMPKPEEQNSVHLNKDYSNSRLHRFKRATSRTVQNIYPPGTVLHLAGLPESYEEEEIKNLFDD--YAITKVKMINPNQRKMALVQLETIDMAIDALIKLHDCDVGL-SKLRVSFSKGFI 1761
            K+  VD++    SRV+HIRN+  D TE +IA  AIPFGL+  +VL+++  QAL+EMH  E A  +V +Y K     +GK+++ QFS +  L     +     A+K AN    +D+     G P  VLHV I+N  G ++ H+  YK+F R+GTI R+++F++N   + L+EF+N + A VA L L G N + G   +++EF   R  L+++ E+D  RDYTISP+  DELNS                            IP  N +        A  S  +D  +     +  +G      A A     +   +   N       ++ PT  ++LN + +    +   +  N +    NL N S S   Q  A++V+IV+NLNE+++ PDALF LFGVYGDV RVKI++NKK+TAL+QF D + A  A+ +LN   LYGKP+++            P+E N V L KDY+NS LHRF++  S+   NIY P  VLHL+ +P +  EEE++ +F+   Y +T  K +  + +KMAL+QLE +DMAI ALI LH+C +   S LR+SFSK  I
Sbjct:   41 KKSRVDRLEASPSRVIHIRNMPGDATENEIALFAIPFGLLKNMVLSKRNNQALIEMHVLEEAVQLVAHYLKYPVTLHGKHLIFQFSTHSHLELISENDAIVNAIKNANRVVQQDLPGAQTGVPNTVLHVVIDNIMGQQINHVILYKIFHRFGTILRVLIFLRNNQYRCLLEFQNHIQAFVAMLLLNGQNIYTGCCSLQVEFWKARGPLEVRRENDKCRDYTISPLTDDELNSLQALPGGVTASTNNSTINSISQPSIGQNIPLGNPTAAFTAVPQATASGINDLAIQLTLLAQQSGLALTPAAAAATASFMALTAQGGNS------AINPTPGTVLNAASLQGPRAALPTVQNQTQLLPNLINQSVSNLGQTGASTVLIVSNLNEEKVYPDALFTLFGVYGDVTRVKIMFNKKSTALVQFSDPQQALTALYHLNGQPLYGKPLKIAL----------PKEDNDVGLTKDYTNSPLHRFRKPNSKNFTNIYAPNHVLHLSNIPSAITEEEVRMIFETKGYHVTDFKFMMKD-KKMALIQLENVDMAIQALIDLHNCQLTENSHLRISFSKTAI 595          
BLAST of Polypyrimidine tract-binding protein 1 vs. TrEMBL
Match: A0A4Z2DXT8 (Polypyrimidine tract-binding protein isoform 2 OS=Schistosoma japonicum OX=6182 GN=EWB00_010035 PE=4 SV=1)

HSP 1 Score: 336.265 bits (861), Expect = 2.104e-104
Identity = 209/575 (36.35%), Postives = 320/575 (55.65%), Query Frame = 1
Query:  175 KRVCVDKI----SRVLHIRNVSSDVTERDIANLAIPFGLISYLVLTRKTGQALMEMHHEESAQAMVDYYSKCLPHFYGKNIVIQFSRYETLSGSGMHPEAETAVKGAN----EDVRKLCEGEPKLVLHVTIENWEGSRLGHLHFYKLFQRYGTICRIIVFVQNQSPQALIEFENEVAAHVAKLQLGGSNAFYGR-PVRIEF-STRKSLDIKHESDTGRDYTISPVRKDELNSIPSFNSSYGMDDHGNANYSQHHDYPVSRQGGSMNNGQMTXXXXXXXXXXXXXXXSNNPNDTLPMLQSLAP---------------TLTSLLNQSQMGSMNSRESSRMNYSN------------------ENLNNTSSSRKSQGNANSVVIVANLNEDRISPDALFILFGVYGDVQRVKILYNKKNTALIQFVDGEHAARAVTNLNNVNLYGKPMRVNFSKHTSISMPKPEEQNSVHLNKDYSNSRLHRFKRATSRTVQNIYPPGTVLHLAGLPESYEEEEIKNLFDD--YAITKVKMINPNQRKMALVQLETIDMAIDALIKLHDCDVGL-SKLRVSFSKGFI 1761
            K+  VD++    SRV+HIRN+ +D TE +IA  AIPFGL+  +VL+++  QAL+EMH  E +  +V +Y K     +GK+++ QFS +  L     +     A+K AN    +D+     G P  VLHV I+N  G ++ H+  YK+F R+G I R+++F++N   + L+EF++ + A VA L L G N + G   +++EF   R  L+++ E+D  RDYT+SP+ + ELNS+ +  S        + N S  +  P    G +++ G  T A             ++  ND    L  LA                +  +L  QS   ++N   ++ +N +                    N+ N S     Q   ++V+IV+NLNE+++ PDALF LFGVYGDV RVKI++NKK+TAL+QF D + A  A+  LN   LYG+P++++ S+   + +PK  E   V L KDY+NS LHRF++  S+   NIY P  VLHL+ +P    EEE++ +F+   Y +T  K +  + +KMAL+QLE +DMAI A+I LH+C +   S LR+SFSK  I
Sbjct:    9 KKSRVDRLEASPSRVIHIRNMPADATENEIALFAIPFGLLKNMVLSKRNNQALIEMHVLEESVQLVAHYLKYPVTLHGKHLIFQFSTHSHLELISENDAIVNAIKNANRVVQQDLPGAQTGVPNTVLHVVIDNIMGQQINHVILYKIFHRFGIILRVLIFLRNNQYRCLLEFQDHIQAFVAMLLLNGQNIYTGCCSLQVEFWKARGPLEVRRENDKCRDYTVSPLTEAELNSLQALPSGVS----ASTNNSTINTIPQPTIGQNISLGNPTTAFTAIPQAS-----ASGINDLAIQLTLLAQQSGLALTPAAAAATASFMALTAQSGNPAINQAPATILNAAALQSPRTALTTVQNPTQLLPNIINQSIPNMGQTATSTVLIVSNLNEEKVYPDALFTLFGVYGDVTRVKIMFNKKSTALVQFSDPQQALTALYYLNGQPLYGRPLKISVSRFNIVQLPK--EDTDVGLTKDYTNSPLHRFRKPNSKNFSNIYAPNHVLHLSNIPSDITEEEVRMIFETKGYHVTDFKFLLKD-KKMALIQLENVDMAIQAMIDLHNCQLTENSHLRISFSKTAI 571          
BLAST of Polypyrimidine tract-binding protein 1 vs. TrEMBL
Match: C1LLD5 (Polypyrimidine tract-binding protein 1 OS=Schistosoma japonicum OX=6182 PE=2 SV=1)

HSP 1 Score: 335.88 bits (860), Expect = 2.900e-104
Identity = 209/575 (36.35%), Postives = 320/575 (55.65%), Query Frame = 1
Query:  175 KRVCVDKI----SRVLHIRNVSSDVTERDIANLAIPFGLISYLVLTRKTGQALMEMHHEESAQAMVDYYSKCLPHFYGKNIVIQFSRYETLSGSGMHPEAETAVKGAN----EDVRKLCEGEPKLVLHVTIENWEGSRLGHLHFYKLFQRYGTICRIIVFVQNQSPQALIEFENEVAAHVAKLQLGGSNAFYGR-PVRIEF-STRKSLDIKHESDTGRDYTISPVRKDELNSIPSFNSSYGMDDHGNANYSQHHDYPVSRQGGSMNNGQMTXXXXXXXXXXXXXXXSNNPNDTLPMLQSLAP---------------TLTSLLNQSQMGSMNSRESSRMNYSN------------------ENLNNTSSSRKSQGNANSVVIVANLNEDRISPDALFILFGVYGDVQRVKILYNKKNTALIQFVDGEHAARAVTNLNNVNLYGKPMRVNFSKHTSISMPKPEEQNSVHLNKDYSNSRLHRFKRATSRTVQNIYPPGTVLHLAGLPESYEEEEIKNLFDD--YAITKVKMINPNQRKMALVQLETIDMAIDALIKLHDCDVGL-SKLRVSFSKGFI 1761
            K+  VD++    SRV+HIRN+ +D TE +IA  AIPFGL+  +VL+++  QAL+EMH  E +  +V +Y K     +GK+++ QFS +  L     +     A+K AN    +D+     G P  VLHV I+N  G ++ H+  YK+F R+G I R+++F++N   + L+EF++ + A VA L L G N + G   +++EF   R  L+++ E+D  RDYT+SP+ + ELNS+ +  S        + N S  +  P    G +++ G  T A             ++  ND    L  LA                +  +L  QS   ++N   ++ +N +                    N+ N S     Q   ++V+IV+NLNE+++ PDALF LFGVYGDV RVKI++NKK+TAL+QF D + A  A+  LN   LYG+P++++ S+   + +PK  E   V L KDY+NS LHRF++  S+   NIY P  VLHL+ +P    EEE++ +F+   Y +T  K +  + +KMAL+QLE +DMAI A+I LH+C +   S LR+SFSK  I
Sbjct:    9 KKSRVDRLEASPSRVIHIRNMPADATENEIALFAIPFGLLKNMVLSKRNNQALIEMHVLEESVQLVAHYLKYPVTLHGKHLIFQFSTHSHLELISENDAIVNAIKNANRVVQQDLPGAQTGVPNTVLHVVIDNIMGQQINHVILYKIFHRFGIILRVLIFLRNNQYRCLLEFQDHIQAFVAMLLLNGQNIYTGCCSLQVEFWKARGPLEVRRENDKCRDYTVSPLTEAELNSLQALPSGVT----ASTNNSTINTIPQPTIGQNISLGNPTTAFTAIPQAS-----ASGINDLAIQLTLLAQQSGLALTPAAAAATASFMALTAQSGNPAINQAPATILNAAALQSPRTALTTVQNPTQLLPNIINQSIPNMGQTATSTVLIVSNLNEEKVYPDALFTLFGVYGDVTRVKIMFNKKSTALVQFSDPQQALTALYYLNGQPLYGRPLKISVSRFNIVQLPK--EDTDVGLTKDYTNSPLHRFRKPNSKNFSNIYAPNHVLHLSNIPSDITEEEVRMIFETKGYHVTDFKFLLKD-KKMALIQLENVDMAIQAMIDLHNCQLTENSHLRISFSKTAI 571          
BLAST of Polypyrimidine tract-binding protein 1 vs. TrEMBL
Match: C1LLD8 (Polypyrimidine tract-binding protein 1 OS=Schistosoma japonicum OX=6182 GN=EWB00_010035 PE=2 SV=1)

HSP 1 Score: 336.65 bits (862), Expect = 3.490e-104
Identity = 213/593 (35.92%), Postives = 325/593 (54.81%), Query Frame = 1
Query:  121 PQMSKRILDLNENSGSGGKRVCVDKI----SRVLHIRNVSSDVTERDIANLAIPFGLISYLVLTRKTGQALMEMHHEESAQAMVDYYSKCLPHFYGKNIVIQFSRYETLSGSGMHPEAETAVKGAN----EDVRKLCEGEPKLVLHVTIENWEGSRLGHLHFYKLFQRYGTICRIIVFVQNQSPQALIEFENEVAAHVAKLQLGGSNAFYGR-PVRIEF-STRKSLDIKHESDTGRDYTISPVRKDELNSIPSFNSSYGMDDHGNANYSQHHDYPVSRQGGSMNNGQMTXXXXXXXXXXXXXXXSNNPNDTLPMLQSLA---------------PTLTSLLNQSQMGSMNSRESSRMNYSN------------------ENLNNTSSSRKSQGNANSVVIVANLNEDRISPDALFILFGVYGDVQRVKILYNKKNTALIQFVDGEHAARAVTNLNNVNLYGKPMRVNFSKHTSISMPKPEEQNSVHLNKDYSNSRLHRFKRATSRTVQNIYPPGTVLHLAGLPESYEEEEIKNLFDD--YAITKVKMINPNQRKMALVQLETIDMAIDALIKLHDCDVGL-SKLRVSFSKGFI 1761
            P M   I+D         K+  VD++    SRV+HIRN+ +D TE +IA  AIPFGL+  +VL+++  QAL+EMH  E +  +V +Y K     +GK+++ QFS +  L     +     A+K AN    +D+     G P  VLHV I+N  G ++ H+  YK+F R+G I R+++F++N   + L+EF++ + A VA L L G N + G   +++EF   R  L+++ E+D  RDYT+SP+ + ELNS+ +  S        + N S  +  P    G +++ G  T A             ++  ND    L  LA                +  +L  QS   ++N   ++ +N +                    N+ N S     Q   ++V+IV+NLNE+++ PDALF LFGVYGDV RVKI++NKK+TAL+QF D + A  A+  LN   LYG+P++++ S+   + +PK  E   V L KDY+NS LHRF++  S+   NIY P  VLHL+ +P    EEE++ +F+   Y +T  K +  + +KMAL+QLE +DMAI A+I LH+C +   S LR+SFSK  I
Sbjct:   31 PSMDLEIVD--------NKKSRVDRLEASPSRVIHIRNMPADATENEIALFAIPFGLLKNMVLSKRNNQALIEMHVLEESVQLVAHYLKYPVTLHGKHLIFQFSTHSHLELISENDAIVNAIKNANRVVQQDLPGAQTGVPNTVLHVVIDNIMGQQINHVILYKIFHRFGIILRVLIFLRNNQYRCLLEFQDHIQAFVAMLLLNGQNIYTGCCSLQVEFWKARGPLEVRRENDKCRDYTVSPLTEAELNSLQALPSGVS----ASTNNSTINTIPQPTIGQNISLGNPTTAFTAIPQAS-----ASGINDLAIQLTLLAQQSGLALTPAAAAATASFMALTAQSGNPAINQAPATILNAAALQSPRTALTTVQNPTQLLPNIINQSIPNMGQTATSTVLIVSNLNEEKVYPDALFTLFGVYGDVTRVKIMFNKKSTALVQFSDPQQALTALYYLNGQPLYGRPLKISVSRFNIVQLPK--EDTDVGLTKDYTNSPLHRFRKPNSKNFSNIYAPNHVLHLSNIPSDITEEEVRMIFETKGYHVTDFKFLLKD-KKMALIQLENVDMAIQAMIDLHNCQLTENSHLRISFSKTAI 603          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Cavefish
Match: ptbp2b (polypyrimidine tract-binding protein 2-like [Source:NCBI gene;Acc:103030091])

HSP 1 Score: 184.496 bits (467), Expect = 9.024e-51
Identity = 93/194 (47.94%), Postives = 132/194 (68.04%), Query Frame = 1
Query: 1183 VVIVANLNEDRISPDALFILFGVYGDVQRVKILYNKKNTALIQFVDGEHAARAVTNLNNVNLYGKPMRVNFSKHTSISMPKPEEQNSVHLNKDYSNSRLHRFKRATSRTVQNIYPPGTVLHLAGLPESYEEEEIKNLFDDYAITKVKMINPNQRKMALVQLETIDMAIDALIKLHDCDVGLS-KLRVSFSKGFI 1761
            V++ +NLN++ ++P +LF LFGVYGDVQRVKILYNKK++ALIQ  DG  A  A+++LN   +YGK +RV  SKH ++ +P+ E  +   L KD++NS LHRFK+  S+  QNI+PP   LHL+ + +   EE+++ LF +   T         RKMAL+Q+ T++ AI ALI LH+ D+G   +LRVSFSK  I
Sbjct:  346 VLLASNLNDEMVTPQSLFTLFGVYGDVQRVKILYNKKDSALIQMADGNQAQLAMSHLNGQKMYGKIIRVTLSKHQTVQLPR-EGLDDQGLTKDFTNSPLHRFKKPGSKNFQNIFPPSATLHLSNVRDDVTEEDLRLLFSNSGGTVKAFKFFQDRKMALLQMSTVEEAIQALIDLHNYDMGRGHRLRVSFSKSTI 538          

HSP 2 Score: 112.464 bits (280), Expect = 6.940e-26
Identity = 68/224 (30.36%), Postives = 115/224 (51.34%), Query Frame = 1
Query:  199 SRVLHIRNVSSDVTERDIANLAIPFGLISYLVLTRKTGQALMEMHHEESAQAMVDYYSKCLPHFYGKNIVIQFSRYETLSGSGMHPEAETAVKGANEDVRK------------LCEGEPKLVLHVTIENWEGSRLGHLHFY--------KLFQRYGTICRIIVFVQNQSPQALIEFENEVAAHVAKLQLGGSNAFYG-RPVRIEFSTRKSLDIKHESDTGRDYT 807
            SRV+HIR + ++V+E ++  L +PFG ++ +++ +   QA +E+  EE+A  MV+YY+   P      + IQ+S ++ L       +   AV  A   V++            +    P  VL + I+N          FY        ++F ++GT+ +II F +N   QAL++F + V A  AKL L G N +     +RI+FS   +L++K+ +D  RDYT
Sbjct:   53 SRVIHIRKLPNEVSETEVIALGLPFGKVTNILMLKGKNQAFLELGTEEAAVTMVNYYTAVTPQVRNVPVFIQYSNHKELKTDSALNQRAQAVLQAVSAVQEGGSPSSDTAGDSILSPAPSPVLRIIIDNM---------FYPVTLDVLQQIFSKFGTVMKIITFTKNNQFQALLQFSDPVNAQQAKLSLDGQNIYNSCCTLRIDFSKLVNLNVKYNNDKSRDYT 267          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Cavefish
Match: ptbp2b (polypyrimidine tract-binding protein 2-like [Source:NCBI gene;Acc:103030091])

HSP 1 Score: 183.726 bits (465), Expect = 9.479e-51
Identity = 93/194 (47.94%), Postives = 132/194 (68.04%), Query Frame = 1
Query: 1183 VVIVANLNEDRISPDALFILFGVYGDVQRVKILYNKKNTALIQFVDGEHAARAVTNLNNVNLYGKPMRVNFSKHTSISMPKPEEQNSVHLNKDYSNSRLHRFKRATSRTVQNIYPPGTVLHLAGLPESYEEEEIKNLFDDYAITKVKMINPNQRKMALVQLETIDMAIDALIKLHDCDVGLS-KLRVSFSKGFI 1761
            V++ +NLN++ ++P +LF LFGVYGDVQRVKILYNKK++ALIQ  DG  A  A+++LN   +YGK +RV  SKH ++ +P+ E  +   L KD++NS LHRFK+  S+  QNI+PP   LHL+ + +   EE+++ LF +   T         RKMAL+Q+ T++ AI ALI LH+ D+G   +LRVSFSK  I
Sbjct:  326 VLLASNLNDEMVTPQSLFTLFGVYGDVQRVKILYNKKDSALIQMADGNQAQLAMSHLNGQKMYGKIIRVTLSKHQTVQLPR-EGLDDQGLTKDFTNSPLHRFKKPGSKNFQNIFPPSATLHLSNVRDDVTEEDLRLLFSNSGGTVKAFKFFQDRKMALLQMSTVEEAIQALIDLHNYDMGRGHRLRVSFSKSTI 518          

HSP 2 Score: 112.849 bits (281), Expect = 5.687e-26
Identity = 68/224 (30.36%), Postives = 115/224 (51.34%), Query Frame = 1
Query:  199 SRVLHIRNVSSDVTERDIANLAIPFGLISYLVLTRKTGQALMEMHHEESAQAMVDYYSKCLPHFYGKNIVIQFSRYETLSGSGMHPEAETAVKGANEDVRK------------LCEGEPKLVLHVTIENWEGSRLGHLHFY--------KLFQRYGTICRIIVFVQNQSPQALIEFENEVAAHVAKLQLGGSNAFYG-RPVRIEFSTRKSLDIKHESDTGRDYT 807
            SRV+HIR + ++V+E ++  L +PFG ++ +++ +   QA +E+  EE+A  MV+YY+   P      + IQ+S ++ L       +   AV  A   V++            +    P  VL + I+N          FY        ++F ++GT+ +II F +N   QAL++F + V A  AKL L G N +     +RI+FS   +L++K+ +D  RDYT
Sbjct:   53 SRVIHIRKLPNEVSETEVIALGLPFGKVTNILMLKGKNQAFLELGTEEAAVTMVNYYTAVTPQVRNVPVFIQYSNHKELKTDSALNQRAQAVLQAVSAVQEGGSPSSDTAGDSILSPAPSPVLRIIIDNM---------FYPVTLDVLQQIFSKFGTVMKIITFTKNNQFQALLQFSDPVNAQQAKLSLDGQNIYNSCCTLRIDFSKLVNLNVKYNNDKSRDYT 267          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Cavefish
Match: ptbp3 (polypyrimidine tract binding protein 3 [Source:ZFIN;Acc:ZDB-GENE-091116-1])

HSP 1 Score: 183.341 bits (464), Expect = 1.266e-50
Identity = 97/198 (48.99%), Postives = 132/198 (66.67%), Query Frame = 1
Query: 1177 NSVVIVANLNEDRISPDALFILFGVYGDVQRVKILYNKKNTALIQFVDGEHAARAVTNLNNVNLYGKPMRVNFSKHTSISMPKPEEQNSVHLNKDYSNSRLHRFKRATSRTVQNIYPPGTVLHLAGLPESYEEEEIKNLFDD--YAITKVKMINPNQRKMALVQLETIDMAIDALIKLHDCDVGLS-KLRVSFSKGFI 1761
            +SV++V+NLN D ISP +LFILFGVYGDV RVKIL+NKK  AL+Q  D   A  A+++LN   L+G+ +RV  SKH ++ +P+ E Q    L KD+S S LHRFK+  S+  QNI+PP   LHL+ +P S  ++ +K+LF    Y +   K      RKMAL+QL +++ AI ALI LH+ D+G +  LRVSFSK  I
Sbjct:  311 HSVLLVSNLNPDSISPHSLFILFGVYGDVHRVKILFNKKENALVQMADATQAQLAMSHLNGQRLHGRVIRVTISKHQTVQLPR-EGQEDQGLTKDFSGSPLHRFKKPGSKNFQNIFPPSATLHLSNIPPSIADDMLKDLFSSAGYTVKAFKFFQ-KDRKMALIQLGSVEEAIQALIDLHNHDLGENHHLRVSFSKSTI 506          

HSP 2 Score: 75.485 bits (184), Expect = 6.075e-14
Identity = 65/235 (27.66%), Postives = 107/235 (45.53%), Query Frame = 1
Query:  172 GKRVCVDKISRVLHIRNVSSDVTERDIANLAIPFGLISYLVLTRKTGQALMEMHHEESAQAMVDYYSKCLPHFYGKNIVIQFSRYETLSGSGMHPEAETAVKGANEDVRKLCEGEPKLVLHVTIENWEGSRLGHLHFYK--LFQRYGTICRIIV-------------FVQNQSPQALIEFENE----VAAHVAKL---QLGGSNAFYG-RPVRIEFSTRKSLDIKHESDTGRDYT 807
            G R C    SRV+H+R V  +V+E ++ +L IPFG ++ L++ +   QA +EM  EE+A  MV+YY+   PH   + + IQ+S +  L    +           N+ VR      P  +  + + +   +      FY+     +Y   C IIV             +V       + +  N     +A H+ +L    L G N +     +RIEFS   SL++K+ +D  RD+T
Sbjct:   16 GDRSC--GPSRVVHVRKVPIEVSEAEVISLGIPFGKVTNLLMLKAKNQAFIEMASEEAAITMVNYYTTATPHVRNQPVYIQYSNHRELKTDNL----------PNQGVR-----SPSTLSVLPVLDQCAA-----FFYRQAASPKYIRTCGIIVTHKYYKCCSFLYLYVGLFGSNYITKTNNSNNKFMAVHLLRLTPITLDGQNIYNACCTLRIEFSKLTSLNVKYNNDKSRDFT 228          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Cavefish
Match: ptbp1b (polypyrimidine tract binding protein 1 [Source:NCBI gene;Acc:103035814])

HSP 1 Score: 182.57 bits (462), Expect = 2.314e-50
Identity = 93/198 (46.97%), Postives = 134/198 (67.68%), Query Frame = 1
Query: 1174 ANSVVIVANLNEDRISPDALFILFGVYGDVQRVKILYNKKNTALIQFVDGEHAARAVTNLNNVNLYGKPMRVNFSKHTSISMPKPEEQNSVHLNKDYSNSRLHRFKRATSRTVQNIYPPGTVLHLAGLPESYEEEEIKNLFDDY-AITKVKMINPNQRKMALVQLETIDMAIDALIKLHDCDVGLS-KLRVSFSKGFI 1761
             + V++V+NLN +R++P  LFILFGVYGDV RVKI++NKK  AL+Q  DG  A  A+++LN   LYG+ +R+  SKHT++ +P+ E      L KDYSNS LHRFK+  S+   NI+PP + LHL+ +P S  E+++K LF    A+ K        RKMAL+Q+ +++ AI++LI+ H+ D+G +  LRVSFSK  I
Sbjct:  303 GHCVMLVSNLNPERVTPQCLFILFGVYGDVIRVKIMFNKKENALVQMSDGTQAQLAMSHLNGQKLYGRALRITLSKHTTVQLPR-EGHEDQGLTKDYSNSPLHRFKKPGSKNYSNIFPPSSTLHLSNIPPSVVEDDLKMLFSTSGALVKNFKFFQKDRKMALIQMGSVEEAIESLIEFHNHDLGENHHLRVSFSKSTI 499          

HSP 2 Score: 122.094 bits (305), Expect = 4.195e-29
Identity = 80/243 (32.92%), Postives = 128/243 (52.67%), Query Frame = 1
Query:  199 SRVLHIRNVSSDVTERDIANLAIPFGLISYLVLTRKTGQALMEMHHEESAQAMVDYYSKCLPHFYGKNIVIQFSRYETLS--GSGMHPEAETAVKGAN---------EDVRKLCEGEPKLVLHVTIEN-WEGSRLGHLHFYKLFQRYGTICRIIVFVQNQSPQALIEFENEVAAHVAKLQLGGSNAFYG-RPVRIEFSTRKSLDIKHESDTGRDYTISPVRKDELNSIPSFNSSYGMDDHGNA 888
            SRV+H+R + SD+ E ++ +L +PFG ++ L++ +   QA +EM+ EE+AQ MV YYS   P      I +Q+S ++ L    S     A+ A++  N           V       P  VL V +EN +    L  LH  ++F ++GT+ ++I F +N   QAL++F + + A  AKL L G N +     +RI FS   SL++K+ +D  RDYT    R D    +P+ +S   ++ H  A
Sbjct:   30 SRVIHVRKLPSDINEAEVISLGLPFGKVTNLLMLKGKNQAFLEMNTEEAAQTMVSYYSSVTPVIRNHPIFMQYSNHKELKTDNSPNQVRAQAALQAVNAVQTGSMAIAGVDPSGVTGPSPVLRVIVENLFYPVTLDVLH--QIFSKFGTVLKVITFTKNNQFQALLQFADGLTAQHAKLALDGQNIYNACCTLRISFSKLTSLNVKYNNDKSRDYT----RPD----LPTGDSQPAIEHHAMA 262          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Cavefish
Match: ptbp1b (polypyrimidine tract binding protein 1 [Source:NCBI gene;Acc:103035814])

HSP 1 Score: 182.185 bits (461), Expect = 6.477e-50
Identity = 93/198 (46.97%), Postives = 134/198 (67.68%), Query Frame = 1
Query: 1174 ANSVVIVANLNEDRISPDALFILFGVYGDVQRVKILYNKKNTALIQFVDGEHAARAVTNLNNVNLYGKPMRVNFSKHTSISMPKPEEQNSVHLNKDYSNSRLHRFKRATSRTVQNIYPPGTVLHLAGLPESYEEEEIKNLFDDY-AITKVKMINPNQRKMALVQLETIDMAIDALIKLHDCDVGLS-KLRVSFSKGFI 1761
             + V++V+NLN +R++P  LFILFGVYGDV RVKI++NKK  AL+Q  DG  A  A+++LN   LYG+ +R+  SKHT++ +P+ E      L KDYSNS LHRFK+  S+   NI+PP + LHL+ +P S  E+++K LF    A+ K        RKMAL+Q+ +++ AI++LI+ H+ D+G +  LRVSFSK  I
Sbjct:  359 GHCVMLVSNLNPERVTPQCLFILFGVYGDVIRVKIMFNKKENALVQMSDGTQAQLAMSHLNGQKLYGRALRITLSKHTTVQLPR-EGHEDQGLTKDYSNSPLHRFKKPGSKNYSNIFPPSSTLHLSNIPPSVVEDDLKMLFSTSGALVKNFKFFQKDRKMALIQMGSVEEAIESLIEFHNHDLGENHHLRVSFSKSTI 555          

HSP 2 Score: 120.939 bits (302), Expect = 1.252e-28
Identity = 80/243 (32.92%), Postives = 128/243 (52.67%), Query Frame = 1
Query:  199 SRVLHIRNVSSDVTERDIANLAIPFGLISYLVLTRKTGQALMEMHHEESAQAMVDYYSKCLPHFYGKNIVIQFSRYETLS--GSGMHPEAETAVKGAN---------EDVRKLCEGEPKLVLHVTIEN-WEGSRLGHLHFYKLFQRYGTICRIIVFVQNQSPQALIEFENEVAAHVAKLQLGGSNAFYG-RPVRIEFSTRKSLDIKHESDTGRDYTISPVRKDELNSIPSFNSSYGMDDHGNA 888
            SRV+H+R + SD+ E ++ +L +PFG ++ L++ +   QA +EM+ EE+AQ MV YYS   P      I +Q+S ++ L    S     A+ A++  N           V       P  VL V +EN +    L  LH  ++F ++GT+ ++I F +N   QAL++F + + A  AKL L G N +     +RI FS   SL++K+ +D  RDYT    R D    +P+ +S   ++ H  A
Sbjct:   59 SRVIHVRKLPSDINEAEVISLGLPFGKVTNLLMLKGKNQAFLEMNTEEAAQTMVSYYSSVTPVIRNHPIFMQYSNHKELKTDNSPNQVRAQAALQAVNAVQTGSMAIAGVDPSGVTGPSPVLRVIVENLFYPVTLDVLH--QIFSKFGTVLKVITFTKNNQFQALLQFADGLTAQHAKLALDGQNIYNACCTLRISFSKLTSLNVKYNNDKSRDYT----RPD----LPTGDSQPAIEHHAMA 291          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008413.1 (pep scaffold:Pmarinus_7.0:GL478562:177533:180128:-1 gene:ENSPMAG00000007617.1 transcript:ENSPMAT00000008413.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 99.3673 bits (246), Expect = 1.170e-24
Identity = 53/140 (37.86%), Postives = 87/140 (62.14%), Query Frame = 1
Query: 1348 NLNNVNLYGKPMRVNFSKHTSISMPKPEEQNSVHLNKDYSNSRLHRFKRATSRTVQNIYPPGTVLHLAGLPESYEEEEIKNLFD-DYAITKVKMINPNQRKMALVQLETIDMAIDALIKLHDCDVGLSK-LRVSFSKGFI 1761
            +LN   +YGKP+RV  S++ ++ +P+     S  L  D+S+S LHRF+R  ++   +I+PP   LHL+ +P S  E+++K LF+ +  + K         KMALVQ+E+++ AI  L +LH+ ++  ++ LRVSFSK  I
Sbjct:   24 HLNGQRMYGKPIRVTSSRYQTVQLPR---DGSDSLTCDFSDSPLHRFRRMGAKNFHHIFPPSVTLHLSNIPSSVLEDDLKTLFESNGCVVKALKFFATDHKMALVQMESLEEAIQTLAELHNHELEKNRLLRVSFSKSVI 160          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006507.1 (pep scaffold:Pmarinus_7.0:GL480554:3468:10153:1 gene:ENSPMAG00000005883.1 transcript:ENSPMAT00000006507.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 99.7525 bits (247), Expect = 1.006e-23
Identity = 71/218 (32.57%), Postives = 119/218 (54.59%), Query Frame = 1
Query:  199 SRVLHIRNVSSDVTERDIANLAIPFGLISYLVLTRKTGQALMEMHHEESAQAMVDYYSKCLPHFYGKNIVIQFSRYETL-----------SGSGMHPEAETAVKGAN-EDVRKLCEGEPK-LVLHVTIEN-WEGSRLGHLHFYKLFQRYGTICRIIVFVQNQSPQALIEFENEVAAHVAKLQLGGSNAFYG-RPVRIEFSTRKSLDIKHESDTGRDYT 807
            S+VLHIR +  + TE ++  LA+PFG ++ +++ +   QA +EM  EE+A A V +YS   P    + + +Q+S Y++L           S +    +A+ A+  AN  D  +     P+  +LH+ +EN      L  LH   +F +YGT+ +II+F +N   QAL++F +   AH AK  L G N + G   +R+ FS   +L++K+ ++  RD T
Sbjct:   26 SKVLHIRKLPENATEAEVVTLALPFGRVTNILMLKGKSQAFLEMASEEAAVAAVTFYSTDPPVLRNQPVYVQYSTYKSLKTDNSAYQAARSHARREQKAQAAMMVANGSDSEETNSAAPQSPILHIIVENLLYPITLEVLH--HVFSKYGTVLKIIIFNKNSQYQALMQFADASNAHQAKTMLDGQNIYNGCCTLRVGFSRLTNLNVKYNNEKSRDLT 241          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Sea Lamprey
Match: HNRNPLL (heterogeneous nuclear ribonucleoprotein L like [Source:HGNC Symbol;Acc:HGNC:25127])

HSP 1 Score: 97.0561 bits (240), Expect = 8.645e-22
Identity = 114/487 (23.41%), Postives = 197/487 (40.45%), Query Frame = 1
Query:  199 SRVLHIRNVSSDVTERDIANLAIPFGLISYLVLTRKTGQALMEMHHEESAQAMVDYYSKCLPHFYGKNIVIQFSRYETLSGSGMHPEAETAVKGANEDVRKLCEGEPKLVLHVTIENWEGSRLGHLHFYKLFQRYGTICRIIVFVQNQSPQALIEFENEVAAHVAKLQLGGSNAFYGR-PVRIEFSTRKSLDIKHESDTGRDYTISPVRKDELNSIPSFNSSYGMDDHGNANYSQHHDYPVSRQGGSMNNGQMTXXXXXXXXXXXXXXXSNNPNDTLPMLQSLAPTLTSLLNQSQMGSM-NSRESSRMNYSNENLNNTSSSRKSQGNANSVVIVANLNEDRISPDALFILFGVYGDVQRVKILYNKKNTALIQFVDGEHAARAVTNLNNVNLYGKPMRVNFSKHTSISMPKP-EEQNSVHLNKDYSNSRLHRFKRATSRTVQNIYPPGTVLHLAGLPESYEEEEIKNLFDDYAITKVKMINPNQRKM 1650
            S V+HIR ++S   E  +      FG + ++V+     QAL+E    E A+A V   +    +  G+     FS  + +S  G  P          +DV +        +L +T+ N        +  + +   YG + RI++F +N   QAL  F++  +A  AK  L G++ + G   ++IE++  +                 P R +                    N S+  DY  + +G  + NGQ     AL    P   +   N   T        P   S  N +      N+R ++ M+       + +        AN V++V N+N   ++   LF L  +YG+V+++K L +K    +IQ  D     RAV NLN   L+G+ + ++ SK   I   +  E ++     +D+  SR +RF      +   I PP  +LH    P  + E+    + ++  + K     PN  K+
Sbjct:   11 SPVVHIRGLASSADESQVMEALQEFGTVRHVVMMPHRRQALVEFERLEDARACVAGTAGDPVYVGGQPAYCNFSTSQRISRKGGTPA---------DDVART-----NHILLLTVNNALYPITTEV-IHTICSPYGVVQRIVIFKKNGV-QALRTFDSIPSAQQAKSSLNGADIYSGCCTLKIEYAKERK----------------PARLNVYR-----------------NDSETWDY--TLEGPCVPNGQQKKQPALLGDHPSTMRGYGNQQGTY------CPQNYSFNNYTSGSPFGNARPTTPMSGPGTCAPHNNPCPMGGSAANRVMMVYNMNPSVMNCSRLFNLVCLYGNVEKIKFLKSKPGVGMIQMADAASVDRAVANLNTAQLFGQKLSLSVSKQQEIVAGQAFELEDGSDSFRDFVGSRHNRFSTHEQASKNRILPPSAILHFYSAPPEFSEQAFIQICEETGVKK-----PNAFKL 435          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006509.1 (pep scaffold:Pmarinus_7.0:GL480554:3489:6552:1 gene:ENSPMAG00000005883.1 transcript:ENSPMAT00000006509.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 83.1889 bits (204), Expect = 1.728e-18
Identity = 59/180 (32.78%), Postives = 98/180 (54.44%), Query Frame = 1
Query:  199 SRVLHIRNVSSDVTERDIANLAIPFGLISYLVLTRKTGQALMEMHHEESAQAMVDYYSKCLPHFYGKNIVIQFSRYETL-----------SGSGMHPEAETAVKGAN-EDVRKLCEGEPK-LVLHVTIEN-WEGSRLGHLHFYKLFQRYGTICRIIVFVQNQSPQALIEFENEVAAHVAK 696
            S+VLHIR +  + TE ++  LA+PFG ++ +++ +   QA +EM  EE+A A V +YS   P    + + +Q+S Y++L           S +    +A+ A+  AN  D  +     P+  +LH+ +EN      L  LH   +F +YGT+ +II+F +N   QAL++F +   AH AK
Sbjct:   19 SKVLHIRKLPENATEAEVVTLALPFGRVTNILMLKGKSQAFLEMASEEAAVAAVTFYSTDPPVLRNQPVYVQYSTYKSLKTDNSAYQAARSHARREQKAQAAMMVANGSDSEETNSAAPQSPILHIIVENLLYPITLEVLH--HVFSKYGTVLKIIIFNKNSQYQALMQFADASNAHQAK 196          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Sea Lamprey
Match: HNRNPLL (heterogeneous nuclear ribonucleoprotein L like [Source:HGNC Symbol;Acc:HGNC:25127])

HSP 1 Score: 74.7146 bits (182), Expect = 2.171e-14
Identity = 47/152 (30.92%), Postives = 77/152 (50.66%), Query Frame = 1
Query: 1174 ANSVVIVANLNEDRISPDALFILFGVYGDVQRVKILYNKKNTALIQFVDGEHAARAVTNLNNVNLYGKPMRVNFSKHTSI----SMPKPEEQNSVHLNKDYSNSRLHRFKRATSRTVQNIYPPGTVLHLAGLPESYEEEEIKNLFDDYAITK 1617
             N V++V   + +RI+ D +F +  ++G+V++VK L +K   A+++  D     RAV++LN   ++GK + +  SK  SI    +   P+  NS    KD++ SR +RF  A       I  P TVLH    P     E    L D+ +I +
Sbjct:  313 GNKVLMVYGFDAERINCDRVFNILCLFGNVEKVKFLKSKPGAAMVEMGDPYAVDRAVSHLNMSQIFGKKINLCVSKQQSIVPGQAYELPDGTNSY---KDFTGSRNNRFANAEKAAKNRIQQPTTVLHFFNAPMDITAEIFMQLCDEMSIAR 461          

HSP 2 Score: 59.3066 bits (142), Expect = 1.278e-9
Identity = 63/234 (26.92%), Postives = 109/234 (46.58%), Query Frame = 1
Query:  199 SRVLHIRNVSSDVTERDIANLAIPFGLISYLVLTRKTGQALMEMHHEESAQAMVDYYSKCLPHFYGKNIVIQFSRYETLSGSGMHPEAETAVKGANEDVRKLCEGEPKLVLHVTIENWEGSRLGHLHFYKLFQRYGTICRIIVFVQNQSPQALIEFENEVAAHVAKLQLGGSNAFYG-RPVRIEFSTRKSLDI-KHESDTGRDYTISPVRKDEL-NSIPSFNSSYGMDDHGNAN 891
            S V+H+R +S    E D+      FG ISY+V+  K  QAL+E    ES+++ V+Y S    +  G+     FS  + +S             G  ED R         +L  TI N        +  Y +    G + RI++F +N   QA+  F++  +A  AK  L G++ + G   +++E++    L++ K++S+T  DYT   ++  +  N++     +  + DH  AN
Sbjct:   48 SAVVHVRGLSDAALESDLVEAVQHFGPISYVVMMPKKRQALVEFEDLESSRSCVNYSSTGSIYVCGQPAYFNFSTSQKISRP-----------GGPEDNR-----NSNHILLFTILNPIYPITTDV-LYTICNPCGPVQRIVIFRKN-GLQAMATFDSVQSAQRAKSSLNGADIYSGCCTLKVEYAKPTRLNVFKNDSET-WDYTNPGLKAGQAENAMMPAKQTALLGDHPKAN 262          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Yeast
Match: MSL1 (U2B component of U2 snRNP; involved in splicing, binds the U2 snRNA stem-loop IV in vitro but requires association of Lea1p for in vivo binding; does not contain the conserved C-terminal RNA binding domain found in other family members [Source:SGD;Acc:S000001448])

HSP 1 Score: 43.5134 bits (101), Expect = 6.648e-6
Identity = 27/81 (33.33%), Postives = 45/81 (55.56%), Query Frame = 1
Query: 1174 ANSVVIVANLNE----DRISPDALFILFGVYGDVQRVKILYNK-KNTALIQFVDGEHAARAVTNLNNVNLYGKPMRVNFSK 1401
            A + + V+ LNE     R+  + LF+LF  +G+V +V + + K +  A I     + A+ A  +LN    +GKP++V FSK
Sbjct:   26 AKNTLYVSQLNEKINMQRLRVN-LFLLFATFGEVLKVSMNFKKQRGQAFITMRTIDQASLAQISLNGERFFGKPLKVEFSK 105          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Nematostella
Match: EDO43995 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXA3])

HSP 1 Score: 192.971 bits (489), Expect = 5.866e-55
Identity = 98/191 (51.31%), Postives = 132/191 (69.11%), Query Frame = 1
Query: 1183 VVIVANLNEDRISPDALFILFGVYGDVQRVKILYNKKNTALIQFVDGEHAARAVTNLNNVNLYGKPMRVNFSKHTSISMPKPEEQNSVHLNKDYSNSRLHRFKRATSRTVQNIYPPGTVLHLAGLPESYEEEEIKNLFDDYAITKVKMINPNQRKMALVQLETIDMAIDALIKLHDCDVGLS-KLRVSFSK 1752
            +V+V+NLNE+ IS DALF LFG YGDVQRVKIL+NKK+TAL+QF +   A  A+ +LN V ++GK M+V  SKHTS+S+PK  E    +L KDY NS LHRFK+  S+  QNI+PP   LHL+ +PES  EEE+ ++F+D          P  RKMA + + T + AIDALIK+H+  +  +  LRVSF++
Sbjct:  279 LVLVSNLNEEMISCDALFTLFGCYGDVQRVKILFNKKDTALVQFANVHQAQTAIGHLNGVRVFGKEMKVTNSKHTSVSLPK--EGEDTNLTKDYMNSPLHRFKKPGSKNFQNIFPPSRTLHLSNIPESVTEEELTSMFEDCGDVADFRFLPKDRKMAHLSMATTEEAIDALIKMHNYKISETHHLRVSFAR 467          

HSP 2 Score: 110.153 bits (274), Expect = 9.642e-26
Identity = 69/233 (29.61%), Postives = 124/233 (53.22%), Query Frame = 1
Query:  196 ISRVLHIRNVSSDVTERDIANLAIPFGLISYLVLTRKTGQALMEMHHEESAQAMVDYYSKCLPHFYGKNIVIQFSRYETLSGSGMHPEAETAVKGANED-----VRKLCEG------EPKL---VLHVTIENWEGSRLGHLHFYKLFQRYGTICRIIVFVQNQSPQALIEFENEVAAHVAKLQLGGSNAFYG-RPVRIEFSTRKSLDIKHESDTGRDYTISPVRKDELNSIPS 849
            +S+VLH+RNV+++ T+ +I  L IP+G ++ +++ +   QA +EM  +E+A A+++ YS   P   G+ I IQ+S ++ L+ +    +    V+G +       +  L  G       P +   +L + +EN        +   ++F +YGT+ +I++F +N   QAL++F     A  AK  L G N + G   +RI++S  K+L +K+ +D  RDYT   +   E    PS
Sbjct:    1 MSKVLHLRNVAAEATDAEIIALGIPYGRVTNVLMLKGKNQAFLEMKTKENAMALMNSYSYIPPSIRGRQIYIQYSNHQELTTN--ESQHSPGVRGLSSSHLGAGIGSLTSGLGIAGELPSVNGCILRIIVENMLYPITIEV-LNQIFTKYGTVLKIVIFTRNNQFQALVQFSQSTEARAAKCSLDGQNIYNGCCTLRIDYSKLKTLSVKYNNDKTRDYTRPDLPSGESTPDPS 230          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Nematostella
Match: EDO26232 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TCJ0])

HSP 1 Score: 123.25 bits (308), Expect = 3.982e-33
Identity = 64/139 (46.04%), Postives = 90/139 (64.75%), Query Frame = 1
Query: 1339 AVTNLNNVNLYGKPMRVNFSKHTSISMPKPEEQNSVHLNKDYSNSRLHRFKRATSRTVQNIYPPGTVLHLAGLPESYEEEEIKNLFDDYAITKVKMINPNQRKMALVQLETIDMAIDALIKLHDCDVGLS-KLRVSFSK 1752
            A+ +LN V ++GK M+V  SKHTS+S+PK  E    +L KDY NS LHRFK+  S+  QNI+PP   LHL+ +PES  EEE+ ++F+D          P  RKMA + + T + AIDALIK+H+  +  +  LRVSF++
Sbjct:    1 AIGHLNGVRVFGKEMKVTNSKHTSVSLPK--EGEDTNLTKDYMNSPLHRFKKPGSKNFQNIFPPSRTLHLSNIPESVTEEELTSMFEDCGDVADFRFLPKDRKMAHLSMATTEEAIDALIKMHNYKISETHHLRVSFAR 137          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Nematostella
Match: EDO39119 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAW4])

HSP 1 Score: 77.7962 bits (190), Expect = 3.567e-15
Identity = 53/213 (24.88%), Postives = 104/213 (48.83%), Query Frame = 1
Query: 1171 NANSVVIVANLNEDRISPDALFILFGVYGDVQRVKILYNKKNTALIQFVDGEHAARAVTNLNNVNLYGKPMRVNFSKHTSISMPK--PEEQNSVHLNKDYSNSRLHRFKRATSRTVQNIYPPGTVLHLAGLPESYEEEEIKNLFDDYAIT---KVKMINPN---QRKMALVQLETIDMAIDALIKLHDCDVGLSKLRVSFSKGFIAN*VELAF 1785
            +  +V++V  L++D+++ D LF L   YG+V ++K L  K  TA+ +  +       + NL+ + L+ + +  +FSK   +  P   P   +     K + NS+ +RF  AT+ +   ++ P  VLH    P    EE+I+ +     +     +KM +P+   +    L++ E++  A++AL+  +   +  S  +  F+       V+LAF
Sbjct:  301 SGGNVIMVYGLDKDKMNCDRLFNLLCCYGNVIKIKFLLGKPGTAMAELHEHVACNTVMENLSKMTLFDQQLEFSFSKQDYLVEPANVPNLPDGSPSFKSFDNSKNNRFTSATASSKNRVFTPMKVLHFFNAPVDCTEEQIREMCQVCGVAPPKTIKMFSPSGNARTSSGLIEWESVTQALEALVMCNHYVIRNSTAKTIFT-------VKLAF 506          

HSP 2 Score: 52.373 bits (124), Expect = 3.716e-7
Identity = 57/235 (24.26%), Postives = 104/235 (44.26%), Query Frame = 1
Query:  121 PQMSKRILDLNENSGSGGKRVCVDKISRVLHIRNVSSDVTERDIANLAIPFGLISYLVLTRKTGQALMEMHHEESAQAMVDYYSKCLPH-FYGKNIVIQFSRYETLSGSGMHPEAETAVKGANEDVRKLCEGEPKLVLHVTIENWEGSRLGHLHFYKLFQRYGTICRIIVFVQNQSPQALIE---FENEVAAHVAKLQLGGSNAFYG-RPVRIEFST-RKSLDIKHESDTGRDYT 807
            P    R+   + N+  GG      + SRV+H+R V+ +  E+D+      +G IS + +  K  QAL+E      A  +V+      P    G+     +S+ + +S   +H  +ET               +P  +L +TI N +      +  + +F + G + RI++F +    QA++E   F+   AA  AK  L G++ + G   ++IE     + L+++       DYT
Sbjct:   21 PTKRARVDSSDSNNRYGGGDPHFAEPSRVVHVRGVADEAREQDLMQCLSQYGNISCITMMPKIRQALVEFEEIACANTLVNQTQMGNPVILCGRPAYANYSKSKQIS-RNVHVRSET---------------QPNKILLITIINPQYVVTTDI-LHTIFSKQGMVQRIVIF-RKSGLQAMVEESRFDCVEAARHAKETLNGADIYTGCNTLKIESQGYAQQLNVRKNDSETYDYT 237          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Nematostella
Match: EDO35537 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLA1])

HSP 1 Score: 61.6178 bits (148), Expect = 5.918e-11
Identity = 57/205 (27.80%), Postives = 90/205 (43.90%), Query Frame = 1
Query:  199 SRVLHIRNVSSDVTERDIANLAIPFGLISYLVLTRKTGQALMEMHHEESAQAMVDYYSKCLPHFYGKNIVIQFSRYETLSGSGMHPEAETAVKGANEDVRKLCEGEPKLVLHVTIENWEGSRLGHLHFYKLFQRYGTICRIIVFVQNQSPQALIEFENEVAAHVAKLQLGGSNAFYG-RPVRIEFSTR-KSLDIKHESDTGRDYT 807
            SRV+H R V+    E D+  +  PFG I+Y+ L  K  QAL+E    ESA A+V Y         G+ + + +S+ + +             K  N D    C     ++L   I       +  LH  K+    G + RI++F +N   QAL       +A  A   L G + + G   ++I++S + K L++    D   DYT
Sbjct:    6 SRVIHCRAVADGCKETDLIQVLQPFGTITYVTLLPKIRQALVEFESLESAIAVVTYSQTSPLTVLGRQMFVNYSKSQEIKRD----------KVLNGDSNGACAEASNILLLTIINPLHPINVKILH--KICSPSGKVLRIVIFHKN-GLQAL-------SAERALAVLNGQDIYAGCCTLKIDYSKKAKKLNVFKNDDETWDYT 190          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Nematostella
Match: EDO35536 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLA0])

HSP 1 Score: 56.225 bits (134), Expect = 4.731e-9
Identity = 43/190 (22.63%), Postives = 91/190 (47.89%), Query Frame = 1
Query: 1183 VVIVANLNEDRISPDALFILFGVYGDVQRVKILYNKKNTALIQFVDGEHAARAVTNLNNVNLYGKPMRVNFSKH-----TSISMPKPEEQNSVHLNKDYSNSRLHRFKRATSRTVQNIY---PPGTVLHLAGLPESYEEEEIKNLFDDYAITKVKMINP----------NQRKMALVQLETIDMAIDALI 1698
            +++V  LN ++++ + +F LF +YG+V +VK L NK    ++Q  D   +   + NL+   ++   + + FSKH     +S+    P+   S     +++++R +RFK      + ++    PP  +LH    P +   ++++++      TK   + P           +    L+++  I  A++ALI
Sbjct:    1 MLMVYGLNHEKMNCERIFNLFCLYGNVIKVKFLTNKPGACMVQMSDKIASEMIIRNLSGATIFDNKINIMFSKHPFIADSSVVTALPDSSPSAM---NFADNRNNRFKYDNMPFLDSVVGYQPPTRMLHFFNAPPNCTVDQLRDV-----STKAGALAPLKGTFFSKANTKSSAGLLEMPDIRSAMEALI 182          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Medaka
Match: ptbp1 (polypyrimidine tract binding protein 1 [Source:NCBI gene;Acc:101165926])

HSP 1 Score: 256.914 bits (655), Expect = 2.277e-77
Identity = 185/559 (33.09%), Postives = 281/559 (50.27%), Query Frame = 1
Query:  199 SRVLHIRNVSSDVTERDIANLAIPFGLISYLVLTRKTGQALMEMHHEESAQAMVDYYSKCLPHFYGKNIVIQFSRYE---------------------TLSGSGMHPEAETAVKGANEDVRKLCEGEPKLVLHVTIEN-WEGSRLGHLHFYKLFQRYGTICRIIVFVQNQSPQALIEFENEVAAHVAKLQLGGSNAFYG-RPVRIEFSTRKSLDIKHESDTGRDYTISPVRKD--ELNSIPSFN------SSYGMDDHGNANYSQHHDYPVS---RQGGSMNNGQMTXXXXXXXXXXXXXXXSNNPNDTLPMLQSLAPTLTSL-LNQSQM-GSMNSRESSRMNYSNENLNNTSSSRKSQGNANSVVIVANLNEDRISPDALFILFGVYGDVQRVKILYNKKNTALIQFVDGEHAARAVTNLNNVNLYGKPMRVNFSKHTSISMPKPEEQNSVHLNKDYSNSRLHRFKRATSRTVQNIYPPGTVLHLAGLPESYEEEEIKNLFDDYAIT-KVKMINPNQRKMALVQLETIDMAIDALIKLHDCDVGLS-KLRVSFSKGFI 1761
            SRV+H+R + +D+ E ++ +L +PFG ++ L++ +   QA +E   EE AQ MV YYS   P      I +Q+S ++                      L GSGM      A+      +       P  VL V +EN +    L  LH  ++F ++GT+ +II F +N   QALI++ + + A  AKL L G N +     +RI FS   SL++K+ +D  RDYT    R D    +S PS +      +++G      + Y   H +P +   +Q G                              L M Q +   L SL +  S M  +  +  ++R+  S            + G  N +++ +NLN + ++P  LFILFGVYGDV RVKIL+NKK  AL+Q  DG  A  ++++LN   L+G+ +RV  SKHT++ +P+ E      L KDYSNS LHRFK+  S+   NI+PP   LHL+ +P S  E++++ LF     T K        RKMAL+Q+ +++ AI+ LI+ H+ D+G +  LRVSFSK  I
Sbjct:   72 SRVVHVRKLPNDINEAEVISLGLPFGKVTNLLMLKGKNQAFLEFGSEECAQTMVSYYSSVTPVIRNHPIYMQYSTHKELKTDNSPNQVRAQAALQAVNALHGSGM---GSMAISAEAASMGGAASQSP--VLRVIVENLFYPVTLDVLH--QIFSKFGTVLKIITFTKNNQFQALIQYADAMTAQHAKLSLDGQNIYNACCTLRISFSKLTSLNVKYNNDKSRDYT----RPDLPTADSQPSLDHQAMAAAAFGPGIISASPYGGAHAFPPTFTFQQAG------------------------------LSM-QGIPSALASLGVGHSGMAAAAAAAAATRLGLSGLG---------ATGGHNVLLV-SNLNPESVTPHCLFILFGVYGDVMRVKILFNKKENALVQMSDGTQAQLSMSHLNGQRLHGRAIRVTLSKHTTVQLPR-EGHEDQGLTKDYSNSPLHRFKKPGSKNYSNIFPPSATLHLSNIPPSVMEDDLRRLFASTGATVKAFKFFQKDRKMALIQMGSVEEAIECLIEFHNHDLGENHHLRVSFSKSTI 577          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Medaka
Match: ptbp1 (polypyrimidine tract binding protein 1 [Source:NCBI gene;Acc:101165926])

HSP 1 Score: 221.476 bits (563), Expect = 4.996e-64
Identity = 175/569 (30.76%), Postives = 267/569 (46.92%), Query Frame = 1
Query:  199 SRVLHIRNVSSDVTERDIANLAIPFGLISYLVLTRKTGQALMEMHHEESAQAMVDYYSKCLPHFYGKNIVIQFSRYE---------------------TLSGSGMHPEAETAVKGANEDVRKLCEGEPKLVLHVTIEN-WEGSRLGHLHFYK----------LFQRYGTICRIIVFVQNQSPQALIEFENEVAAHVAKLQLGGSNAFYG-RPVRIEFSTRKSLDIKHESDTGRDYTISPVRKD--ELNSIPSFN------SSYGMDDHGNANYSQHHDYPVS---RQGGSMNNGQMTXXXXXXXXXXXXXXXSNNPNDTLPMLQSLAPTLTSL-LNQSQM-GSMNSRESSRMNYSNENLNNTSSSRKSQGNANSVVIVANLNEDRISPDALFILFGVYGDVQRVKILYNKKNTALIQFVDGEHAARAVTNLNNVNLYGKPMRVNFSKHTSISMPKPEEQNSVHLNKDYSNSRLHRFKRATSRTVQNIYPPGTVLHLAGLPESYEEEEIKNLFDDYAIT-KVKMINPNQRKMALVQLETIDMAIDALIKLHDCDVGLS-KLRVSFSKGFI 1761
            SRV+H+R + +D+ E ++ +L +PFG ++ L++ +   QA +E   EE AQ MV YYS   P      I +Q+S ++                      L GSGM      A+      +       P  VL V +EN +    L  LH +           L     T C+  + + + S   L+      A H     L G N +     +RI FS   SL++K+ +D  RDYT    R D    +S PS +      +++G      + Y   H +P +   +Q G                                 +Q +   L SL +  S M  +  +  ++R+  S            + G  N +++ +NLN + ++P  LFILFGVYGDV RVKIL+NKK  AL+Q  DG  A  ++++LN   L+G+ +RV  SKHT++ +P+ E      L KDYSNS LHRFK+  S+   NI+PP   LHL+ +P S  E++++ LF     T K        RKMAL+Q+ +++ AI+ LI+ H+ D+G +  LRVSFSK  I
Sbjct:   64 SRVVHVRKLPNDINEAEVISLGLPFGKVTNLLMLKGKNQAFLEFGSEECAQTMVSYYSSVTPVIRNHPIYMQYSTHKELKTDNSPNQVRAQAALQAVNALHGSGM---GSMAISAEAASMGGAASQSP--VLRVIVENLFYPVTLDVLHQFSPINTCLLLPDLLGFQKTNCQFAIMLPSLSIPFLVS-----AFHALFTSLDGQNIYNACCTLRISFSKLTSLNVKYNNDKSRDYT----RPDLPTADSQPSLDHQAMAAAAFGPGIISASPYGGAHAFPPTFTFQQAGL-------------------------------SMQGIPSALASLGVGHSGMAAAAAAAAATRLGLSGLG---------ATGGHNVLLV-SNLNPESVTPHCLFILFGVYGDVMRVKILFNKKENALVQMSDGTQAQLSMSHLNGQRLHGRAIRVTLSKHTTVQLPR-EGHEDQGLTKDYSNSPLHRFKKPGSKNYSNIFPPSATLHLSNIPPSVMEDDLRRLFASTGATVKAFKFFQKDRKMALIQMGSVEEAIECLIEFHNHDLGENHHLRVSFSKSTI 576          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Medaka
Match: ENSORLT00000042697.1 (polypyrimidine tract-binding protein 1 [Source:NCBI gene;Acc:101170752])

HSP 1 Score: 184.882 bits (468), Expect = 2.924e-51
Identity = 95/198 (47.98%), Postives = 133/198 (67.17%), Query Frame = 1
Query: 1174 ANSVVIVANLNEDRISPDALFILFGVYGDVQRVKILYNKKNTALIQFVDGEHAARAVTNLNNVNLYGKPMRVNFSKHTSISMPKPEEQNSVHLNKDYSNSRLHRFKRATSRTVQNIYPPGTVLHLAGLPESYEEEEIKNLFDDY-AITKVKMINPNQRKMALVQLETIDMAIDALIKLHDCDVGLS-KLRVSFSKGFI 1761
             +SVV+V+NLN +R++P  LFILFGVYGDV RVKIL+NKK  AL+Q  D   A  A+++LN   L+G+P+R+  SKHTS+ +P+ E      L KDYS+S LHRFK+  S+   NI+PP   LHL+ +P S  E+++K LF    A+ K         KMAL+Q+ +++ AI+ LI+LH+ D+G +  LRVSFSK  I
Sbjct:  313 GHSVVLVSNLNAERVTPHCLFILFGVYGDVMRVKILFNKKENALVQMSDSTQAQLAMSHLNGQRLHGRPLRITLSKHTSVQLPR-EGHEDQGLTKDYSSSPLHRFKKPGSKNYSNIFPPSATLHLSNIPPSVVEDDLKMLFSSSGAVVKAFKFFQKDHKMALIQMGSVEEAIECLIQLHNHDLGENHHLRVSFSKSSI 509          

HSP 2 Score: 124.79 bits (312), Expect = 5.142e-30
Identity = 75/210 (35.71%), Postives = 120/210 (57.14%), Query Frame = 1
Query:  199 SRVLHIRNVSSDVTERDIANLAIPFGLISYLVLTRKTGQALMEMHHEESAQAMVDYYSKCLPHFYGKNIVIQFSRYETLS--GSGMHPEAETAVKG---ANEDVRKLCEGEPKLVLHVTIEN-WEGSRLGHLHFYKLFQRYGTICRIIVFVQNQSPQALIEFENEVAAHVAKLQLGGSNAFYG-RPVRIEFSTRKSLDIKHESDTGRDYT 807
            SRVLHIR +  D+TE ++ +L +PFG ++ L++ +   QA +EM+ EE+AQ MV YYS  +P    + + +QFS ++ L    S     A+ A++    ++ D   L    P  VL V +EN      L  L   ++F ++GT+ RIIVF +N   QAL+++    +A  AK+ L G N + G   +RI FS   +L++K+ +D  RD+T
Sbjct:   24 SRVLHIRKLPIDITETEVISLGLPFGDVTNLLMLKAKNQAFLEMNSEEAAQNMVGYYSTVMPIIRQQPVFVQFSNHKELKTDNSPNQERAQAALRALSSSHVDTAALVVA-PSSVLRVVVENLLYPVSLDAL--CQIFSKFGTVLRIIVFTKNNQFQALLQYAEGASAQAAKVSLDGQNIYNGCCTLRISFSKLTTLNVKYNNDKSRDFT 230          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Medaka
Match: ENSORLT00000036879.1 (polypyrimidine tract-binding protein 1 [Source:NCBI gene;Acc:101170752])

HSP 1 Score: 185.267 bits (469), Expect = 5.964e-51
Identity = 95/198 (47.98%), Postives = 133/198 (67.17%), Query Frame = 1
Query: 1174 ANSVVIVANLNEDRISPDALFILFGVYGDVQRVKILYNKKNTALIQFVDGEHAARAVTNLNNVNLYGKPMRVNFSKHTSISMPKPEEQNSVHLNKDYSNSRLHRFKRATSRTVQNIYPPGTVLHLAGLPESYEEEEIKNLFDDY-AITKVKMINPNQRKMALVQLETIDMAIDALIKLHDCDVGLS-KLRVSFSKGFI 1761
             +SVV+V+NLN +R++P  LFILFGVYGDV RVKIL+NKK  AL+Q  D   A  A+++LN   L+G+P+R+  SKHTS+ +P+ E      L KDYS+S LHRFK+  S+   NI+PP   LHL+ +P S  E+++K LF    A+ K         KMAL+Q+ +++ AI+ LI+LH+ D+G +  LRVSFSK  I
Sbjct:  366 GHSVVLVSNLNAERVTPHCLFILFGVYGDVMRVKILFNKKENALVQMSDSTQAQLAMSHLNGQRLHGRPLRITLSKHTSVQLPR-EGHEDQGLTKDYSSSPLHRFKKPGSKNYSNIFPPSATLHLSNIPPSVVEDDLKMLFSSSGAVVKAFKFFQKDHKMALIQMGSVEEAIECLIQLHNHDLGENHHLRVSFSKSSI 562          

HSP 2 Score: 124.02 bits (310), Expect = 1.289e-29
Identity = 73/209 (34.93%), Postives = 119/209 (56.94%), Query Frame = 1
Query:  199 SRVLHIRNVSSDVTERDIANLAIPFGLISYLVLTRKTGQALMEMHHEESAQAMVDYYSKCLPHFYGKNIVIQFSRYETLS--GSGMHPEAETAVKG---ANEDVRKLCEGEPKLVLHVTIENWEGSRLGHLHFYKLFQRYGTICRIIVFVQNQSPQALIEFENEVAAHVAKLQLGGSNAFYG-RPVRIEFSTRKSLDIKHESDTGRDYT 807
            SRVLHIR +  D+TE ++ +L +PFG ++ L++ +   QA +EM+ EE+AQ MV YYS  +P    + + +QFS ++ L    S     A+ A++    ++ D   L    P  VL V +EN     +      ++F ++GT+ RIIVF +N   QAL+++    +A  AK+ L G N + G   +RI FS   +L++K+ +D  RD+T
Sbjct:   77 SRVLHIRKLPIDITETEVISLGLPFGDVTNLLMLKAKNQAFLEMNSEEAAQNMVGYYSTVMPIIRQQPVFVQFSNHKELKTDNSPNQERAQAALRALSSSHVDTAALVVA-PSSVLRVVVENLL-YPVSLDALCQIFSKFGTVLRIIVFTKNNQFQALLQYAEGASAQAAKVSLDGQNIYNGCCTLRISFSKLTTLNVKYNNDKSRDFT 283          
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Medaka
Match: PTBP2 (polypyrimidine tract binding protein 2 [Source:NCBI gene;Acc:101156726])

HSP 1 Score: 183.341 bits (464), Expect = 1.230e-50
Identity = 93/200 (46.50%), Postives = 135/200 (67.50%), Query Frame = 1
Query: 1165 QGNANSVVIVANLNEDRISPDALFILFGVYGDVQRVKILYNKKNTALIQFVDGEHAARAVTNLNNVNLYGKPMRVNFSKHTSISMPKPEEQNSVHLNKDYSNSRLHRFKRATSRTVQNIYPPGTVLHLAGLPESYEEEEIKNLFDDYAITKVKMINPNQRKMALVQLETIDMAIDALIKLHDCDVGLSK-LRVSFSKGFI 1761
            Q  +  V++ +NLNE+ ++P +LF LFGVYGDVQRVKILYNKK++ALIQ  D   A  A+++LN   +YGK +RV  SKH S+++P+ +  +   L KD++NS LHRFK+  S+  QNI+PP   LHL+ + +   EE+++ LF +   T         RKMAL+Q+ T++ AI ALI LH+ ++G ++ LRVSFSK  I
Sbjct:  317 QAGSGGVLLASNLNEEMVTPQSLFTLFGVYGDVQRVKILYNKKDSALIQMCDPSQAQLAMSHLNGQKMYGKIIRVTLSKHQSVALPR-DGLDDQGLTKDFTNSSLHRFKKPGSKNFQNIFPPSATLHLSNVLQDVTEEDLRLLFSNTGGTVKAFKFFQDRKMALIQMSTVEEAIQALIDLHNYNMGANQHLRVSFSKSTI 515          

HSP 2 Score: 117.087 bits (292), Expect = 1.929e-27
Identity = 70/227 (30.84%), Postives = 125/227 (55.07%), Query Frame = 1
Query:  157 NSGSGGKRVCVDKI--SRVLHIRNVSSDVTERDIANLAIPFGLISYLVLTRKTGQALMEMHHEESAQAMVDYYSKCLPHFYGKNIVIQFSRYETLSGSGMHP------EAETAVKGANEDVRKLCEGEPKLVLHVTIEN-WEGSRLGHLHFYKLFQRYGTICRIIVFVQNQSPQALIEFENEVAAHVAKLQLGGSNAFYG-RPVRIEFSTRKSLDIKHESDTGRDYT 807
            ++GS  K++ V++   SRV+HIR + ++  + ++  L +PFG ++ ++  R   QA +EM  EE+A  MV+YY+   PH     + +QFS ++ L             +A +AV+    +V+ +       VL + I+N +    L  L   ++F ++GT+ +II F +N   QAL+++ + V A  AKL L G N +     +RI+FS   +L++K+ +D  RDY+
Sbjct:   36 STGSDSKKLRVEEALPSRVIHIRRLPTEAMDAEVIALGLPFGKVTNILTLRGKNQAFLEMGTEEAAITMVNYYNTVPPHVRNSPVYVQFSNHKELKTDAASQRTQAVLQAVSAVQPPGSEVQDVLAAASSPVLRIIIDNMFYPVTLDVLQ--QIFSKFGTVMKIITFTKNNQFQALLQYSDPVQAQHAKLALDGQNIYNSCCTLRIDFSKLVNLNVKYNNDKSRDYS 260          
BLAST of Polypyrimidine tract-binding protein 1 vs. Planmine SMEST
Match: SMESG000022463.1 (SMESG000022463.1)

HSP 1 Score: 1103.58 bits (2853), Expect = 0.000e+0
Identity = 547/547 (100.00%), Postives = 547/547 (100.00%), Query Frame = 1
Query:  127 MSKRILDLNENSGSGGKRVCVDKISRVLHIRNVSSDVTERDIANLAIPFGLISYLVLTRKTGQALMEMHHEESAQAMVDYYSKCLPHFYGKNIVIQFSRYETLSGSGMHPEAETAVKGANEDVRKLCEGEPKLVLHVTIENWEGSRLGHLHFYKLFQRYGTICRIIVFVQNQSPQALIEFENEVAAHVAKLQLGGSNAFYGRPVRIEFSTRKSLDIKHESDTGRDYTISPVRKDELNSIPSFNSSYGMDDHGNANYSQHHDYPVSRQGGSMNNGQMTXXXXXXXXXXXXXXXSNNPNDTLPMLQSLAPTLTSLLNQSQMGSMNSRESSRMNYSNENLNNTSSSRKSQGNANSVVIVANLNEDRISPDALFILFGVYGDVQRVKILYNKKNTALIQFVDGEHAARAVTNLNNVNLYGKPMRVNFSKHTSISMPKPEEQNSVHLNKDYSNSRLHRFKRATSRTVQNIYPPGTVLHLAGLPESYEEEEIKNLFDDYAITKVKMINPNQRKMALVQLETIDMAIDALIKLHDCDVGLSKLRVSFSKGFIAN 1767
            MSKRILDLNENSGSGGKRVCVDKISRVLHIRNVSSDVTERDIANLAIPFGLISYLVLTRKTGQALMEMHHEESAQAMVDYYSKCLPHFYGKNIVIQFSRYETLSGSGMHPEAETAVKGANEDVRKLCEGEPKLVLHVTIENWEGSRLGHLHFYKLFQRYGTICRIIVFVQNQSPQALIEFENEVAAHVAKLQLGGSNAFYGRPVRIEFSTRKSLDIKHESDTGRDYTISPVRKDELNSIPSFNSSYGMDDHGNANYSQHHDYPVSRQGGSMNNGQMTAAEALAMLQPLLQQASNNPNDTLPMLQSLAPTLTSLLNQSQMGSMNSRESSRMNYSNENLNNTSSSRKSQGNANSVVIVANLNEDRISPDALFILFGVYGDVQRVKILYNKKNTALIQFVDGEHAARAVTNLNNVNLYGKPMRVNFSKHTSISMPKPEEQNSVHLNKDYSNSRLHRFKRATSRTVQNIYPPGTVLHLAGLPESYEEEEIKNLFDDYAITKVKMINPNQRKMALVQLETIDMAIDALIKLHDCDVGLSKLRVSFSKGFIAN
Sbjct:    1 MSKRILDLNENSGSGGKRVCVDKISRVLHIRNVSSDVTERDIANLAIPFGLISYLVLTRKTGQALMEMHHEESAQAMVDYYSKCLPHFYGKNIVIQFSRYETLSGSGMHPEAETAVKGANEDVRKLCEGEPKLVLHVTIENWEGSRLGHLHFYKLFQRYGTICRIIVFVQNQSPQALIEFENEVAAHVAKLQLGGSNAFYGRPVRIEFSTRKSLDIKHESDTGRDYTISPVRKDELNSIPSFNSSYGMDDHGNANYSQHHDYPVSRQGGSMNNGQMTAAEALAMLQPLLQQASNNPNDTLPMLQSLAPTLTSLLNQSQMGSMNSRESSRMNYSNENLNNTSSSRKSQGNANSVVIVANLNEDRISPDALFILFGVYGDVQRVKILYNKKNTALIQFVDGEHAARAVTNLNNVNLYGKPMRVNFSKHTSISMPKPEEQNSVHLNKDYSNSRLHRFKRATSRTVQNIYPPGTVLHLAGLPESYEEEEIKNLFDDYAITKVKMINPNQRKMALVQLETIDMAIDALIKLHDCDVGLSKLRVSFSKGFIAN 547          
BLAST of Polypyrimidine tract-binding protein 1 vs. Planmine SMEST
Match: SMESG000019377.1 (SMESG000019377.1)

HSP 1 Score: 385.185 bits (988), Expect = 2.744e-127
Identity = 225/531 (42.37%), Postives = 320/531 (60.26%), Query Frame = 1
Query:  199 SRVLHIRNVSSDVTERDIANLAIPFGLISYLVLTRKTGQALMEMHHEESAQAMVDYYSKCLPHFYGKNIVIQFSRYETL--SGSGMHPEAETAVKGANEDVRKLCEGEPKLVLHVTIENWEGSRLGHLHFYKLFQRYGTICRIIVFVQNQSPQALIEFENEVAAHVAKLQLGGSNAFYGRPV-RIEFSTRKSLDIKHESDTGRDYTISPVRKDELNSIPSFNSSYGMDDHGNANYSQHHDYPVSRQGGSMNNGQMTXXXXXXXXXXXXXXXSNNPNDTLPMLQSLAPTLTSLLNQSQMGSMNSRESSRMNYSNENLNNTSSSRKSQGNANSVVIVANLNEDRISPDALFILFGVYGDVQRVKILYNKKNTALIQFVDGEHAARAVTNLNNVNLYGKPMRVNFSKHTSISMPKP-----EEQNSVHLNKDYSNSRLHRFKRATSRTVQNIYPPGTVLHLAGLPESYEEEEIKNLFDD--YAITKVKMINPNQRKMALVQLETIDMAIDALIKLHDCDVGLSKLRVSFSKGFI 1761
            S+VLH+R++  DVTE +IA++A PFG ISY+VLTRKTGQAL+EM  +E A+ M +YY +  PH   K   IQ+S + TL  + S MHPEAE AV   N+    + + +   VL + +++W   ++ +LH +K+FQ YG + RI+++V     Q  I++    +A VAK    G   F    V R+ FS R+SLDI  E D  RD+   PV   EL +I   N   G+         +   +   R+   + +   T A    +L       + +P+D +P+L+S+AP +   L+   +     RE SR +  N+N   T    K+    + ++IV+NLNE +I PDALF LFG YGDV RVKI+YN+KNTALIQF   EHA RA+  LN VNLYGKP+ VNFSKH  IS   P     EE     L+++Y++S+LHRFKRA SR   NIY P  VLH+AGL +   EE+I+ LF D  + + K+++ N + +KMALV+L +++ AI+ALI+LHD D+  S LRVSFSK ++
Sbjct:   29 SKVLHVRSLPDDVTEMEIASIATPFGHISYMVLTRKTGQALLEMETKEIAETMFEYYQRHSPHLRNKRCFIQYSHHGTLQSTDSSMHPEAENAVSTTNQICDSMAKEQAGPVLRLVVDDWNHEKITNLHLFKIFQHYGILERIVIYVSKGIVQGFIQYSEPFSAKVAKALTNGLCVFPRCCVLRVNFSNRQSLDISREDDLVRDFVRHPVSPQELKNI-HVNIGGGIP-------KETERFRDIREFRELRDPIDTLAALQPLLTHA----ATHPDDAMPLLRSIAPAIRGFLDSQDLLP---REISRHD-RNDNFGRTHFGEKT----SPLLIVSNLNEAKIHPDALFKLFGCYGDVTRVKIMYNRKNTALIQFATEEHAQRALQFLNGVNLYGKPLHVNFSKHDRISHRAPIAGSEEEATGDLLHREYNDSKLHRFKRAQSRNHSNIYEPSKVLHVAGLIDDVSEEDIEALFTDNKFRVKKIRVFNSSGKKMALVELSSVESAIEALIELHDYDLCGSNLRVSFSKQYL 539          
BLAST of Polypyrimidine tract-binding protein 1 vs. Planmine SMEST
Match: SMESG000019377.1 (SMESG000019377.1)

HSP 1 Score: 385.185 bits (988), Expect = 3.151e-127
Identity = 225/531 (42.37%), Postives = 320/531 (60.26%), Query Frame = 1
Query:  199 SRVLHIRNVSSDVTERDIANLAIPFGLISYLVLTRKTGQALMEMHHEESAQAMVDYYSKCLPHFYGKNIVIQFSRYETL--SGSGMHPEAETAVKGANEDVRKLCEGEPKLVLHVTIENWEGSRLGHLHFYKLFQRYGTICRIIVFVQNQSPQALIEFENEVAAHVAKLQLGGSNAFYGRPV-RIEFSTRKSLDIKHESDTGRDYTISPVRKDELNSIPSFNSSYGMDDHGNANYSQHHDYPVSRQGGSMNNGQMTXXXXXXXXXXXXXXXSNNPNDTLPMLQSLAPTLTSLLNQSQMGSMNSRESSRMNYSNENLNNTSSSRKSQGNANSVVIVANLNEDRISPDALFILFGVYGDVQRVKILYNKKNTALIQFVDGEHAARAVTNLNNVNLYGKPMRVNFSKHTSISMPKP-----EEQNSVHLNKDYSNSRLHRFKRATSRTVQNIYPPGTVLHLAGLPESYEEEEIKNLFDD--YAITKVKMINPNQRKMALVQLETIDMAIDALIKLHDCDVGLSKLRVSFSKGFI 1761
            S+VLH+R++  DVTE +IA++A PFG ISY+VLTRKTGQAL+EM  +E A+ M +YY +  PH   K   IQ+S + TL  + S MHPEAE AV   N+    + + +   VL + +++W   ++ +LH +K+FQ YG + RI+++V     Q  I++    +A VAK    G   F    V R+ FS R+SLDI  E D  RD+   PV   EL +I   N   G+         +   +   R+   + +   T A    +L       + +P+D +P+L+S+AP +   L+   +     RE SR +  N+N   T    K+    + ++IV+NLNE +I PDALF LFG YGDV RVKI+YN+KNTALIQF   EHA RA+  LN VNLYGKP+ VNFSKH  IS   P     EE     L+++Y++S+LHRFKRA SR   NIY P  VLH+AGL +   EE+I+ LF D  + + K+++ N + +KMALV+L +++ AI+ALI+LHD D+  S LRVSFSK ++
Sbjct:   30 SKVLHVRSLPDDVTEMEIASIATPFGHISYMVLTRKTGQALLEMETKEIAETMFEYYQRHSPHLRNKRCFIQYSHHGTLQSTDSSMHPEAENAVSTTNQICDSMAKEQAGPVLRLVVDDWNHEKITNLHLFKIFQHYGILERIVIYVSKGIVQGFIQYSEPFSAKVAKALTNGLCVFPRCCVLRVNFSNRQSLDISREDDLVRDFVRHPVSPQELKNI-HVNIGGGIP-------KETERFRDIREFRELRDPIDTLAALQPLLTHA----ATHPDDAMPLLRSIAPAIRGFLDSQDLLP---REISRHD-RNDNFGRTHFGEKT----SPLLIVSNLNEAKIHPDALFKLFGCYGDVTRVKIMYNRKNTALIQFATEEHAQRALQFLNGVNLYGKPLHVNFSKHDRISHRAPIAGSEEEATGDLLHREYNDSKLHRFKRAQSRNHSNIYEPSKVLHVAGLIDDVSEEDIEALFTDNKFRVKKIRVFNSSGKKMALVELSSVESAIEALIELHDYDLCGSNLRVSFSKQYL 540          
BLAST of Polypyrimidine tract-binding protein 1 vs. Planmine SMEST
Match: SMESG000018057.1 (SMESG000018057.1)

HSP 1 Score: 306.22 bits (783), Expect = 9.047e-97
Identity = 191/537 (35.57%), Postives = 297/537 (55.31%), Query Frame = 1
Query:  190 DKISRVLHIRNVSSDVTERDIANLAIPFGLISYLVLTRKTGQALMEMHHEESAQAMVDYYSKCLPHFYGKNIVIQFSRYETLSGSGMHPEAETAVKGANEDVRKLC------EGEPKLVLHVTIENWEGSRLGHLHFYKLFQRYGTICRIIVFVQNQSPQALIEFENEVAAHVAKLQLGGSNAFYG-RPVRIEFSTRKS-LDIKHESDTGRDYTISPVRKDELNSIPSFNSSYGMDDHGNANYSQHHDYPVSRQGGSMNNGQMTXXXXXXXXXXXXXXXSNNPNDTL-PMLQSLAPTLTSLLNQSQMGSMNSRESSRMNY---SNENLNNTSSSRKSQGNANSVVIVANLNEDRISPDALFILFGVYGDVQRVKILYNKKNTALIQFVDGEHAARAVTNLNNVNLYGKPMRVNFSKHTSISMPKPEEQNSVHLNKDYSNSRLHRFKRATSRTVQNIYPPGTVLHLAGLPESYEEEEIKNL--FDDYAITKVKMINPNQRKMALVQLETIDMAIDALIKLHDCDVG-LSKLRVSFSKG 1755
            +K SRV+HIRNV  +V +  +A LA+PFG I  +V  RK  QAL++M     A  M DY+++ +P  YGK++ IQFS+++ L     +   +  V+ ANE  +          G    +L + I+N     + HL FYK+F R+G I RI+ F +N     L+EF + +++HVA+LQL G+N       +RI+FS     L ++ +SD  RDY  SP+ + EL  +                    + +P+   G SM+  +    + ++ +   L   ++     L P     A +L +  NQ     MN R + + N+   SN++ N   +      N NSVV+V NLN ++ +PDALF LFGVYGDV RVK+++NKKNTAL+QF + + A  A+ NL+   L+GK M ++ SK   I +P  +  +   L KDYSNS LHRFK+  S+  QNI+PP  V+HL+ +P +  E ++ ++     Y + K K + PN +KMAL++L +++ AI  LI+ H+  +   + LR+SFSK 
Sbjct:   24 EKPSRVIHIRNVPQEVDDTSVAMLAVPFGYIDNIVFVRKNNQALIQMRELNEAIEMADYFNQYVPLMYGKHLFIQFSKHQQLDLRNNNSNIDKLVQSANEKRKHYLINWANNTGGASEILRILIDNAPNLIINHLVFYKIFSRFGQIIRIVSFTKNNQHHGLVEFASTLSSHVAQLQLNGANLLGDCGTMRIDFSKNPGPLQVQRQSDKVRDYMESPLNRTELQELEG----------------PQYSFPLFAVGRSMSMARGNDQQFMSNITAQLSAMASQTGVELTPAAAMAAASLMAACNQ-----MNHRTADQSNWGFGSNQSQNAMFNPNSGIENGNSVVLVTNLNAEKSNPDALFTLFGVYGDVMRVKVMFNKKNTALVQFANHQQAMTAIRNLDACFLWGKQMHLHVSKTNVIQLPMEDANHG--LTKDYSNSTLHRFKKPNSKNYQNIFPPSAVVHLSNIPPTTSEGDLSDMIRIAGYEVKKFKFL-PNDKKMALLELNSVEDAIHVLIEFHNRKLSEKNHLRISFSKA 536          
BLAST of Polypyrimidine tract-binding protein 1 vs. Planmine SMEST
Match: SMESG000018057.1 (SMESG000018057.1)

HSP 1 Score: 306.22 bits (783), Expect = 1.732e-96
Identity = 193/536 (36.01%), Postives = 295/536 (55.04%), Query Frame = 1
Query:  190 DKISRVLHIRNVSSDVTERDIANLAIPFGLISYLVLTRKTGQALMEMHHEESAQAMVDYYSKCLPHFYGKNIVIQFSRYETLSGSGMHPEAETAVKGANEDVRKLC------EGEPKLVLHVTIENWEGSRLGHLHFYKLFQRYGTICRIIVFVQNQSPQALIEFENEVAAHVAKLQLGGSNAFYG-RPVRIEFSTRKS-LDIKHESDTGRDYTISPVRKDELNSIPSFNSSYGMDDHGNANYSQHHDYPVSRQGGSMNNGQMTXXXXXXXXXXXXXXXSNNPNDTLPMLQSLAPTLTSLLNQSQMGSMNSRESSRMNY---SNENLNNTSSSRKSQGNANSVVIVANLNEDRISPDALFILFGVYGDVQRVKILYNKKNTALIQFVDGEHAARAVTNLNNVNLYGKPMRVNFSKHTSISMPKPEEQNSVHLNKDYSNSRLHRFKRATSRTVQNIYPPGTVLHLAGLPESYEEEEIKNL--FDDYAITKVKMINPNQRKMALVQLETIDMAIDALIKLHDCDVG-LSKLRVSFSKG 1755
            +K SRV+HIRNV  +V +  +A LA+PFG I  +V  RK  QAL++M     A  M DY+++ +P  YGK++ IQFS+++ L     +   +  V+ ANE  +          G    +L + I+N     + HL FYK+F R+G I RI+ F +N     L+EF + +++HVA+LQL G+N       +RI+FS     L ++ +SD  RDY  SP+ + EL  +                    + +P+   G SM+  +    +   M   L   AS    +  P     A +L +  NQ     MN R + + N+   SN++ N   +      N NSVV+V NLN ++ +PDALF LFGVYGDV RVK+++NKKNTAL+QF + + A  A+ NL+   L+GK M ++ SK   I +P  +  +   L KDYSNS LHRFK+  S+  QNI+PP  V+HL+ +P +  E ++ ++     Y + K K + PN +KMAL++L +++ AI  LI+ H+  +   + LR+SFSK 
Sbjct:   50 EKPSRVIHIRNVPQEVDDTSVAMLAVPFGYIDNIVFVRKNNQALIQMRELNEAIEMADYFNQYVPLMYGKHLFIQFSKHQQLDLRNNNSNIDKLVQSANEKRKHYLINWANNTGGASEILRILIDNAPNLIINHLVFYKIFSRFGQIIRIVSFTKNNQHHGLVEFASTLSSHVAQLQLNGANLLGDCGTMRIDFSKNPGPLQVQRQSDKVRDYMESPLNRTELQELEG----------------PQYSFPLFAVGRSMSMAR--GNDQQFMTAQLSAMASQTGVELTPAAAMAAASLMAACNQ-----MNHRTADQSNWGFGSNQSQNAMFNPNSGIENGNSVVLVTNLNAEKSNPDALFTLFGVYGDVMRVKVMFNKKNTALVQFANHQQAMTAIRNLDACFLWGKQMHLHVSKTNVIQLPMEDANHG--LTKDYSNSTLHRFKKPNSKNYQNIFPPSAVVHLSNIPPTTSEGDLSDMIRIAGYEVKKFKFL-PNDKKMALLELNSVEDAIHVLIEFHNRKLSEKNHLRISFSKA 559          
The following BLAST results are available for this feature:
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PTBP11.725e-8634.62polypyrimidine tract binding protein 1 [Source:HGN... [more]
PTBP13.617e-8634.62polypyrimidine tract binding protein 1 [Source:HGN... [more]
PTBP14.948e-8533.33polypyrimidine tract binding protein 1 [Source:HGN... [more]
PTBP16.331e-5550.00polypyrimidine tract binding protein 1 [Source:HGN... [more]
PTBP17.511e-5550.00polypyrimidine tract binding protein 1 [Source:HGN... [more]
back to top
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ptb-17.661e-5148.08PTB (HnRNP) homolog; Putative RNA-binding protein ... [more]
ptb-17.661e-5148.08PTB (HnRNP) homolog; Putative RNA-binding protein ... [more]
ptb-19.520e-5048.08PTB (HnRNP) homolog; Putative RNA-binding protein ... [more]
hrpl-17.646e-1521.56Heterogeneous nuclear RibonucleoProtein (HnRNP) L ... [more]
hrpl-17.646e-1521.56Heterogeneous nuclear RibonucleoProtein (HnRNP) L ... [more]
back to top
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
heph1.282e-8032.99gene:FBgn0011224 transcript:FBtr0112865[more]
heph2.508e-8032.99gene:FBgn0011224 transcript:FBtr0300268[more]
heph2.508e-8032.99gene:FBgn0011224 transcript:FBtr0300269[more]
heph2.508e-8032.99gene:FBgn0011224 transcript:FBtr0300267[more]
heph2.508e-8032.99gene:FBgn0011224 transcript:FBtr0085880[more]
back to top
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ptbp1a7.105e-5348.99polypyrimidine tract binding protein 1a [Source:ZF... [more]
ptbp1b6.804e-5249.23polypyrimidine tract binding protein 1b [Source:ZF... [more]
ptbp1b7.120e-5249.23polypyrimidine tract binding protein 1b [Source:ZF... [more]
ptbp38.632e-5250.51polypyrimidine tract binding protein 3 [Source:ZFI... [more]
ptbp38.632e-5250.51polypyrimidine tract binding protein 3 [Source:ZFI... [more]
back to top
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ptbp12.630e-5449.75polypyrimidine tract binding protein 1 [Source:NCB... [more]
htr42.030e-5148.995-hydroxytryptamine (serotonin) receptor 4, G prot... [more]
taco11.955e-4948.24translational activator of mitochondrially encoded... [more]
taco12.070e-4948.24translational activator of mitochondrially encoded... [more]
taco12.107e-4948.24translational activator of mitochondrially encoded... [more]
back to top
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ptbp18.747e-8634.07polypyrimidine tract binding protein 1 [Source:MGI... [more]
Ptbp12.235e-5449.00polypyrimidine tract binding protein 1 [Source:MGI... [more]
Ptbp15.204e-5449.00polypyrimidine tract binding protein 1 [Source:MGI... [more]
Ptbp25.260e-5249.75polypyrimidine tract binding protein 2 [Source:MGI... [more]
Ptbp38.686e-5248.99polypyrimidine tract binding protein 3 [Source:MGI... [more]
back to top
BLAST of Polypyrimidine tract-binding protein 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8WN55|PTBP1_BOVIN1.537e-5450.50Polypyrimidine tract-binding protein 1 OS=Bos taur... [more]
sp|P26599|PTBP1_HUMAN3.040e-5450.00Polypyrimidine tract-binding protein 1 OS=Homo sap... [more]
sp|Q29099|PTBP1_PIG2.471e-5350.50Polypyrimidine tract-binding protein 1 OS=Sus scro... [more]
sp|Q00438|PTBP1_RAT1.372e-5248.50Polypyrimidine tract-binding protein 1 OS=Rattus n... [more]
sp|Q9UKA9|PTBP2_HUMAN1.516e-5048.22Polypyrimidine tract-binding protein 2 OS=Homo sap... [more]
back to top
BLAST of Polypyrimidine tract-binding protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3Q0KMW91.056e-10937.94Polypyrimidine tract binding protein, putative OS=... [more]
A0A183QYD01.612e-10737.59Uncharacterized protein OS=Schistosoma rodhaini OX... [more]
A0A4Z2DXT82.104e-10436.35Polypyrimidine tract-binding protein isoform 2 OS=... [more]
C1LLD52.900e-10436.35Polypyrimidine tract-binding protein 1 OS=Schistos... [more]
C1LLD83.490e-10435.92Polypyrimidine tract-binding protein 1 OS=Schistos... [more]
back to top
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ptbp2b9.024e-5147.94polypyrimidine tract-binding protein 2-like [Sourc... [more]
ptbp2b9.479e-5147.94polypyrimidine tract-binding protein 2-like [Sourc... [more]
ptbp31.266e-5048.99polypyrimidine tract binding protein 3 [Source:ZFI... [more]
ptbp1b2.314e-5046.97polypyrimidine tract binding protein 1 [Source:NCB... [more]
ptbp1b6.477e-5046.97polypyrimidine tract binding protein 1 [Source:NCB... [more]
back to top
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000008413.11.170e-2437.86pep scaffold:Pmarinus_7.0:GL478562:177533:180128:-... [more]
ENSPMAT00000006507.11.006e-2332.57pep scaffold:Pmarinus_7.0:GL480554:3468:10153:1 ge... [more]
HNRNPLL8.645e-2223.41heterogeneous nuclear ribonucleoprotein L like [So... [more]
ENSPMAT00000006509.11.728e-1832.78pep scaffold:Pmarinus_7.0:GL480554:3489:6552:1 gen... [more]
HNRNPLL2.171e-1430.92heterogeneous nuclear ribonucleoprotein L like [So... [more]
back to top
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
MSL16.648e-633.33U2B component of U2 snRNP; involved in splicing, b... [more]
back to top
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO439955.866e-5551.31Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO262323.982e-3346.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO391193.567e-1524.88Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO355375.918e-1127.80Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO355364.731e-922.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Polypyrimidine tract-binding protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ptbp12.277e-7733.09polypyrimidine tract binding protein 1 [Source:NCB... [more]
ptbp14.996e-6430.76polypyrimidine tract binding protein 1 [Source:NCB... [more]
ENSORLT00000042697.12.924e-5147.98polypyrimidine tract-binding protein 1 [Source:NCB... [more]
ENSORLT00000036879.15.964e-5147.98polypyrimidine tract-binding protein 1 [Source:NCB... [more]
PTBP21.230e-5046.50polypyrimidine tract binding protein 2 [Source:NCB... [more]
back to top
BLAST of Polypyrimidine tract-binding protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000022463.10.000e+0100.00SMESG000022463.1[more]
SMESG000019377.12.744e-12742.37SMESG000019377.1[more]
SMESG000019377.13.151e-12742.37SMESG000019377.1[more]
SMESG000018057.19.047e-9735.57SMESG000018057.1[more]
SMESG000018057.11.732e-9636.01SMESG000018057.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027927 ID=SMED30027927|Name=Polypyrimidine tract-binding protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=1794bp
GTCCGTTGTTTAAATTTACTGATATTTGTTATTTATTTGTGAACCAATAA
ATTATTTAAAGTCCGTTGTTTAAATTTAGTTTCTAATATTTATAAATTTT
ACGTAGTTGCCATTTTATTACCACAAATGTCGAAGCGAATTTTGGACCTG
AATGAAAATTCTGGAAGTGGTGGGAAACGAGTATGCGTTGATAAAATTTC
TAGAGTTTTACATATTAGAAACGTTTCAAGTGATGTTACTGAAAGAGACA
TAGCTAATCTTGCAATTCCATTTGGTTTGATAAGCTATTTAGTATTAACC
AGGAAAACTGGTCAAGCTTTAATGGAAATGCATCATGAAGAATCTGCTCA
AGCTATGGTTGACTACTATTCTAAATGTCTTCCACATTTTTATGGAAAGA
ATATTGTAATTCAATTTTCACGATATGAAACATTATCAGGCAGTGGTATG
CATCCGGAAGCTGAAACTGCTGTTAAAGGTGCAAATGAGGATGTTAGAAA
ATTATGTGAAGGTGAACCCAAACTTGTATTACATGTCACAATTGAAAATT
GGGAAGGCAGTCGTTTAGGACATCTACATTTTTATAAACTCTTTCAAAGA
TATGGTACTATCTGCCGTATTATAGTCTTTGTTCAAAACCAAAGTCCACA
AGCTTTGATAGAATTTGAAAATGAGGTTGCAGCTCATGTAGCTAAATTAC
AATTAGGGGGTTCTAACGCATTCTATGGTAGGCCAGTTCGAATTGAATTT
TCTACAAGAAAATCACTTGATATAAAGCATGAAAGTGATACCGGGCGGGA
TTATACAATAAGCCCAGTTAGAAAAGACGAATTAAACAGTATTCCTAGTT
TCAACAGCAGTTATGGAATGGATGATCATGGTAATGCAAACTATAGTCAG
CATCACGACTATCCAGTTTCAAGACAAGGAGGATCAATGAACAATGGTCA
AATGACGGCTGCAGAAGCTTTAGCTATGCTGCAACCATTACTTCAACAAG
CATCTAATAATCCAAATGATACATTACCTATGTTGCAAAGCTTAGCACCA
ACTTTAACAAGTCTTCTAAATCAAAGTCAAATGGGCTCCATGAATTCACG
TGAAAGTTCTAGAATGAATTATTCAAACGAAAATTTAAACAATACCAGCA
GTAGTAGAAAATCTCAAGGAAATGCTAATTCTGTGGTTATTGTGGCTAAT
CTTAATGAGGATCGGATATCACCAGATGCATTATTTATACTCTTTGGAGT
TTATGGCGATGTTCAACGTGTTAAAATTCTCTACAATAAAAAGAATACTG
CTCTCATTCAATTTGTTGATGGTGAACATGCTGCTAGAGCCGTGACAAAT
TTAAACAATGTTAATTTATATGGCAAGCCAATGCGGGTTAATTTCTCTAA
GCATACTAGCATCAGCATGCCTAAACCCGAAGAACAAAATTCTGTTCACT
TGAACAAAGATTACTCAAATAGTCGATTGCATCGATTCAAACGAGCAACT
TCACGGACTGTTCAAAATATCTATCCTCCTGGAACTGTTCTTCATCTCGC
TGGATTGCCTGAGTCTTACGAGGAAGAAGAAATTAAAAATCTTTTTGATG
ATTATGCGATTACAAAAGTCAAAATGATTAACCCAAATCAAAGGAAAATG
GCTCTTGTTCAGTTAGAAACAATCGATATGGCTATTGATGCTCTAATTAA
ATTGCATGATTGTGATGTTGGATTAAGCAAACTTCGTGTGAGTTTCAGTA
AAGGGTTTATTGCCAATTAAGTTGAATTAGCATTTTAGTTCATG
back to top

protein sequence of SMED30027927-orf-1

>SMED30027927-orf-1 ID=SMED30027927-orf-1|Name=SMED30027927-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=548bp
MSKRILDLNENSGSGGKRVCVDKISRVLHIRNVSSDVTERDIANLAIPFG
LISYLVLTRKTGQALMEMHHEESAQAMVDYYSKCLPHFYGKNIVIQFSRY
ETLSGSGMHPEAETAVKGANEDVRKLCEGEPKLVLHVTIENWEGSRLGHL
HFYKLFQRYGTICRIIVFVQNQSPQALIEFENEVAAHVAKLQLGGSNAFY
GRPVRIEFSTRKSLDIKHESDTGRDYTISPVRKDELNSIPSFNSSYGMDD
HGNANYSQHHDYPVSRQGGSMNNGQMTAAEALAMLQPLLQQASNNPNDTL
PMLQSLAPTLTSLLNQSQMGSMNSRESSRMNYSNENLNNTSSSRKSQGNA
NSVVIVANLNEDRISPDALFILFGVYGDVQRVKILYNKKNTALIQFVDGE
HAARAVTNLNNVNLYGKPMRVNFSKHTSISMPKPEEQNSVHLNKDYSNSR
LHRFKRATSRTVQNIYPPGTVLHLAGLPESYEEEEIKNLFDDYAITKVKM
INPNQRKMALVQLETIDMAIDALIKLHDCDVGLSKLRVSFSKGFIAN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR006536HnRNP-L/PTB
IPR035979RBD_domain_sf
IPR000504RRM_dom
IPR012677Nucleotide-bd_a/b_plait_sf
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0000166nucleotide binding
GO:0003723RNA binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
Vocabulary: biological process
TermDefinition
GO:0006397mRNA processing
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000504RNA recognition motif domainSMARTSM00360rrm1_1coord: 471..539
e-value: 4.0E-7
score: 39.7
coord: 27..96
e-value: 0.0016
score: 27.7
coord: 353..422
e-value: 5.4E-13
score: 59.2
coord: 134..207
e-value: 0.15
score: 14.0
IPR000504RNA recognition motif domainPFAMPF00076RRM_1coord: 30..83
e-value: 1.1E-4
score: 21.9
coord: 475..529
e-value: 1.2E-4
score: 21.8
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 352..426
score: 14.59
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 26..100
score: 9.03
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 470..543
score: 9.559
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 135..211
score: 8.552
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 348..447
e-value: 7.3E-28
score: 98.7
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 21..106
e-value: 6.6E-20
score: 72.7
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 459..543
e-value: 5.1E-14
score: 54.0
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 132..235
e-value: 3.4E-17
score: 64.4
NoneNo IPR availablePFAMPF13893RRM_5coord: 140..214
e-value: 0.0012
score: 18.5
coord: 342..449
e-value: 8.5E-31
score: 106.2
NoneNo IPR availablePANTHERPTHR15592MATRIN 3/NUCLEAR PROTEIN 220-RELATEDcoord: 14..542
NoneNo IPR availablePANTHERPTHR15592:SF27HEPHAESTUS, ISOFORM Ycoord: 14..542
NoneNo IPR availableCDDcd12423RRM3_PTBP1_likecoord: 353..426
e-value: 6.27374E-38
score: 131.997
NoneNo IPR availableCDDcd12421RRM1_PTBP1_hnRNPL_likecoord: 27..100
e-value: 5.61805E-23
score: 90.7189
IPR006536HnRNP-L/PTBTIGRFAMTIGR01649TIGR01649coord: 25..542
e-value: 3.1E-105
score: 350.9
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 152..224
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 443..541
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 25..104
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 338..435