Heat shock cognate 70 kDa protein

Overview
NameHeat shock cognate 70 kDa protein
Smed IDSMED30027920
Length (bp)2167
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Heat shock cognate 70 kDa protein (SMED30027920) t-SNE clustered cells

Violin plots show distribution of expression levels for Heat shock cognate 70 kDa protein (SMED30027920) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Heat shock cognate 70 kDa protein (SMED30027920) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Heat shock cognate 70 kDa protein (SMED30027920) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Human
Match: HSPA8 (heat shock protein family A (Hsp70) member 8 [Source:HGNC Symbol;Acc:HGNC:5241])

HSP 1 Score: 993.801 bits (2568), Expect = 0.000e+0
Identity = 507/608 (83.39%), Postives = 563/608 (92.60%), Query Frame = 2
Query:  188 APAVGIDLGTTFSCVGVFQHGKVEIIGNDQGNRTTPSFVAFNDTERLIGDAAKNQAAMNPANTVFDAKRLIGRKFDEPSVQADMKHFSFNVVNVEGRPKIQVEFKGESKTFSAEEISSMVLLKMKETAEAYIGKEVKNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKSSEEKNVLIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRMVDHFIQEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSAQANIEVDSLFEGLDFYTSITRARFEELCADLFRSTLDPVEKSLRDAKMDKNAIHEIVLVGGSTRIPKVQKLLQDYFNGKELNKSINPDEXXXXXXXXXXXILSGDKSXXXXXXXXXXXXXXXXGIETAGGVMTALIKRNSTIPTKQTQTFSTYADNQPGVLIQVFEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKEDIERMVNDAXXXXXXXXXXXXRISSKNALESYAFQVKSAMEDEKLKDKFTAEEKQTVTDKCSEIVSWLDKNQSASKDEYEHHMKELEGVCKPVMSKIY 2011
             PAVGIDLGTT+SCVGVFQHGKVEII NDQGNRTTPS+VAF DTERLIGDAAKNQ AMNP NTVFDAKRLIGR+FD+  VQ+DMKH+ F VVN  GRPK+QVE+KGE+K+F  EE+SSMVL KMKE AEAY+GK V NAVVTVPAYFNDSQRQATKDAG IAGLNVLRIINEPTAAAIAYGLDKK   E+NVLIFDLGGGTFDVSIL+I+DGIFEVKSTAGDTHLGGEDFDNRMV+HFI EFKRKHKKDISENKRAVRRLRTACERAKRTLSSS QA+IE+DSL+EG+DFYTSITRARFEEL ADLFR TLDPVEK+LRDAK+DK+ IH+IVLVGGSTRIPK+QKLLQD+FNGKELNKSINPDEAVAYGAAVQAAILSGDKS+ VQDLLLLDV PLSLGIETAGGVMT LIKRN+TIPTKQTQTF+TY+DNQPGVLIQV+EGERAMTKDNNLLGKFEL+GIPPAPRGVPQIEVTFDIDANGILNVSAV+K TGKENKITITNDKGRLSKEDIERMV +AEKYK EDE+Q++++SSKN+LESYAF +K+ +EDEKL+ K   E+KQ + DKC+EI++WLDKNQ+A K+E+EH  KELE VC P+++K+Y
Sbjct:    4 GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLQGKINDEDKQKILDKCNEIINWLDKNQTAEKEEFEHQQKELEKVCNPIITKLY 611          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Human
Match: HSPA8 (heat shock protein family A (Hsp70) member 8 [Source:HGNC Symbol;Acc:HGNC:5241])

HSP 1 Score: 993.801 bits (2568), Expect = 0.000e+0
Identity = 507/608 (83.39%), Postives = 563/608 (92.60%), Query Frame = 2
Query:  188 APAVGIDLGTTFSCVGVFQHGKVEIIGNDQGNRTTPSFVAFNDTERLIGDAAKNQAAMNPANTVFDAKRLIGRKFDEPSVQADMKHFSFNVVNVEGRPKIQVEFKGESKTFSAEEISSMVLLKMKETAEAYIGKEVKNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKSSEEKNVLIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRMVDHFIQEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSAQANIEVDSLFEGLDFYTSITRARFEELCADLFRSTLDPVEKSLRDAKMDKNAIHEIVLVGGSTRIPKVQKLLQDYFNGKELNKSINPDEXXXXXXXXXXXILSGDKSXXXXXXXXXXXXXXXXGIETAGGVMTALIKRNSTIPTKQTQTFSTYADNQPGVLIQVFEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKEDIERMVNDAXXXXXXXXXXXXRISSKNALESYAFQVKSAMEDEKLKDKFTAEEKQTVTDKCSEIVSWLDKNQSASKDEYEHHMKELEGVCKPVMSKIY 2011
             PAVGIDLGTT+SCVGVFQHGKVEII NDQGNRTTPS+VAF DTERLIGDAAKNQ AMNP NTVFDAKRLIGR+FD+  VQ+DMKH+ F VVN  GRPK+QVE+KGE+K+F  EE+SSMVL KMKE AEAY+GK V NAVVTVPAYFNDSQRQATKDAG IAGLNVLRIINEPTAAAIAYGLDKK   E+NVLIFDLGGGTFDVSIL+I+DGIFEVKSTAGDTHLGGEDFDNRMV+HFI EFKRKHKKDISENKRAVRRLRTACERAKRTLSSS QA+IE+DSL+EG+DFYTSITRARFEEL ADLFR TLDPVEK+LRDAK+DK+ IH+IVLVGGSTRIPK+QKLLQD+FNGKELNKSINPDEAVAYGAAVQAAILSGDKS+ VQDLLLLDV PLSLGIETAGGVMT LIKRN+TIPTKQTQTF+TY+DNQPGVLIQV+EGERAMTKDNNLLGKFEL+GIPPAPRGVPQIEVTFDIDANGILNVSAV+K TGKENKITITNDKGRLSKEDIERMV +AEKYK EDE+Q++++SSKN+LESYAF +K+ +EDEKL+ K   E+KQ + DKC+EI++WLDKNQ+A K+E+EH  KELE VC P+++K+Y
Sbjct:    4 GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLQGKINDEDKQKILDKCNEIINWLDKNQTAEKEEFEHQQKELEKVCNPIITKLY 611          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Human
Match: HSPA8 (heat shock protein family A (Hsp70) member 8 [Source:HGNC Symbol;Acc:HGNC:5241])

HSP 1 Score: 993.801 bits (2568), Expect = 0.000e+0
Identity = 507/608 (83.39%), Postives = 563/608 (92.60%), Query Frame = 2
Query:  188 APAVGIDLGTTFSCVGVFQHGKVEIIGNDQGNRTTPSFVAFNDTERLIGDAAKNQAAMNPANTVFDAKRLIGRKFDEPSVQADMKHFSFNVVNVEGRPKIQVEFKGESKTFSAEEISSMVLLKMKETAEAYIGKEVKNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKSSEEKNVLIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRMVDHFIQEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSAQANIEVDSLFEGLDFYTSITRARFEELCADLFRSTLDPVEKSLRDAKMDKNAIHEIVLVGGSTRIPKVQKLLQDYFNGKELNKSINPDEXXXXXXXXXXXILSGDKSXXXXXXXXXXXXXXXXGIETAGGVMTALIKRNSTIPTKQTQTFSTYADNQPGVLIQVFEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKEDIERMVNDAXXXXXXXXXXXXRISSKNALESYAFQVKSAMEDEKLKDKFTAEEKQTVTDKCSEIVSWLDKNQSASKDEYEHHMKELEGVCKPVMSKIY 2011
             PAVGIDLGTT+SCVGVFQHGKVEII NDQGNRTTPS+VAF DTERLIGDAAKNQ AMNP NTVFDAKRLIGR+FD+  VQ+DMKH+ F VVN  GRPK+QVE+KGE+K+F  EE+SSMVL KMKE AEAY+GK V NAVVTVPAYFNDSQRQATKDAG IAGLNVLRIINEPTAAAIAYGLDKK   E+NVLIFDLGGGTFDVSIL+I+DGIFEVKSTAGDTHLGGEDFDNRMV+HFI EFKRKHKKDISENKRAVRRLRTACERAKRTLSSS QA+IE+DSL+EG+DFYTSITRARFEEL ADLFR TLDPVEK+LRDAK+DK+ IH+IVLVGGSTRIPK+QKLLQD+FNGKELNKSINPDEAVAYGAAVQAAILSGDKS+ VQDLLLLDV PLSLGIETAGGVMT LIKRN+TIPTKQTQTF+TY+DNQPGVLIQV+EGERAMTKDNNLLGKFEL+GIPPAPRGVPQIEVTFDIDANGILNVSAV+K TGKENKITITNDKGRLSKEDIERMV +AEKYK EDE+Q++++SSKN+LESYAF +K+ +EDEKL+ K   E+KQ + DKC+EI++WLDKNQ+A K+E+EH  KELE VC P+++K+Y
Sbjct:    4 GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLQGKINDEDKQKILDKCNEIINWLDKNQTAEKEEFEHQQKELEKVCNPIITKLY 611          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Human
Match: HSPA1B (heat shock protein family A (Hsp70) member 1B [Source:HGNC Symbol;Acc:HGNC:5233])

HSP 1 Score: 961.059 bits (2483), Expect = 0.000e+0
Identity = 492/608 (80.92%), Postives = 552/608 (90.79%), Query Frame = 2
Query:  188 APAVGIDLGTTFSCVGVFQHGKVEIIGNDQGNRTTPSFVAFNDTERLIGDAAKNQAAMNPANTVFDAKRLIGRKFDEPSVQADMKHFSFNVVNVEGRPKIQVEFKGESKTFSAEEISSMVLLKMKETAEAYIGKEVKNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKSSEEKNVLIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRMVDHFIQEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSAQANIEVDSLFEGLDFYTSITRARFEELCADLFRSTLDPVEKSLRDAKMDKNAIHEIVLVGGSTRIPKVQKLLQDYFNGKELNKSINPDEXXXXXXXXXXXILSGDKSXXXXXXXXXXXXXXXXGIETAGGVMTALIKRNSTIPTKQTQTFSTYADNQPGVLIQVFEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKEDIERMVNDAXXXXXXXXXXXXRISSKNALESYAFQVKSAMEDEKLKDKFTAEEKQTVTDKCSEIVSWLDKNQSASKDEYEHHMKELEGVCKPVMSKIY 2011
            A A+GIDLGTT+SCVGVFQHGKVEII NDQGNRTTPS+VAF DTERLIGDAAKNQ A+NP NTVFDAKRLIGRKF +P VQ+DMKH+ F V+N   +PK+QV +KGE+K F  EEISSMVL KMKE AEAY+G  V NAV+TVPAYFNDSQRQATKDAG IAGLNVLRIINEPTAAAIAYGLD+    E+NVLIFDLGGGTFDVSIL+IDDGIFEVK+TAGDTHLGGEDFDNR+V+HF++EFKRKHKKDIS+NKRAVRRLRTACERAKRTLSSS QA++E+DSLFEG+DFYTSITRARFEELC+DLFRSTL+PVEK+LRDAK+DK  IH++VLVGGSTRIPKVQKLLQD+FNG++LNKSINPDEAVAYGAAVQAAIL GDKS+ VQDLLLLDVAPLSLG+ETAGGVMTALIKRNSTIPTKQTQ F+TY+DNQPGVLIQV+EGERAMTKDNNLLG+FELSGIPPAPRGVPQIEVTFDIDANGILNV+A +K TGK NKITITNDKGRLSKE+IERMV +AEKYK EDE Q+ER+S+KNALESYAF +KSA+EDE LK K +  +K+ V DKC E++SWLD N  A KDE+EH  KELE VC P++S +Y
Sbjct:    4 AAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVALNPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEEISSMVLTKMKEIAEAYLGYPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDRTGKGERNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVNHFVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQASLEIDSLFEGIDFYTSITRARFEELCSDLFRSTLEPVEKALRDAKLDKAQIHDLVLVGGSTRIPKVQKLLQDFFNGRDLNKSINPDEAVAYGAAVQAAILMGDKSENVQDLLLLDVAPLSLGLETAGGVMTALIKRNSTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGRFELSGIPPAPRGVPQIEVTFDIDANGILNVTATDKSTGKANKITITNDKGRLSKEEIERMVQEAEKYKAEDEVQRERVSAKNALESYAFNMKSAVEDEGLKGKISEADKKKVLDKCQEVISWLDANTLAEKDEFEHKRKELEQVCNPIISGLY 611          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Human
Match: HSPA1A (heat shock protein family A (Hsp70) member 1A [Source:HGNC Symbol;Acc:HGNC:5232])

HSP 1 Score: 961.059 bits (2483), Expect = 0.000e+0
Identity = 492/608 (80.92%), Postives = 552/608 (90.79%), Query Frame = 2
Query:  188 APAVGIDLGTTFSCVGVFQHGKVEIIGNDQGNRTTPSFVAFNDTERLIGDAAKNQAAMNPANTVFDAKRLIGRKFDEPSVQADMKHFSFNVVNVEGRPKIQVEFKGESKTFSAEEISSMVLLKMKETAEAYIGKEVKNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKSSEEKNVLIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRMVDHFIQEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSAQANIEVDSLFEGLDFYTSITRARFEELCADLFRSTLDPVEKSLRDAKMDKNAIHEIVLVGGSTRIPKVQKLLQDYFNGKELNKSINPDEXXXXXXXXXXXILSGDKSXXXXXXXXXXXXXXXXGIETAGGVMTALIKRNSTIPTKQTQTFSTYADNQPGVLIQVFEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKEDIERMVNDAXXXXXXXXXXXXRISSKNALESYAFQVKSAMEDEKLKDKFTAEEKQTVTDKCSEIVSWLDKNQSASKDEYEHHMKELEGVCKPVMSKIY 2011
            A A+GIDLGTT+SCVGVFQHGKVEII NDQGNRTTPS+VAF DTERLIGDAAKNQ A+NP NTVFDAKRLIGRKF +P VQ+DMKH+ F V+N   +PK+QV +KGE+K F  EEISSMVL KMKE AEAY+G  V NAV+TVPAYFNDSQRQATKDAG IAGLNVLRIINEPTAAAIAYGLD+    E+NVLIFDLGGGTFDVSIL+IDDGIFEVK+TAGDTHLGGEDFDNR+V+HF++EFKRKHKKDIS+NKRAVRRLRTACERAKRTLSSS QA++E+DSLFEG+DFYTSITRARFEELC+DLFRSTL+PVEK+LRDAK+DK  IH++VLVGGSTRIPKVQKLLQD+FNG++LNKSINPDEAVAYGAAVQAAIL GDKS+ VQDLLLLDVAPLSLG+ETAGGVMTALIKRNSTIPTKQTQ F+TY+DNQPGVLIQV+EGERAMTKDNNLLG+FELSGIPPAPRGVPQIEVTFDIDANGILNV+A +K TGK NKITITNDKGRLSKE+IERMV +AEKYK EDE Q+ER+S+KNALESYAF +KSA+EDE LK K +  +K+ V DKC E++SWLD N  A KDE+EH  KELE VC P++S +Y
Sbjct:    4 AAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVALNPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEEISSMVLTKMKEIAEAYLGYPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDRTGKGERNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVNHFVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQASLEIDSLFEGIDFYTSITRARFEELCSDLFRSTLEPVEKALRDAKLDKAQIHDLVLVGGSTRIPKVQKLLQDFFNGRDLNKSINPDEAVAYGAAVQAAILMGDKSENVQDLLLLDVAPLSLGLETAGGVMTALIKRNSTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGRFELSGIPPAPRGVPQIEVTFDIDANGILNVTATDKSTGKANKITITNDKGRLSKEEIERMVQEAEKYKAEDEVQRERVSAKNALESYAFNMKSAVEDEGLKGKISEADKKKVLDKCQEVISWLDANTLAEKDEFEHKRKELEQVCNPIISGLY 611          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Celegans
Match: hsp-1 (Heat shock 70 kDa protein A [Source:UniProtKB/Swiss-Prot;Acc:P09446])

HSP 1 Score: 975.311 bits (2520), Expect = 0.000e+0
Identity = 500/607 (82.37%), Postives = 560/607 (92.26%), Query Frame = 2
Query:  194 AVGIDLGTTFSCVGVFQHGKVEIIGNDQGNRTTPSFVAFNDTERLIGDAAKNQAAMNPANTVFDAKRLIGRKFDEPSVQADMKHFSFNVVNVEG-RPKIQVEFKGESKTFSAEEISSMVLLKMKETAEAYIGKEVKNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKSSEEKNVLIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRMVDHFIQEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSAQANIEVDSLFEGLDFYTSITRARFEELCADLFRSTLDPVEKSLRDAKMDKNAIHEIVLVGGSTRIPKVQKLLQDYFNGKELNKSINPDEXXXXXXXXXXXILSGDKSXXXXXXXXXXXXXXXXGIETAGGVMTALIKRNSTIPTKQTQTFSTYADNQPGVLIQVFEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKEDIERMVNDAXXXXXXXXXXXXRISSKNALESYAFQVKSAMEDEKLKDKFTAEEKQTVTDKCSEIVSWLDKNQSASKDEYEHHMKELEGVCKPVMSKIY 2011
            AVGIDLGTT+SCVGVF HGKVEII NDQGNRTTPS+VAF DTERLIGDAAKNQ AMNP NTVFDAKRLIGRKFD+P+VQ+DMKH+ F V++ EG +PK+QVE+KGE+K F+ EEISSMVLLKMKETAEA++G  VK+AVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKK   E+NVLIFDLGGGTFDVSIL+I+DGIFEVKSTAGDTHLGGEDFDNRMV+HF  EFKRKHKKD++ N RA+RRLRTACERAKRTLSSS+QA+IE+DSLFEG+DFYT+ITRARFEELCADLFRST+DPVEKSLRDAKMDK+ +H+IVLVGGSTRIPKVQKLL D F+GKELNKSINPDEAVAYGAAVQAAILSGDKS+ VQDLLLLDVAPLSLGIETAGGVMTALIKRN+TIPTK  QTF+TY+DNQPGVLIQV+EGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSA +K TGK+NKITITNDKGRLSK+DIERMVN+AEKYK +DE QK+RI +KN LESYAF +K  +EDEKLKDK + E+K+ + DKC EI+ WLD NQ+A K+E+EH  K+LEG+  P++SK+Y
Sbjct:    6 AVGIDLGTTYSCVGVFMHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPHNTVFDAKRLIGRKFDDPAVQSDMKHWPFKVISAEGAKPKVQVEYKGENKIFTPEEISSMVLLKMKETAEAFLGTTVKDAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKGHGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFCAEFKRKHKKDLASNPRALRRLRTACERAKRTLSSSSQASIEIDSLFEGIDFYTNITRARFEELCADLFRSTMDPVEKSLRDAKMDKSQVHDIVLVGGSTRIPKVQKLLSDLFSGKELNKSINPDEAVAYGAAVQAAILSGDKSEAVQDLLLLDVAPLSLGIETAGGVMTALIKRNTTIPTKTAQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSATDKSTGKQNKITITNDKGRLSKDDIERMVNEAEKYKADDEAQKDRIGAKNGLESYAFNLKQTIEDEKLKDKISPEDKKKIEDKCDEILKWLDSNQTAEKEEFEHQQKDLEGLANPIISKLY 612          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Celegans
Match: hsp-1 (Heat shock 70 kDa protein A [Source:UniProtKB/Swiss-Prot;Acc:P09446])

HSP 1 Score: 975.311 bits (2520), Expect = 0.000e+0
Identity = 500/607 (82.37%), Postives = 560/607 (92.26%), Query Frame = 2
Query:  194 AVGIDLGTTFSCVGVFQHGKVEIIGNDQGNRTTPSFVAFNDTERLIGDAAKNQAAMNPANTVFDAKRLIGRKFDEPSVQADMKHFSFNVVNVEG-RPKIQVEFKGESKTFSAEEISSMVLLKMKETAEAYIGKEVKNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKSSEEKNVLIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRMVDHFIQEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSAQANIEVDSLFEGLDFYTSITRARFEELCADLFRSTLDPVEKSLRDAKMDKNAIHEIVLVGGSTRIPKVQKLLQDYFNGKELNKSINPDEXXXXXXXXXXXILSGDKSXXXXXXXXXXXXXXXXGIETAGGVMTALIKRNSTIPTKQTQTFSTYADNQPGVLIQVFEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKEDIERMVNDAXXXXXXXXXXXXRISSKNALESYAFQVKSAMEDEKLKDKFTAEEKQTVTDKCSEIVSWLDKNQSASKDEYEHHMKELEGVCKPVMSKIY 2011
            AVGIDLGTT+SCVGVF HGKVEII NDQGNRTTPS+VAF DTERLIGDAAKNQ AMNP NTVFDAKRLIGRKFD+P+VQ+DMKH+ F V++ EG +PK+QVE+KGE+K F+ EEISSMVLLKMKETAEA++G  VK+AVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKK   E+NVLIFDLGGGTFDVSIL+I+DGIFEVKSTAGDTHLGGEDFDNRMV+HF  EFKRKHKKD++ N RA+RRLRTACERAKRTLSSS+QA+IE+DSLFEG+DFYT+ITRARFEELCADLFRST+DPVEKSLRDAKMDK+ +H+IVLVGGSTRIPKVQKLL D F+GKELNKSINPDEAVAYGAAVQAAILSGDKS+ VQDLLLLDVAPLSLGIETAGGVMTALIKRN+TIPTK  QTF+TY+DNQPGVLIQV+EGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSA +K TGK+NKITITNDKGRLSK+DIERMVN+AEKYK +DE QK+RI +KN LESYAF +K  +EDEKLKDK + E+K+ + DKC EI+ WLD NQ+A K+E+EH  K+LEG+  P++SK+Y
Sbjct:    6 AVGIDLGTTYSCVGVFMHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPHNTVFDAKRLIGRKFDDPAVQSDMKHWPFKVISAEGAKPKVQVEYKGENKIFTPEEISSMVLLKMKETAEAFLGTTVKDAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKGHGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFCAEFKRKHKKDLASNPRALRRLRTACERAKRTLSSSSQASIEIDSLFEGIDFYTNITRARFEELCADLFRSTMDPVEKSLRDAKMDKSQVHDIVLVGGSTRIPKVQKLLSDLFSGKELNKSINPDEAVAYGAAVQAAILSGDKSEAVQDLLLLDVAPLSLGIETAGGVMTALIKRNTTIPTKTAQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSATDKSTGKQNKITITNDKGRLSKDDIERMVNEAEKYKADDEAQKDRIGAKNGLESYAFNLKQTIEDEKLKDKISPEDKKKIEDKCDEILKWLDSNQTAEKEEFEHQQKDLEGLANPIISKLY 612          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Celegans
Match: F44E5.5 (pep chromosome:WBcel235:II:11759681:11761808:1 gene:WBGene00009692.1 transcript:F44E5.5.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F44E5.5)

HSP 1 Score: 835.099 bits (2156), Expect = 0.000e+0
Identity = 439/650 (67.54%), Postives = 532/650 (81.85%), Query Frame = 2
Query:  185 SAPAVGIDLGTTFSCVGVFQHGKVEIIGNDQGNRTTPSFVAFNDTERLIGDAAKNQAAMNPANTVFDAKRLIGRKFDEPSVQADMKHFSFNVVNVEGRPKIQVEFKGESKTFSAEEISSMVLLKMKETAEAYIGKEVKNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKSSEEKNVLIFDLGGGTFDVSILSIDDG-IFEVKSTAGDTHLGGEDFDNRMVDHFIQEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSAQANIEVDSLFEGLDFYTSITRARFEELCADLFRSTLDPVEKSLRDAKMDKNAIHEIVLVGGSTRIPKVQKLLQDYFNGKELNKSINPDEXXXXXXXXXXXILSGDKSXXXXXXXXXXXXXXXXGIETAGGVMTALIKRNSTIPTKQTQTFSTYADNQPGVLIQVFEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKEDIERMVNDAXXXXXXXXXXXXRISSKNALESYAFQVKSAMEDEKLKDKFTAEEKQTVTDKCSEIVSWLDKNQSASKDEYEHHMKELEGVCKPVMSKIYGAGMPS------GMPFEM---PTEMPASGDKSGPSIEELD 2104
            S  A+GIDLGTT+SCVG++Q+GKVEI+ N +GN+TTPS+VAF DTERL+GDAAK+QAA NP NTVFDAKRLIGR+FDE +VQ+D KH+ F V   +G+P I+VE KGE + F+ EEIS+MVL KMKETAE Y+G  VK+AV+TVPAYFNDSQRQATKDA  IAGLN +RIINEPTAAA+AYGLDK   +EKNVLIFDLGGGTFDVSILSI +G IFEVKSTAGDTHLGGEDFD RM+ HF+ EFKRK  KDIS N RA+RRLRTACERAKRTLSSS++A +EVDSLFEG+D  T ITRARFEELCADLFR TL+PVEK+LRDAK+DK+ I E+VLVGGSTR+PK+QKLL+D+FNGKELN SINPDEAVA+GAAVQAA+LSG K + ++D+LL+DVAPLSLGIETAGGVMT LI RN+ IPTK  +TF+TYADNQPGV IQV+EGERAMT+DN+ LG FELSGIPPAPRGVPQIEVTFDIDANGILNVSA +K TGK N+ITI N+KGRL++ DI+RMV++A++++KED EQ+ER+ ++N LE+YAFQ+K A+++     K + E+     +   E + WLD N  A KDE E   KEL+ VC+ +++K++ +G  S      G P      P   P      GP++EE+D
Sbjct:    3 SCKAIGIDLGTTYSCVGIYQNGKVEILANSEGNKTTPSYVAFTDTERLVGDAAKDQAARNPENTVFDAKRLIGRRFDESTVQSDCKHWPFGVKGKQGKPVIEVEVKGEKRQFNPEEISAMVLQKMKETAETYLGHTVKDAVITVPAYFNDSQRQATKDAATIAGLNAIRIINEPTAAALAYGLDKGIQDEKNVLIFDLGGGTFDVSILSIAEGSIFEVKSTAGDTHLGGEDFDQRMLQHFMNEFKRKTGKDISPNPRAIRRLRTACERAKRTLSSSSEACVEVDSLFEGIDLCTKITRARFEELCADLFRKTLEPVEKALRDAKLDKSKIDEVVLVGGSTRVPKIQKLLKDFFNGKELNCSINPDEAVAFGAAVQAAVLSGVKDETIKDVLLVDVAPLSLGIETAGGVMTNLIDRNTRIPTKACKTFTTYADNQPGVSIQVYEGERAMTRDNHRLGTFELSGIPPAPRGVPQIEVTFDIDANGILNVSAEDKSTGKSNRITIQNEKGRLTQSDIDRMVHEAKQFEKEDGEQRERVQARNQLEAYAFQIKQALDE--YSSKLSTEDASRAKEAVDETLRWLDSNSLAEKDEIEAKDKELKSVCQSILTKMHQSGQSSASAGCAGNPGTAGFNPNNYP-----QGPTVEEVD 645          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Celegans
Match: F44E5.5 (pep chromosome:WBcel235:II:11759640:11761853:1 gene:WBGene00009692.1 transcript:F44E5.5.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F44E5.5)

HSP 1 Score: 835.099 bits (2156), Expect = 0.000e+0
Identity = 439/650 (67.54%), Postives = 532/650 (81.85%), Query Frame = 2
Query:  185 SAPAVGIDLGTTFSCVGVFQHGKVEIIGNDQGNRTTPSFVAFNDTERLIGDAAKNQAAMNPANTVFDAKRLIGRKFDEPSVQADMKHFSFNVVNVEGRPKIQVEFKGESKTFSAEEISSMVLLKMKETAEAYIGKEVKNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKSSEEKNVLIFDLGGGTFDVSILSIDDG-IFEVKSTAGDTHLGGEDFDNRMVDHFIQEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSAQANIEVDSLFEGLDFYTSITRARFEELCADLFRSTLDPVEKSLRDAKMDKNAIHEIVLVGGSTRIPKVQKLLQDYFNGKELNKSINPDEXXXXXXXXXXXILSGDKSXXXXXXXXXXXXXXXXGIETAGGVMTALIKRNSTIPTKQTQTFSTYADNQPGVLIQVFEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKEDIERMVNDAXXXXXXXXXXXXRISSKNALESYAFQVKSAMEDEKLKDKFTAEEKQTVTDKCSEIVSWLDKNQSASKDEYEHHMKELEGVCKPVMSKIYGAGMPS------GMPFEM---PTEMPASGDKSGPSIEELD 2104
            S  A+GIDLGTT+SCVG++Q+GKVEI+ N +GN+TTPS+VAF DTERL+GDAAK+QAA NP NTVFDAKRLIGR+FDE +VQ+D KH+ F V   +G+P I+VE KGE + F+ EEIS+MVL KMKETAE Y+G  VK+AV+TVPAYFNDSQRQATKDA  IAGLN +RIINEPTAAA+AYGLDK   +EKNVLIFDLGGGTFDVSILSI +G IFEVKSTAGDTHLGGEDFD RM+ HF+ EFKRK  KDIS N RA+RRLRTACERAKRTLSSS++A +EVDSLFEG+D  T ITRARFEELCADLFR TL+PVEK+LRDAK+DK+ I E+VLVGGSTR+PK+QKLL+D+FNGKELN SINPDEAVA+GAAVQAA+LSG K + ++D+LL+DVAPLSLGIETAGGVMT LI RN+ IPTK  +TF+TYADNQPGV IQV+EGERAMT+DN+ LG FELSGIPPAPRGVPQIEVTFDIDANGILNVSA +K TGK N+ITI N+KGRL++ DI+RMV++A++++KED EQ+ER+ ++N LE+YAFQ+K A+++     K + E+     +   E + WLD N  A KDE E   KEL+ VC+ +++K++ +G  S      G P      P   P      GP++EE+D
Sbjct:    3 SCKAIGIDLGTTYSCVGIYQNGKVEILANSEGNKTTPSYVAFTDTERLVGDAAKDQAARNPENTVFDAKRLIGRRFDESTVQSDCKHWPFGVKGKQGKPVIEVEVKGEKRQFNPEEISAMVLQKMKETAETYLGHTVKDAVITVPAYFNDSQRQATKDAATIAGLNAIRIINEPTAAALAYGLDKGIQDEKNVLIFDLGGGTFDVSILSIAEGSIFEVKSTAGDTHLGGEDFDQRMLQHFMNEFKRKTGKDISPNPRAIRRLRTACERAKRTLSSSSEACVEVDSLFEGIDLCTKITRARFEELCADLFRKTLEPVEKALRDAKLDKSKIDEVVLVGGSTRVPKIQKLLKDFFNGKELNCSINPDEAVAFGAAVQAAVLSGVKDETIKDVLLVDVAPLSLGIETAGGVMTNLIDRNTRIPTKACKTFTTYADNQPGVSIQVYEGERAMTRDNHRLGTFELSGIPPAPRGVPQIEVTFDIDANGILNVSAEDKSTGKSNRITIQNEKGRLTQSDIDRMVHEAKQFEKEDGEQRERVQARNQLEAYAFQIKQALDE--YSSKLSTEDASRAKEAVDETLRWLDSNSLAEKDEIEAKDKELKSVCQSILTKMHQSGQSSASAGCAGNPGTAGFNPNNYP-----QGPTVEEVD 645          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Celegans
Match: F44E5.4 (pep chromosome:WBcel235:II:11757106:11759323:-1 gene:WBGene00009691.1 transcript:F44E5.4.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F44E5.4)

HSP 1 Score: 835.099 bits (2156), Expect = 0.000e+0
Identity = 439/650 (67.54%), Postives = 532/650 (81.85%), Query Frame = 2
Query:  185 SAPAVGIDLGTTFSCVGVFQHGKVEIIGNDQGNRTTPSFVAFNDTERLIGDAAKNQAAMNPANTVFDAKRLIGRKFDEPSVQADMKHFSFNVVNVEGRPKIQVEFKGESKTFSAEEISSMVLLKMKETAEAYIGKEVKNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKSSEEKNVLIFDLGGGTFDVSILSIDDG-IFEVKSTAGDTHLGGEDFDNRMVDHFIQEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSAQANIEVDSLFEGLDFYTSITRARFEELCADLFRSTLDPVEKSLRDAKMDKNAIHEIVLVGGSTRIPKVQKLLQDYFNGKELNKSINPDEXXXXXXXXXXXILSGDKSXXXXXXXXXXXXXXXXGIETAGGVMTALIKRNSTIPTKQTQTFSTYADNQPGVLIQVFEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKEDIERMVNDAXXXXXXXXXXXXRISSKNALESYAFQVKSAMEDEKLKDKFTAEEKQTVTDKCSEIVSWLDKNQSASKDEYEHHMKELEGVCKPVMSKIYGAGMPS------GMPFEM---PTEMPASGDKSGPSIEELD 2104
            S  A+GIDLGTT+SCVG++Q+GKVEI+ N +GN+TTPS+VAF DTERL+GDAAK+QAA NP NTVFDAKRLIGR+FDE +VQ+D KH+ F V   +G+P I+VE KGE + F+ EEIS+MVL KMKETAE Y+G  VK+AV+TVPAYFNDSQRQATKDA  IAGLN +RIINEPTAAA+AYGLDK   +EKNVLIFDLGGGTFDVSILSI +G IFEVKSTAGDTHLGGEDFD RM+ HF+ EFKRK  KDIS N RA+RRLRTACERAKRTLSSS++A +EVDSLFEG+D  T ITRARFEELCADLFR TL+PVEK+LRDAK+DK+ I E+VLVGGSTR+PK+QKLL+D+FNGKELN SINPDEAVA+GAAVQAA+LSG K + ++D+LL+DVAPLSLGIETAGGVMT LI RN+ IPTK  +TF+TYADNQPGV IQV+EGERAMT+DN+ LG FELSGIPPAPRGVPQIEVTFDIDANGILNVSA +K TGK N+ITI N+KGRL++ DI+RMV++A++++KED EQ+ER+ ++N LE+YAFQ+K A+++     K + E+     +   E + WLD N  A KDE E   KEL+ VC+ +++K++ +G  S      G P      P   P      GP++EE+D
Sbjct:    3 SCKAIGIDLGTTYSCVGIYQNGKVEILANSEGNKTTPSYVAFTDTERLVGDAAKDQAARNPENTVFDAKRLIGRRFDESTVQSDCKHWPFGVKGKQGKPVIEVEVKGEKRQFNPEEISAMVLQKMKETAETYLGHTVKDAVITVPAYFNDSQRQATKDAATIAGLNAIRIINEPTAAALAYGLDKGIQDEKNVLIFDLGGGTFDVSILSIAEGSIFEVKSTAGDTHLGGEDFDQRMLQHFMNEFKRKTGKDISPNPRAIRRLRTACERAKRTLSSSSEACVEVDSLFEGIDLCTKITRARFEELCADLFRKTLEPVEKALRDAKLDKSKIDEVVLVGGSTRVPKIQKLLKDFFNGKELNCSINPDEAVAFGAAVQAAVLSGVKDETIKDVLLVDVAPLSLGIETAGGVMTNLIDRNTRIPTKACKTFTTYADNQPGVSIQVYEGERAMTRDNHRLGTFELSGIPPAPRGVPQIEVTFDIDANGILNVSAEDKSTGKSNRITIQNEKGRLTQSDIDRMVHEAKQFEKEDGEQRERVQARNQLEAYAFQIKQALDE--YSSKLSTEDASRAKEAVDETLRWLDSNSLAEKDEIEAKDKELKSVCQSILTKMHQSGQSSASAGCAGNPGTAGFNPNNYP-----QGPTVEEVD 645          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Fly
Match: Hsc70-4 (gene:FBgn0266599 transcript:FBtr0083059)

HSP 1 Score: 968.763 bits (2503), Expect = 0.000e+0
Identity = 494/608 (81.25%), Postives = 553/608 (90.95%), Query Frame = 2
Query:  188 APAVGIDLGTTFSCVGVFQHGKVEIIGNDQGNRTTPSFVAFNDTERLIGDAAKNQAAMNPANTVFDAKRLIGRKFDEPSVQADMKHFSFNVVNVEGRPKIQVEFKGESKTFSAEEISSMVLLKMKETAEAYIGKEVKNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKSSEEKNVLIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRMVDHFIQEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSAQANIEVDSLFEGLDFYTSITRARFEELCADLFRSTLDPVEKSLRDAKMDKNAIHEIVLVGGSTRIPKVQKLLQDYFNGKELNKSINPDEXXXXXXXXXXXILSGDKSXXXXXXXXXXXXXXXXGIETAGGVMTALIKRNSTIPTKQTQTFSTYADNQPGVLIQVFEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKEDIERMVNDAXXXXXXXXXXXXRISSKNALESYAFQVKSAMEDEKLKDKFTAEEKQTVTDKCSEIVSWLDKNQSASKDEYEHHMKELEGVCKPVMSKIY 2011
            APAVGIDLGTT+SCVGVFQHGKVEII NDQGNRTTPS+VAF DTERLIGDAAKNQ AMNP  T+FDAKRLIGRKFD+ +VQ+DMKH+ F VV+ +G+PKI+V +K E KTF  EEISSMVL KMKETAEAY+GK V NAV+TVPAYFNDSQRQATKDAG IAGLNVLRIINEPTAAAIAYGLDKK+  E+NVLIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNR+V HF+QEFKRKHKKD++ NKRA+RRLRTACERAKRTLSSS QA+IE+DSLFEG DFYTSITRARFEEL ADLFRST+DPVEK+LRDAK+DK+ IH+IVLVGGSTRIPKVQ+LLQD FNGKELNKSINPDEAVAYGAAVQAAIL GDKS  VQDLLLLDV PLSLGIETAGGVM+ LIKRN+TIPTKQTQTF+TY+DNQPGVLIQV+EGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNV+A+E+ T KENKITITNDKGRLSKEDIERMVN+AEKY+ EDE+QKE I++KN LESY F +K+ ++++ LK K +  ++ T+ DKC+E + WLD NQ A K+EYEH  KELEGVC P+++K+Y
Sbjct:    4 APAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTQTIFDAKRLIGRKFDDAAVQSDMKHWPFEVVSADGKPKIEVTYKDEKKTFFPEEISSMVLTKMKETAEAYLGKTVTNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKAVGERNVLIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRLVTHFVQEFKRKHKKDLTTNKRALRRLRTACERAKRTLSSSTQASIEIDSLFEGTDFYTSITRARFEELNADLFRSTMDPVEKALRDAKLDKSVIHDIVLVGGSTRIPKVQRLLQDLFNGKELNKSINPDEAVAYGAAVQAAILHGDKSQEVQDLLLLDVTPLSLGIETAGGVMSVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVTALERSTNKENKITITNDKGRLSKEDIERMVNEAEKYRNEDEKQKETIAAKNGLESYCFNMKATLDEDNLKTKISDSDRTTILDKCNETIKWLDANQLADKEEYEHRQKELEGVCNPIITKLY 611          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Fly
Match: Hsc70-4 (gene:FBgn0266599 transcript:FBtr0337053)

HSP 1 Score: 968.763 bits (2503), Expect = 0.000e+0
Identity = 494/608 (81.25%), Postives = 553/608 (90.95%), Query Frame = 2
Query:  188 APAVGIDLGTTFSCVGVFQHGKVEIIGNDQGNRTTPSFVAFNDTERLIGDAAKNQAAMNPANTVFDAKRLIGRKFDEPSVQADMKHFSFNVVNVEGRPKIQVEFKGESKTFSAEEISSMVLLKMKETAEAYIGKEVKNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKSSEEKNVLIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRMVDHFIQEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSAQANIEVDSLFEGLDFYTSITRARFEELCADLFRSTLDPVEKSLRDAKMDKNAIHEIVLVGGSTRIPKVQKLLQDYFNGKELNKSINPDEXXXXXXXXXXXILSGDKSXXXXXXXXXXXXXXXXGIETAGGVMTALIKRNSTIPTKQTQTFSTYADNQPGVLIQVFEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKEDIERMVNDAXXXXXXXXXXXXRISSKNALESYAFQVKSAMEDEKLKDKFTAEEKQTVTDKCSEIVSWLDKNQSASKDEYEHHMKELEGVCKPVMSKIY 2011
            APAVGIDLGTT+SCVGVFQHGKVEII NDQGNRTTPS+VAF DTERLIGDAAKNQ AMNP  T+FDAKRLIGRKFD+ +VQ+DMKH+ F VV+ +G+PKI+V +K E KTF  EEISSMVL KMKETAEAY+GK V NAV+TVPAYFNDSQRQATKDAG IAGLNVLRIINEPTAAAIAYGLDKK+  E+NVLIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNR+V HF+QEFKRKHKKD++ NKRA+RRLRTACERAKRTLSSS QA+IE+DSLFEG DFYTSITRARFEEL ADLFRST+DPVEK+LRDAK+DK+ IH+IVLVGGSTRIPKVQ+LLQD FNGKELNKSINPDEAVAYGAAVQAAIL GDKS  VQDLLLLDV PLSLGIETAGGVM+ LIKRN+TIPTKQTQTF+TY+DNQPGVLIQV+EGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNV+A+E+ T KENKITITNDKGRLSKEDIERMVN+AEKY+ EDE+QKE I++KN LESY F +K+ ++++ LK K +  ++ T+ DKC+E + WLD NQ A K+EYEH  KELEGVC P+++K+Y
Sbjct:    4 APAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTQTIFDAKRLIGRKFDDAAVQSDMKHWPFEVVSADGKPKIEVTYKDEKKTFFPEEISSMVLTKMKETAEAYLGKTVTNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKAVGERNVLIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRLVTHFVQEFKRKHKKDLTTNKRALRRLRTACERAKRTLSSSTQASIEIDSLFEGTDFYTSITRARFEELNADLFRSTMDPVEKALRDAKLDKSVIHDIVLVGGSTRIPKVQRLLQDLFNGKELNKSINPDEAVAYGAAVQAAILHGDKSQEVQDLLLLDVTPLSLGIETAGGVMSVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVTALERSTNKENKITITNDKGRLSKEDIERMVNEAEKYRNEDEKQKETIAAKNGLESYCFNMKATLDEDNLKTKISDSDRTTILDKCNETIKWLDANQLADKEEYEHRQKELEGVCNPIITKLY 611          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Fly
Match: Hsc70-4 (gene:FBgn0266599 transcript:FBtr0083058)

HSP 1 Score: 968.763 bits (2503), Expect = 0.000e+0
Identity = 494/608 (81.25%), Postives = 553/608 (90.95%), Query Frame = 2
Query:  188 APAVGIDLGTTFSCVGVFQHGKVEIIGNDQGNRTTPSFVAFNDTERLIGDAAKNQAAMNPANTVFDAKRLIGRKFDEPSVQADMKHFSFNVVNVEGRPKIQVEFKGESKTFSAEEISSMVLLKMKETAEAYIGKEVKNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKSSEEKNVLIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRMVDHFIQEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSAQANIEVDSLFEGLDFYTSITRARFEELCADLFRSTLDPVEKSLRDAKMDKNAIHEIVLVGGSTRIPKVQKLLQDYFNGKELNKSINPDEXXXXXXXXXXXILSGDKSXXXXXXXXXXXXXXXXGIETAGGVMTALIKRNSTIPTKQTQTFSTYADNQPGVLIQVFEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKEDIERMVNDAXXXXXXXXXXXXRISSKNALESYAFQVKSAMEDEKLKDKFTAEEKQTVTDKCSEIVSWLDKNQSASKDEYEHHMKELEGVCKPVMSKIY 2011
            APAVGIDLGTT+SCVGVFQHGKVEII NDQGNRTTPS+VAF DTERLIGDAAKNQ AMNP  T+FDAKRLIGRKFD+ +VQ+DMKH+ F VV+ +G+PKI+V +K E KTF  EEISSMVL KMKETAEAY+GK V NAV+TVPAYFNDSQRQATKDAG IAGLNVLRIINEPTAAAIAYGLDKK+  E+NVLIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNR+V HF+QEFKRKHKKD++ NKRA+RRLRTACERAKRTLSSS QA+IE+DSLFEG DFYTSITRARFEEL ADLFRST+DPVEK+LRDAK+DK+ IH+IVLVGGSTRIPKVQ+LLQD FNGKELNKSINPDEAVAYGAAVQAAIL GDKS  VQDLLLLDV PLSLGIETAGGVM+ LIKRN+TIPTKQTQTF+TY+DNQPGVLIQV+EGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNV+A+E+ T KENKITITNDKGRLSKEDIERMVN+AEKY+ EDE+QKE I++KN LESY F +K+ ++++ LK K +  ++ T+ DKC+E + WLD NQ A K+EYEH  KELEGVC P+++K+Y
Sbjct:    4 APAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTQTIFDAKRLIGRKFDDAAVQSDMKHWPFEVVSADGKPKIEVTYKDEKKTFFPEEISSMVLTKMKETAEAYLGKTVTNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKAVGERNVLIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRLVTHFVQEFKRKHKKDLTTNKRALRRLRTACERAKRTLSSSTQASIEIDSLFEGTDFYTSITRARFEELNADLFRSTMDPVEKALRDAKLDKSVIHDIVLVGGSTRIPKVQRLLQDLFNGKELNKSINPDEAVAYGAAVQAAILHGDKSQEVQDLLLLDVTPLSLGIETAGGVMSVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVTALERSTNKENKITITNDKGRLSKEDIERMVNEAEKYRNEDEKQKETIAAKNGLESYCFNMKATLDEDNLKTKISDSDRTTILDKCNETIKWLDANQLADKEEYEHRQKELEGVCNPIITKLY 611          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Fly
Match: Hsc70-4 (gene:FBgn0266599 transcript:FBtr0083060)

HSP 1 Score: 968.763 bits (2503), Expect = 0.000e+0
Identity = 494/608 (81.25%), Postives = 553/608 (90.95%), Query Frame = 2
Query:  188 APAVGIDLGTTFSCVGVFQHGKVEIIGNDQGNRTTPSFVAFNDTERLIGDAAKNQAAMNPANTVFDAKRLIGRKFDEPSVQADMKHFSFNVVNVEGRPKIQVEFKGESKTFSAEEISSMVLLKMKETAEAYIGKEVKNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKSSEEKNVLIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRMVDHFIQEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSAQANIEVDSLFEGLDFYTSITRARFEELCADLFRSTLDPVEKSLRDAKMDKNAIHEIVLVGGSTRIPKVQKLLQDYFNGKELNKSINPDEXXXXXXXXXXXILSGDKSXXXXXXXXXXXXXXXXGIETAGGVMTALIKRNSTIPTKQTQTFSTYADNQPGVLIQVFEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKEDIERMVNDAXXXXXXXXXXXXRISSKNALESYAFQVKSAMEDEKLKDKFTAEEKQTVTDKCSEIVSWLDKNQSASKDEYEHHMKELEGVCKPVMSKIY 2011
            APAVGIDLGTT+SCVGVFQHGKVEII NDQGNRTTPS+VAF DTERLIGDAAKNQ AMNP  T+FDAKRLIGRKFD+ +VQ+DMKH+ F VV+ +G+PKI+V +K E KTF  EEISSMVL KMKETAEAY+GK V NAV+TVPAYFNDSQRQATKDAG IAGLNVLRIINEPTAAAIAYGLDKK+  E+NVLIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNR+V HF+QEFKRKHKKD++ NKRA+RRLRTACERAKRTLSSS QA+IE+DSLFEG DFYTSITRARFEEL ADLFRST+DPVEK+LRDAK+DK+ IH+IVLVGGSTRIPKVQ+LLQD FNGKELNKSINPDEAVAYGAAVQAAIL GDKS  VQDLLLLDV PLSLGIETAGGVM+ LIKRN+TIPTKQTQTF+TY+DNQPGVLIQV+EGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNV+A+E+ T KENKITITNDKGRLSKEDIERMVN+AEKY+ EDE+QKE I++KN LESY F +K+ ++++ LK K +  ++ T+ DKC+E + WLD NQ A K+EYEH  KELEGVC P+++K+Y
Sbjct:    4 APAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTQTIFDAKRLIGRKFDDAAVQSDMKHWPFEVVSADGKPKIEVTYKDEKKTFFPEEISSMVLTKMKETAEAYLGKTVTNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKAVGERNVLIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRLVTHFVQEFKRKHKKDLTTNKRALRRLRTACERAKRTLSSSTQASIEIDSLFEGTDFYTSITRARFEELNADLFRSTMDPVEKALRDAKLDKSVIHDIVLVGGSTRIPKVQRLLQDLFNGKELNKSINPDEAVAYGAAVQAAILHGDKSQEVQDLLLLDVTPLSLGIETAGGVMSVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVTALERSTNKENKITITNDKGRLSKEDIERMVNEAEKYRNEDEKQKETIAAKNGLESYCFNMKATLDEDNLKTKISDSDRTTILDKCNETIKWLDANQLADKEEYEHRQKELEGVCNPIITKLY 611          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Fly
Match: Hsc70-4 (gene:FBgn0266599 transcript:FBtr0083057)

HSP 1 Score: 968.763 bits (2503), Expect = 0.000e+0
Identity = 494/608 (81.25%), Postives = 553/608 (90.95%), Query Frame = 2
Query:  188 APAVGIDLGTTFSCVGVFQHGKVEIIGNDQGNRTTPSFVAFNDTERLIGDAAKNQAAMNPANTVFDAKRLIGRKFDEPSVQADMKHFSFNVVNVEGRPKIQVEFKGESKTFSAEEISSMVLLKMKETAEAYIGKEVKNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKSSEEKNVLIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRMVDHFIQEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSAQANIEVDSLFEGLDFYTSITRARFEELCADLFRSTLDPVEKSLRDAKMDKNAIHEIVLVGGSTRIPKVQKLLQDYFNGKELNKSINPDEXXXXXXXXXXXILSGDKSXXXXXXXXXXXXXXXXGIETAGGVMTALIKRNSTIPTKQTQTFSTYADNQPGVLIQVFEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKEDIERMVNDAXXXXXXXXXXXXRISSKNALESYAFQVKSAMEDEKLKDKFTAEEKQTVTDKCSEIVSWLDKNQSASKDEYEHHMKELEGVCKPVMSKIY 2011
            APAVGIDLGTT+SCVGVFQHGKVEII NDQGNRTTPS+VAF DTERLIGDAAKNQ AMNP  T+FDAKRLIGRKFD+ +VQ+DMKH+ F VV+ +G+PKI+V +K E KTF  EEISSMVL KMKETAEAY+GK V NAV+TVPAYFNDSQRQATKDAG IAGLNVLRIINEPTAAAIAYGLDKK+  E+NVLIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNR+V HF+QEFKRKHKKD++ NKRA+RRLRTACERAKRTLSSS QA+IE+DSLFEG DFYTSITRARFEEL ADLFRST+DPVEK+LRDAK+DK+ IH+IVLVGGSTRIPKVQ+LLQD FNGKELNKSINPDEAVAYGAAVQAAIL GDKS  VQDLLLLDV PLSLGIETAGGVM+ LIKRN+TIPTKQTQTF+TY+DNQPGVLIQV+EGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNV+A+E+ T KENKITITNDKGRLSKEDIERMVN+AEKY+ EDE+QKE I++KN LESY F +K+ ++++ LK K +  ++ T+ DKC+E + WLD NQ A K+EYEH  KELEGVC P+++K+Y
Sbjct:    4 APAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTQTIFDAKRLIGRKFDDAAVQSDMKHWPFEVVSADGKPKIEVTYKDEKKTFFPEEISSMVLTKMKETAEAYLGKTVTNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKAVGERNVLIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRLVTHFVQEFKRKHKKDLTTNKRALRRLRTACERAKRTLSSSTQASIEIDSLFEGTDFYTSITRARFEELNADLFRSTMDPVEKALRDAKLDKSVIHDIVLVGGSTRIPKVQRLLQDLFNGKELNKSINPDEAVAYGAAVQAAILHGDKSQEVQDLLLLDVTPLSLGIETAGGVMSVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVTALERSTNKENKITITNDKGRLSKEDIERMVNEAEKYRNEDEKQKETIAAKNGLESYCFNMKATLDEDNLKTKISDSDRTTILDKCNETIKWLDANQLADKEEYEHRQKELEGVCNPIITKLY 611          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Zebrafish
Match: hspa8 (heat shock protein 8 [Source:NCBI gene;Acc:573376])

HSP 1 Score: 993.416 bits (2567), Expect = 0.000e+0
Identity = 504/608 (82.89%), Postives = 560/608 (92.11%), Query Frame = 2
Query:  188 APAVGIDLGTTFSCVGVFQHGKVEIIGNDQGNRTTPSFVAFNDTERLIGDAAKNQAAMNPANTVFDAKRLIGRKFDEPSVQADMKHFSFNVVNVEGRPKIQVEFKGESKTFSAEEISSMVLLKMKETAEAYIGKEVKNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKSSEEKNVLIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRMVDHFIQEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSAQANIEVDSLFEGLDFYTSITRARFEELCADLFRSTLDPVEKSLRDAKMDKNAIHEIVLVGGSTRIPKVQKLLQDYFNGKELNKSINPDEXXXXXXXXXXXILSGDKSXXXXXXXXXXXXXXXXGIETAGGVMTALIKRNSTIPTKQTQTFSTYADNQPGVLIQVFEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKEDIERMVNDAXXXXXXXXXXXXRISSKNALESYAFQVKSAMEDEKLKDKFTAEEKQTVTDKCSEIVSWLDKNQSASKDEYEHHMKELEGVCKPVMSKIY 2011
             PAVGIDLGTT+SCVGVFQHGKVEII NDQGNRTTPS+VAF DTERLIGDAAKNQ AMNP NTVFDAKRLIGR+FD+  VQ+DMKH+ FNV+N   RPK+QVE+KGESK+F  EEISSMVL KMKE AEAY+GK V NAV+TVPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKK   E+NVLIFDLGGGTFDVSIL+I+DGIFEVKSTAGDTHLGGEDFDNRMV+HFI EFKRKHKKDIS+NKRAVRRLRTACERAKRTLSSS QA+IE+DSL+EG+DFYTSITRARFEEL ADLFR TLDPVEK+LRDAKMDK  IH+IVLVGGSTRIPK+QKLLQDYFNGKELNKSINPDEAVAYGAAVQAAILSGDKS+ VQDLLLLDV PLSLGIETAGGVMT LIKRN+TIPTKQTQTF+TY+DNQPGVLIQV+EGERAMTKDNNLLGKFEL+GIPPAPRGVPQIEVTFDIDANGI+NVSAV+K TGKENKITITNDKGRLSKEDIERMV +AEKYK ED+ Q++++S+KN LESYAF +KS +EDEKLK K + E+KQ + DKC+E++ WLDKNQ+A ++E+EH  KELE VC P+++K+Y
Sbjct:    9 GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDGVVQSDMKHWPFNVINDNSRPKVQVEYKGESKSFYPEEISSMVLTKMKEIAEAYLGKTVSNAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFITEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKMDKAQIHDIVLVGGSTRIPKIQKLLQDYFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGIMNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDDVQRDKVSAKNGLESYAFNMKSTVEDEKLKGKISDEDKQKILDKCNEVIGWLDKNQTAEREEFEHQQKELEKVCNPIITKLY 616          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Zebrafish
Match: hsp70l (heat shock cognate 70-kd protein, like [Source:ZFIN;Acc:ZDB-GENE-050321-1])

HSP 1 Score: 993.416 bits (2567), Expect = 0.000e+0
Identity = 510/644 (79.19%), Postives = 581/644 (90.22%), Query Frame = 2
Query:  182 MSAP---AVGIDLGTTFSCVGVFQHGKVEIIGNDQGNRTTPSFVAFNDTERLIGDAAKNQAAMNPANTVFDAKRLIGRKFDEPSVQADMKHFSFNVVNVEGRPKIQVEFKGESKTFSAEEISSMVLLKMKETAEAYIGKEVKNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKSSEEKNVLIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRMVDHFIQEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSAQANIEVDSLFEGLDFYTSITRARFEELCADLFRSTLDPVEKSLRDAKMDKNAIHEIVLVGGSTRIPKVQKLLQDYFNGKELNKSINPDEXXXXXXXXXXXILSGDKSXXXXXXXXXXXXXXXXGIETAGGVMTALIKRNSTIPTKQTQTFSTYADNQPGVLIQVFEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKEDIERMVNDAXXXXXXXXXXXXRISSKNALESYAFQVKSAMEDEKLKDKFTAEEKQTVTDKCSEIVSWLDKNQSASKDEYEHHMKELEGVCKPVMSKIYGAGMPSGMPFEMPTEMPASGDKSGPSIEELD 2104
            MS+P   A+GIDLGTT+SCVGVFQHGKVEII NDQGNRTTPS+VAF DTERLIGDAAKNQ AMNP NTVFDAKRLIGR+FD+P VQ+DMKH+SF VV+  G+PK+ VE KGE+KTF+ EEISSMVL+KMKE AEAY+G++V NAV+TVPAYFNDSQRQATKDAG IAGLNVLRIINEPTAAAIAYGLDK  S E+NVLIFDLGGGTFDVSIL+I+DGIFEVK+TAGDTHLGGEDFDNRMV+HF++EFKRKHKKDIS+NKRA+RRLRTACERAKRTLSSS+QA+IE+DSL+EG+DFYTSITRARFEELC+DLFR TLDPVEK+LRDAKMDK  IH+IVLVGGSTRIPK+QKLLQD+FNG+ELNKSINPDEAVAYGAAVQAAIL GD S  VQDLLLLDVAPLSLGIETAGGVMTALIKRN+TIPTKQTQTF+TY+DNQPGVLIQVFEGERAMTKDNNLLGKFEL+GIPPAPRGVPQIEVTFDIDANGILNVSA +K TGK+NKITITNDKGRLSKE+IERMV +A+KYK ED+ Q+E+IS+KN+LESYAF +K+++ED+ LK K + E+K+ V +KC+E VSWL+ NQ A K+EYEH +KELE VC PV+SK+Y  GMP+G          +     GP+IEE+D
Sbjct:    1 MSSPKEIAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRRFDDPVVQSDMKHWSFKVVSDGGKPKVAVEHKGENKTFNPEEISSMVLVKMKEIAEAYLGQKVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKGKSSERNVLIFDLGGGTFDVSILTIEDGIFEVKATAGDTHLGGEDFDNRMVNHFVEEFKRKHKKDISQNKRALRRLRTACERAKRTLSSSSQASIEIDSLYEGIDFYTSITRARFEELCSDLFRGTLDPVEKALRDAKMDKAQIHDIVLVGGSTRIPKIQKLLQDFFNGRELNKSINPDEAVAYGAAVQAAILMGDTSGNVQDLLLLDVAPLSLGIETAGGVMTALIKRNTTIPTKQTQTFTTYSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAADKSTGKQNKITITNDKGRLSKEEIERMVQEADKYKAEDDLQREKISAKNSLESYAFNMKNSVEDDNLKGKISEEDKKRVVEKCNEAVSWLENNQLADKEEYEHQLKELEKVCNPVISKLYQGGMPAG-GCGAQARAASGASAQGPTIEEVD 643          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Zebrafish
Match: hspa8 (heat shock protein 8 [Source:NCBI gene;Acc:573376])

HSP 1 Score: 993.03 bits (2566), Expect = 0.000e+0
Identity = 504/608 (82.89%), Postives = 560/608 (92.11%), Query Frame = 2
Query:  188 APAVGIDLGTTFSCVGVFQHGKVEIIGNDQGNRTTPSFVAFNDTERLIGDAAKNQAAMNPANTVFDAKRLIGRKFDEPSVQADMKHFSFNVVNVEGRPKIQVEFKGESKTFSAEEISSMVLLKMKETAEAYIGKEVKNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKSSEEKNVLIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRMVDHFIQEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSAQANIEVDSLFEGLDFYTSITRARFEELCADLFRSTLDPVEKSLRDAKMDKNAIHEIVLVGGSTRIPKVQKLLQDYFNGKELNKSINPDEXXXXXXXXXXXILSGDKSXXXXXXXXXXXXXXXXGIETAGGVMTALIKRNSTIPTKQTQTFSTYADNQPGVLIQVFEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKEDIERMVNDAXXXXXXXXXXXXRISSKNALESYAFQVKSAMEDEKLKDKFTAEEKQTVTDKCSEIVSWLDKNQSASKDEYEHHMKELEGVCKPVMSKIY 2011
             PAVGIDLGTT+SCVGVFQHGKVEII NDQGNRTTPS+VAF DTERLIGDAAKNQ AMNP NTVFDAKRLIGR+FD+  VQ+DMKH+ FNV+N   RPK+QVE+KGESK+F  EEISSMVL KMKE AEAY+GK V NAV+TVPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKK   E+NVLIFDLGGGTFDVSIL+I+DGIFEVKSTAGDTHLGGEDFDNRMV+HFI EFKRKHKKDIS+NKRAVRRLRTACERAKRTLSSS QA+IE+DSL+EG+DFYTSITRARFEEL ADLFR TLDPVEK+LRDAKMDK  IH+IVLVGGSTRIPK+QKLLQDYFNGKELNKSINPDEAVAYGAAVQAAILSGDKS+ VQDLLLLDV PLSLGIETAGGVMT LIKRN+TIPTKQTQTF+TY+DNQPGVLIQV+EGERAMTKDNNLLGKFEL+GIPPAPRGVPQIEVTFDIDANGI+NVSAV+K TGKENKITITNDKGRLSKEDIERMV +AEKYK ED+ Q++++S+KN LESYAF +KS +EDEKLK K + E+KQ + DKC+E++ WLDKNQ+A ++E+EH  KELE VC P+++K+Y
Sbjct:    4 GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDGVVQSDMKHWPFNVINDNSRPKVQVEYKGESKSFYPEEISSMVLTKMKEIAEAYLGKTVSNAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFITEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKMDKAQIHDIVLVGGSTRIPKIQKLLQDYFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGIMNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDDVQRDKVSAKNGLESYAFNMKSTVEDEKLKGKISDEDKQKILDKCNEVIGWLDKNQTAEREEFEHQQKELEKVCNPIITKLY 611          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Zebrafish
Match: hspa8 (heat shock protein 8 [Source:NCBI gene;Acc:573376])

HSP 1 Score: 992.645 bits (2565), Expect = 0.000e+0
Identity = 504/608 (82.89%), Postives = 560/608 (92.11%), Query Frame = 2
Query:  188 APAVGIDLGTTFSCVGVFQHGKVEIIGNDQGNRTTPSFVAFNDTERLIGDAAKNQAAMNPANTVFDAKRLIGRKFDEPSVQADMKHFSFNVVNVEGRPKIQVEFKGESKTFSAEEISSMVLLKMKETAEAYIGKEVKNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKSSEEKNVLIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRMVDHFIQEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSAQANIEVDSLFEGLDFYTSITRARFEELCADLFRSTLDPVEKSLRDAKMDKNAIHEIVLVGGSTRIPKVQKLLQDYFNGKELNKSINPDEXXXXXXXXXXXILSGDKSXXXXXXXXXXXXXXXXGIETAGGVMTALIKRNSTIPTKQTQTFSTYADNQPGVLIQVFEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKEDIERMVNDAXXXXXXXXXXXXRISSKNALESYAFQVKSAMEDEKLKDKFTAEEKQTVTDKCSEIVSWLDKNQSASKDEYEHHMKELEGVCKPVMSKIY 2011
             PAVGIDLGTT+SCVGVFQHGKVEII NDQGNRTTPS+VAF DTERLIGDAAKNQ AMNP NTVFDAKRLIGR+FD+  VQ+DMKH+ FNV+N   RPK+QVE+KGESK+F  EEISSMVL KMKE AEAY+GK V NAV+TVPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKK   E+NVLIFDLGGGTFDVSIL+I+DGIFEVKSTAGDTHLGGEDFDNRMV+HFI EFKRKHKKDIS+NKRAVRRLRTACERAKRTLSSS QA+IE+DSL+EG+DFYTSITRARFEEL ADLFR TLDPVEK+LRDAKMDK  IH+IVLVGGSTRIPK+QKLLQDYFNGKELNKSINPDEAVAYGAAVQAAILSGDKS+ VQDLLLLDV PLSLGIETAGGVMT LIKRN+TIPTKQTQTF+TY+DNQPGVLIQV+EGERAMTKDNNLLGKFEL+GIPPAPRGVPQIEVTFDIDANGI+NVSAV+K TGKENKITITNDKGRLSKEDIERMV +AEKYK ED+ Q++++S+KN LESYAF +KS +EDEKLK K + E+KQ + DKC+E++ WLDKNQ+A ++E+EH  KELE VC P+++K+Y
Sbjct:    4 GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDGVVQSDMKHWPFNVINDNSRPKVQVEYKGESKSFYPEEISSMVLTKMKEIAEAYLGKTVSNAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFITEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKMDKAQIHDIVLVGGSTRIPKIQKLLQDYFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGIMNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDDVQRDKVSAKNGLESYAFNMKSTVEDEKLKGKISDEDKQKILDKCNEVIGWLDKNQTAEREEFEHQQKELEKVCNPIITKLY 611          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Zebrafish
Match: hspa8 (heat shock protein 8 [Source:NCBI gene;Acc:573376])

HSP 1 Score: 992.645 bits (2565), Expect = 0.000e+0
Identity = 504/608 (82.89%), Postives = 560/608 (92.11%), Query Frame = 2
Query:  188 APAVGIDLGTTFSCVGVFQHGKVEIIGNDQGNRTTPSFVAFNDTERLIGDAAKNQAAMNPANTVFDAKRLIGRKFDEPSVQADMKHFSFNVVNVEGRPKIQVEFKGESKTFSAEEISSMVLLKMKETAEAYIGKEVKNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKSSEEKNVLIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRMVDHFIQEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSAQANIEVDSLFEGLDFYTSITRARFEELCADLFRSTLDPVEKSLRDAKMDKNAIHEIVLVGGSTRIPKVQKLLQDYFNGKELNKSINPDEXXXXXXXXXXXILSGDKSXXXXXXXXXXXXXXXXGIETAGGVMTALIKRNSTIPTKQTQTFSTYADNQPGVLIQVFEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKEDIERMVNDAXXXXXXXXXXXXRISSKNALESYAFQVKSAMEDEKLKDKFTAEEKQTVTDKCSEIVSWLDKNQSASKDEYEHHMKELEGVCKPVMSKIY 2011
             PAVGIDLGTT+SCVGVFQHGKVEII NDQGNRTTPS+VAF DTERLIGDAAKNQ AMNP NTVFDAKRLIGR+FD+  VQ+DMKH+ FNV+N   RPK+QVE+KGESK+F  EEISSMVL KMKE AEAY+GK V NAV+TVPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKK   E+NVLIFDLGGGTFDVSIL+I+DGIFEVKSTAGDTHLGGEDFDNRMV+HFI EFKRKHKKDIS+NKRAVRRLRTACERAKRTLSSS QA+IE+DSL+EG+DFYTSITRARFEEL ADLFR TLDPVEK+LRDAKMDK  IH+IVLVGGSTRIPK+QKLLQDYFNGKELNKSINPDEAVAYGAAVQAAILSGDKS+ VQDLLLLDV PLSLGIETAGGVMT LIKRN+TIPTKQTQTF+TY+DNQPGVLIQV+EGERAMTKDNNLLGKFEL+GIPPAPRGVPQIEVTFDIDANGI+NVSAV+K TGKENKITITNDKGRLSKEDIERMV +AEKYK ED+ Q++++S+KN LESYAF +KS +EDEKLK K + E+KQ + DKC+E++ WLDKNQ+A ++E+EH  KELE VC P+++K+Y
Sbjct:    4 GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDGVVQSDMKHWPFNVINDNSRPKVQVEYKGESKSFYPEEISSMVLTKMKEIAEAYLGKTVSNAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFITEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKMDKAQIHDIVLVGGSTRIPKIQKLLQDYFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGIMNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDDVQRDKVSAKNGLESYAFNMKSTVEDEKLKGKISDEDKQKILDKCNEVIGWLDKNQTAEREEFEHQQKELEKVCNPIITKLY 611          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Xenopus
Match: wdr26 (WD repeat domain 26 [Source:Xenbase;Acc:XB-GENE-993726])

HSP 1 Score: 999.579 bits (2583), Expect = 0.000e+0
Identity = 513/641 (80.03%), Postives = 578/641 (90.17%), Query Frame = 2
Query:  188 APAVGIDLGTTFSCVGVFQHGKVEIIGNDQGNRTTPSFVAFNDTERLIGDAAKNQAAMNPANTVFDAKRLIGRKFDEPSVQADMKHFSFNVVNVEGRPKIQVEFKGESKTFSAEEISSMVLLKMKETAEAYIGKEVKNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKSSEEKNVLIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRMVDHFIQEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSAQANIEVDSLFEGLDFYTSITRARFEELCADLFRSTLDPVEKSLRDAKMDKNAIHEIVLVGGSTRIPKVQKLLQDYFNGKELNKSINPDEXXXXXXXXXXXILSGDKSXXXXXXXXXXXXXXXXGIETAGGVMTALIKRNSTIPTKQTQTFSTYADNQPGVLIQVFEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKEDIERMVNDAXXXXXXXXXXXXRISSKNALESYAFQVKSAMEDEKLKDKFTAEEKQTVTDKCSEIVSWLDKNQSASKDEYEHHMKELEGVCKPVMSKIY--GAGMPSGMPFEMPTEMPASGDKSGPSIEELD 2104
             PAVGIDLGTT+SCVGVFQHGKVEII NDQGNRTTPS+VAF DTERLIGDAAKNQ AMNP NTVFDAKRLIGR+F++  VQ+DMKH+ FNV++  GRPK+QVE+K E+K+F  EEISSMVL+KMKE AEAY+GK V NAV+TVPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKK   E+NVLIFDLGGGTFDVSIL+I+DGIFEVKSTAGDTHLGGEDFDNRMV+HF+ EFKRKHKKDI +NKRAVRRLRTACERAKRTLSSS QA+IE+DSL+EG+DFYTSITRARFEEL ADLFR TLDPVEK+LRDAK+DK+ IH+IVLVGGSTRIPK+QKLLQD+FNGKELNKSINPDEAVAYGAAVQAAILSGDKS+ VQDLLLLDV PLSLGIETAGGVMT LIKRN+TIPTKQTQTF+TY+DNQPGVLIQV+EGERAMTKDNNLLGKFEL+GIPPAPRGVPQIEVTFDIDANGILNVSAV+K TGKENKITITNDKGRLSKEDIERMV +AEKYK EDE+Q++++SSKN+LESYAF +K+ +EDEKLK K + E+KQ + DKC+E++SWLDKNQ+A K+E+EH  KELE VC P+++K+Y    G PSG            G  SGP+IEE+D
Sbjct:    4 GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFEDAVVQSDMKHWPFNVISDSGRPKVQVEYKAETKSFYPEEISSMVLVKMKEIAEAYLGKTVTNAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVAEFKRKHKKDIIDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLKGKISDEDKQKILDKCNEVISWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQSAGGAPSG------------GASSGPTIEEVD 632          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Xenopus
Match: wdr26 (WD repeat domain 26 [Source:Xenbase;Acc:XB-GENE-993726])

HSP 1 Score: 989.949 bits (2558), Expect = 0.000e+0
Identity = 502/612 (82.03%), Postives = 567/612 (92.65%), Query Frame = 2
Query:  176 LKMSAPAVGIDLGTTFSCVGVFQHGKVEIIGNDQGNRTTPSFVAFNDTERLIGDAAKNQAAMNPANTVFDAKRLIGRKFDEPSVQADMKHFSFNVVNVEGRPKIQVEFKGESKTFSAEEISSMVLLKMKETAEAYIGKEVKNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKSSEEKNVLIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRMVDHFIQEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSAQANIEVDSLFEGLDFYTSITRARFEELCADLFRSTLDPVEKSLRDAKMDKNAIHEIVLVGGSTRIPKVQKLLQDYFNGKELNKSINPDEXXXXXXXXXXXILSGDKSXXXXXXXXXXXXXXXXGIETAGGVMTALIKRNSTIPTKQTQTFSTYADNQPGVLIQVFEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKEDIERMVNDAXXXXXXXXXXXXRISSKNALESYAFQVKSAMEDEKLKDKFTAEEKQTVTDKCSEIVSWLDKNQSASKDEYEHHMKELEGVCKPVMSKIY 2011
            ++ S PAVGIDLGTT+SCVGVFQHGKVEII NDQGNRTTPS+VAF DTERLIGDAAKNQ AMNP NTVFDAKRLIGR+F++  VQ+DMKH+ FNV++  GRPK+QVE+K E+K+F  EEISSMVL+KMKE AEAY+GK V NAV+TVPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKK   E+NVLIFDLGGGTFDVSIL+I+DGIFEVKSTAGDTHLGGEDFDNRMV+HF+ EFKRKHKKDI +NKRAVRRLRTACERAKRTLSSS QA+IE+DSL+EG+DFYTSITRARFEEL ADLFR TLDPVEK+LRDAK+DK+ IH+IVLVGGSTRIPK+QKLLQD+FNGKELNKSINPDEAVAYGAAVQAAILSGDKS+ VQDLLLLDV PLSLGIETAGGVMT LIKRN+TIPTKQTQTF+TY+DNQPGVLIQV+EGERAMTKDNNLLGKFEL+GIPPAPRGVPQIEVTFDIDANGILNVSAV+K TGKENKITITNDKGRLSKEDIERMV +AEKYK EDE+Q++++SSKN+LESYAF +K+ +EDEKLK K + E+KQ + DKC+E++SWLDKNQ+A K+E+EH  KELE VC P+++K+Y
Sbjct:    1 MQPSGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFEDAVVQSDMKHWPFNVISDSGRPKVQVEYKAETKSFYPEEISSMVLVKMKEIAEAYLGKTVTNAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVAEFKRKHKKDIIDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLKGKISDEDKQKILDKCNEVISWLDKNQTAEKEEFEHQQKELEKVCNPIITKLY 612          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Xenopus
Match: wdr26 (WD repeat domain 26 [Source:Xenbase;Acc:XB-GENE-993726])

HSP 1 Score: 988.793 bits (2555), Expect = 0.000e+0
Identity = 501/608 (82.40%), Postives = 564/608 (92.76%), Query Frame = 2
Query:  188 APAVGIDLGTTFSCVGVFQHGKVEIIGNDQGNRTTPSFVAFNDTERLIGDAAKNQAAMNPANTVFDAKRLIGRKFDEPSVQADMKHFSFNVVNVEGRPKIQVEFKGESKTFSAEEISSMVLLKMKETAEAYIGKEVKNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKSSEEKNVLIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRMVDHFIQEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSAQANIEVDSLFEGLDFYTSITRARFEELCADLFRSTLDPVEKSLRDAKMDKNAIHEIVLVGGSTRIPKVQKLLQDYFNGKELNKSINPDEXXXXXXXXXXXILSGDKSXXXXXXXXXXXXXXXXGIETAGGVMTALIKRNSTIPTKQTQTFSTYADNQPGVLIQVFEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKEDIERMVNDAXXXXXXXXXXXXRISSKNALESYAFQVKSAMEDEKLKDKFTAEEKQTVTDKCSEIVSWLDKNQSASKDEYEHHMKELEGVCKPVMSKIY 2011
             PAVGIDLGTT+SCVGVFQHGKVEII NDQGNRTTPS+VAF DTERLIGDAAKNQ AMNP NTVFDAKRLIGR+F++  VQ+DMKH+ FNV++  GRPK+QVE+K E+K+F  EEISSMVL+KMKE AEAY+GK V NAV+TVPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKK   E+NVLIFDLGGGTFDVSIL+I+DGIFEVKSTAGDTHLGGEDFDNRMV+HF+ EFKRKHKKDI +NKRAVRRLRTACERAKRTLSSS QA+IE+DSL+EG+DFYTSITRARFEEL ADLFR TLDPVEK+LRDAK+DK+ IH+IVLVGGSTRIPK+QKLLQD+FNGKELNKSINPDEAVAYGAAVQAAILSGDKS+ VQDLLLLDV PLSLGIETAGGVMT LIKRN+TIPTKQTQTF+TY+DNQPGVLIQV+EGERAMTKDNNLLGKFEL+GIPPAPRGVPQIEVTFDIDANGILNVSAV+K TGKENKITITNDKGRLSKEDIERMV +AEKYK EDE+Q++++SSKN+LESYAF +K+ +EDEKLK K + E+KQ + DKC+E++SWLDKNQ+A K+E+EH  KELE VC P+++K+Y
Sbjct:    9 GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFEDAVVQSDMKHWPFNVISDSGRPKVQVEYKAETKSFYPEEISSMVLVKMKEIAEAYLGKTVTNAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVAEFKRKHKKDIIDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLKGKISDEDKQKILDKCNEVISWLDKNQTAEKEEFEHQQKELEKVCNPIITKLY 616          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Xenopus
Match: wdr26 (WD repeat domain 26 [Source:Xenbase;Acc:XB-GENE-993726])

HSP 1 Score: 988.408 bits (2554), Expect = 0.000e+0
Identity = 501/608 (82.40%), Postives = 564/608 (92.76%), Query Frame = 2
Query:  188 APAVGIDLGTTFSCVGVFQHGKVEIIGNDQGNRTTPSFVAFNDTERLIGDAAKNQAAMNPANTVFDAKRLIGRKFDEPSVQADMKHFSFNVVNVEGRPKIQVEFKGESKTFSAEEISSMVLLKMKETAEAYIGKEVKNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKSSEEKNVLIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRMVDHFIQEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSAQANIEVDSLFEGLDFYTSITRARFEELCADLFRSTLDPVEKSLRDAKMDKNAIHEIVLVGGSTRIPKVQKLLQDYFNGKELNKSINPDEXXXXXXXXXXXILSGDKSXXXXXXXXXXXXXXXXGIETAGGVMTALIKRNSTIPTKQTQTFSTYADNQPGVLIQVFEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKEDIERMVNDAXXXXXXXXXXXXRISSKNALESYAFQVKSAMEDEKLKDKFTAEEKQTVTDKCSEIVSWLDKNQSASKDEYEHHMKELEGVCKPVMSKIY 2011
             PAVGIDLGTT+SCVGVFQHGKVEII NDQGNRTTPS+VAF DTERLIGDAAKNQ AMNP NTVFDAKRLIGR+F++  VQ+DMKH+ FNV++  GRPK+QVE+K E+K+F  EEISSMVL+KMKE AEAY+GK V NAV+TVPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKK   E+NVLIFDLGGGTFDVSIL+I+DGIFEVKSTAGDTHLGGEDFDNRMV+HF+ EFKRKHKKDI +NKRAVRRLRTACERAKRTLSSS QA+IE+DSL+EG+DFYTSITRARFEEL ADLFR TLDPVEK+LRDAK+DK+ IH+IVLVGGSTRIPK+QKLLQD+FNGKELNKSINPDEAVAYGAAVQAAILSGDKS+ VQDLLLLDV PLSLGIETAGGVMT LIKRN+TIPTKQTQTF+TY+DNQPGVLIQV+EGERAMTKDNNLLGKFEL+GIPPAPRGVPQIEVTFDIDANGILNVSAV+K TGKENKITITNDKGRLSKEDIERMV +AEKYK EDE+Q++++SSKN+LESYAF +K+ +EDEKLK K + E+KQ + DKC+E++SWLDKNQ+A K+E+EH  KELE VC P+++K+Y
Sbjct:    4 GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFEDAVVQSDMKHWPFNVISDSGRPKVQVEYKAETKSFYPEEISSMVLVKMKEIAEAYLGKTVTNAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVAEFKRKHKKDIIDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLKGKISDEDKQKILDKCNEVISWLDKNQTAEKEEFEHQQKELEKVCNPIITKLY 611          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Xenopus
Match: ENSXETT00000032295.1 (heat shock protein family A (Hsp70) member 1A [Source:NCBI gene;Acc:100488052])

HSP 1 Score: 988.408 bits (2554), Expect = 0.000e+0
Identity = 498/608 (81.91%), Postives = 563/608 (92.60%), Query Frame = 2
Query:  188 APAVGIDLGTTFSCVGVFQHGKVEIIGNDQGNRTTPSFVAFNDTERLIGDAAKNQAAMNPANTVFDAKRLIGRKFDEPSVQADMKHFSFNVVNVEGRPKIQVEFKGESKTFSAEEISSMVLLKMKETAEAYIGKEVKNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKSSEEKNVLIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRMVDHFIQEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSAQANIEVDSLFEGLDFYTSITRARFEELCADLFRSTLDPVEKSLRDAKMDKNAIHEIVLVGGSTRIPKVQKLLQDYFNGKELNKSINPDEXXXXXXXXXXXILSGDKSXXXXXXXXXXXXXXXXGIETAGGVMTALIKRNSTIPTKQTQTFSTYADNQPGVLIQVFEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKEDIERMVNDAXXXXXXXXXXXXRISSKNALESYAFQVKSAMEDEKLKDKFTAEEKQTVTDKCSEIVSWLDKNQSASKDEYEHHMKELEGVCKPVMSKIY 2011
             PAVGIDLGTT+SCVGVFQHGKVEII NDQGNRTTPS+VAF DTERLIGDAAKNQ AMNP NTVFDAKRLIGR+FD+P VQ+DMKH+ F V+N  GRPK+QVE+KGE+KTF AEE+SSMVL KMKE +EAY+GK + NAV+TVPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKK   E+NVLIFDLGGGTFDVSIL+I+DGIFEVKSTAGDTHLGGEDFDNRMV+HF+ EFKRKHKKDI+ENKRA+RRLRTACERAKRTLSSS QA+IE+DSL+EG+DFYTS+TRARFEEL ADLFR TL+PVEK+LRDAKMDK  IH+IVLVGGSTRIPK+QKLLQD+FNG+ELNKSINPDEAVAYGAAVQAAILSGDKS+ VQDLLLLDV PLSLGIETAGGVMT LIKRN+TIPTKQTQTF+TY+DNQPGVLIQVFEGERAMTKDNNLLGKFEL+GIPPAPRGVPQIEVTFDIDANGI+NVSAV+K TGKENKITITNDKGRLSKE+IERMV +A++YK EDE Q+E+IS+KN+LES AF +KS +EDEKLKDK + E+KQ + DKC+E++SWLD+NQ A K+EYEH  KEL+ +C P+++K+Y
Sbjct:    4 GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDPVVQSDMKHWPFTVINDGGRPKVQVEYKGEAKTFYAEEVSSMVLTKMKEISEAYLGKTITNAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKVGGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVGEFKRKHKKDITENKRAIRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSLTRARFEELNADLFRGTLEPVEKALRDAKMDKAQIHDIVLVGGSTRIPKIQKLLQDFFNGRELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGIMNVSAVDKSTGKENKITITNDKGRLSKEEIERMVQEADRYKAEDEVQREKISAKNSLESLAFNMKSTVEDEKLKDKISPEDKQKILDKCNEVISWLDRNQMAEKEEYEHQQKELQNLCNPIITKLY 611          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Mouse
Match: Hspa8 (heat shock protein 8 [Source:MGI Symbol;Acc:MGI:105384])

HSP 1 Score: 995.342 bits (2572), Expect = 0.000e+0
Identity = 508/608 (83.55%), Postives = 563/608 (92.60%), Query Frame = 2
Query:  188 APAVGIDLGTTFSCVGVFQHGKVEIIGNDQGNRTTPSFVAFNDTERLIGDAAKNQAAMNPANTVFDAKRLIGRKFDEPSVQADMKHFSFNVVNVEGRPKIQVEFKGESKTFSAEEISSMVLLKMKETAEAYIGKEVKNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKSSEEKNVLIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRMVDHFIQEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSAQANIEVDSLFEGLDFYTSITRARFEELCADLFRSTLDPVEKSLRDAKMDKNAIHEIVLVGGSTRIPKVQKLLQDYFNGKELNKSINPDEXXXXXXXXXXXILSGDKSXXXXXXXXXXXXXXXXGIETAGGVMTALIKRNSTIPTKQTQTFSTYADNQPGVLIQVFEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKEDIERMVNDAXXXXXXXXXXXXRISSKNALESYAFQVKSAMEDEKLKDKFTAEEKQTVTDKCSEIVSWLDKNQSASKDEYEHHMKELEGVCKPVMSKIY 2011
             PAVGIDLGTT+SCVGVFQHGKVEII NDQGNRTTPS+VAF DTERLIGDAAKNQ AMNP NTVFDAKRLIGR+FD+  VQ+DMKH+ F VVN  GRPK+QVE+KGE+K+F  EE+SSMVL KMKE AEAY+GK V NAVVTVPAYFNDSQRQATKDAG IAGLNVLRIINEPTAAAIAYGLDKK   E+NVLIFDLGGGTFDVSIL+I+DGIFEVKSTAGDTHLGGEDFDNRMV+HFI EFKRKHKKDISENKRAVRRLRTACERAKRTLSSS QA+IE+DSL+EG+DFYTSITRARFEEL ADLFR TLDPVEK+LRDAK+DK+ IH+IVLVGGSTRIPK+QKLLQD+FNGKELNKSINPDEAVAYGAAVQAAILSGDKS+ VQDLLLLDV PLSLGIETAGGVMT LIKRN+TIPTKQTQTF+TY+DNQPGVLIQV+EGERAMTKDNNLLGKFEL+GIPPAPRGVPQIEVTFDIDANGILNVSAV+K TGKENKITITNDKGRLSKEDIERMV +AEKYK EDE+Q++++SSKN+LESYAF +K+ +EDEKL+ K   E+KQ + DKC+EI+SWLDKNQ+A K+E+EH  KELE VC P+++K+Y
Sbjct:    4 GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLQGKINDEDKQKILDKCNEIISWLDKNQTAEKEEFEHQQKELEKVCNPIITKLY 611          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Mouse
Match: Hspa1l (heat shock protein 1-like [Source:MGI Symbol;Acc:MGI:96231])

HSP 1 Score: 966.452 bits (2497), Expect = 0.000e+0
Identity = 497/637 (78.02%), Postives = 567/637 (89.01%), Query Frame = 2
Query:  194 AVGIDLGTTFSCVGVFQHGKVEIIGNDQGNRTTPSFVAFNDTERLIGDAAKNQAAMNPANTVFDAKRLIGRKFDEPSVQADMKHFSFNVVNVEGRPKIQVEFKGESKTFSAEEISSMVLLKMKETAEAYIGKEVKNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKSSEEKNVLIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRMVDHFIQEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSAQANIEVDSLFEGLDFYTSITRARFEELCADLFRSTLDPVEKSLRDAKMDKNAIHEIVLVGGSTRIPKVQKLLQDYFNGKELNKSINPDEXXXXXXXXXXXILSGDKSXXXXXXXXXXXXXXXXGIETAGGVMTALIKRNSTIPTKQTQTFSTYADNQPGVLIQVFEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKEDIERMVNDAXXXXXXXXXXXXRISSKNALESYAFQVKSAMEDEKLKDKFTAEEKQTVTDKCSEIVSWLDKNQSASKDEYEHHMKELEGVCKPVMSKIYGAGMPSGMPFEMPTEMPASGDKSGPSIEELD 2104
            A+GIDLGTT+SCVGVFQHGKVEII NDQGNRTTPS+VAF DTERLIGDAAKNQ AMNP NTVFDAKRLIGRKF++P VQ+DMK + F V+N  G+PK+ V +KGE K F  EEISSMVL KMKETAEA++G  V NAV+TVPAYFNDSQRQATKDAG IAGLNVLRIINEPTAAAIAYGLDK S  E++VLIFDLGGGTFDVSIL+IDDGIFEVK+TAGDTHLGGEDFDNR+V HF++EFKRKHKKDIS+NKRAVRRLRTACERAKRTLSSS QAN+E+DSL+EG+DFYTSITRARFEELCADLFR TL+PVEKSLRDAKMDK  IH+IVLVGGSTRIPKVQKLLQDYFNG++LNKSINPDEAVAYGAAVQAAIL GDKS+ VQDLLLLDVAPLSLG+ETAGGVMT LIKRNSTIPTKQTQ F+TY+DNQPGVLIQV+EGERAMT+DNNLLG+F+L+GIPPAPRGVPQIEVTFDIDANGILNV+A++K TGK NKITITNDKGRLSKE+IERMV +AE+YK EDE Q+E+I++KNALESYAF +KSA+ DE LKDK +  +K+ + DKC+E++SWL+ NQ A KDE++H  KELE +C P+++K+Y +G     P   P   P     +GP+IEE+D
Sbjct:    8 AIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPQNTVFDAKRLIGRKFNDPVVQSDMKLWPFQVINEAGKPKVMVSYKGEKKAFYPEEISSMVLTKMKETAEAFLGHNVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKGSHGERHVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVSHFVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQANLEIDSLYEGIDFYTSITRARFEELCADLFRGTLEPVEKSLRDAKMDKAKIHDIVLVGGSTRIPKVQKLLQDYFNGRDLNKSINPDEAVAYGAAVQAAILMGDKSEKVQDLLLLDVAPLSLGLETAGGVMTVLIKRNSTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTRDNNLLGRFDLTGIPPAPRGVPQIEVTFDIDANGILNVTAMDKSTGKANKITITNDKGRLSKEEIERMVQEAERYKAEDEGQREKIAAKNALESYAFNMKSAVGDEGLKDKISESDKKKILDKCNEVLSWLEANQLAEKDEFDHKRKELENMCNPIITKLYQSGCTG--PTCTPGYTPGRA-ATGPTIEEVD 641          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Mouse
Match: Hspa1b (heat shock protein 1B [Source:MGI Symbol;Acc:MGI:99517])

HSP 1 Score: 958.362 bits (2476), Expect = 0.000e+0
Identity = 494/637 (77.55%), Postives = 560/637 (87.91%), Query Frame = 2
Query:  194 AVGIDLGTTFSCVGVFQHGKVEIIGNDQGNRTTPSFVAFNDTERLIGDAAKNQAAMNPANTVFDAKRLIGRKFDEPSVQADMKHFSFNVVNVEGRPKIQVEFKGESKTFSAEEISSMVLLKMKETAEAYIGKEVKNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKSSEEKNVLIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRMVDHFIQEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSAQANIEVDSLFEGLDFYTSITRARFEELCADLFRSTLDPVEKSLRDAKMDKNAIHEIVLVGGSTRIPKVQKLLQDYFNGKELNKSINPDEXXXXXXXXXXXILSGDKSXXXXXXXXXXXXXXXXGIETAGGVMTALIKRNSTIPTKQTQTFSTYADNQPGVLIQVFEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKEDIERMVNDAXXXXXXXXXXXXRISSKNALESYAFQVKSAMEDEKLKDKFTAEEKQTVTDKCSEIVSWLDKNQSASKDEYEHHMKELEGVCKPVMSKIYGAGMPSGMPFEMPTEMPASGDKSGPSIEELD 2104
            A+GIDLGTT+SCVGVFQHGKVEII NDQGNRTTPS+VAF DTERLIGDAAKNQ A+NP NTVFDAKRLIGRKF +  VQ+DMKH+ F VVN   +PK+QV +KGES++F  EEISSMVL KMKE AEAY+G  V NAV+TVPAYFNDSQRQATKDAG IAGLNVLRIINEPTAAAIAYGLD+    E+NVLIFDLGGGTFDVSIL+IDDGIFEVK+TAGDTHLGGEDFDNR+V HF++EFKRKHKKDIS+NKRAVRRLRTACERAKRTLSSS QA++E+DSLFEG+DFYTSITRARFEELC+DLFR TL+PVEK+LRDAKMDK  IH++VLVGGSTRIPKVQKLLQD+FNG++LNKSINPDEAVAYGAAVQAAIL GDKS+ VQDLLLLDVAPLSLG+ETAGGVMTALIKRNSTIPTKQTQTF+TY+DNQPGVLIQV+EGERAMT+DNNLLG+FELSGIPPAPRGVPQIEVTFDIDANGILNV+A +K TGK NKITITNDKGRLSKE+IERMV +AE+YK EDE Q++R+++KNALESYAF +KSA+EDE LK K +  +K+ V DKC E++SWLD N  A K+E+ H  +ELE VC P++S +Y      G         P     SGP+IEE+D
Sbjct:    6 AIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVALNPQNTVFDAKRLIGRKFGDAVVQSDMKHWPFQVVNDGDKPKVQVNYKGESRSFFPEEISSMVLTKMKEIAEAYLGHPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDRTGKGERNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVSHFVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQASLEIDSLFEGIDFYTSITRARFEELCSDLFRGTLEPVEKALRDAKMDKAQIHDLVLVGGSTRIPKVQKLLQDFFNGRDLNKSINPDEAVAYGAAVQAAILMGDKSENVQDLLLLDVAPLSLGLETAGGVMTALIKRNSTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTRDNNLLGRFELSGIPPAPRGVPQIEVTFDIDANGILNVTATDKSTGKANKITITNDKGRLSKEEIERMVQEAERYKAEDEVQRDRVAAKNALESYAFNMKSAVEDEGLKGKLSEADKKKVLDKCQEVISWLDSNTLADKEEFVHKREELERVCSPIISGLYQGAGAPGAGGFGAQAPPKGASGSGPTIEEVD 642          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Mouse
Match: Hspa1a (heat shock protein 1A [Source:MGI Symbol;Acc:MGI:96244])

HSP 1 Score: 952.584 bits (2461), Expect = 0.000e+0
Identity = 496/638 (77.74%), Postives = 562/638 (88.09%), Query Frame = 2
Query:  194 AVGIDLGTTFSCVGVFQHGKVEIIGNDQGNRTTPSFVAFNDTERLIGDAAKNQAAMNPANTVFDAKRLIGRKFDEPSVQADMKHFSFNVVNVEGRPKIQVEFKGESKTFSAEEISSMVLLKMKETAEAYIGKEVKNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKSSEEKNVLIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRMVDHFIQEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSAQANIEVDSLFEGLDFYTSITRARFEELCADLFRSTLDPVEKSLRDAKMDKNAIHEIVLVGGSTRIPKVQKLLQDYFNGKELNKSINPDEXXXXXXXXXXXILSGDKSXXXXXXXXXXXXXXXXGIETAGGVMTALIKRNSTIPTKQTQTFSTYADNQPGVLIQVFEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKEDIERMVNDAXXXXXXXXXXXXRISSKNALESYAFQVKSAMEDEKLKDKFTAEEKQTVTDKCSEIVSWLDKNQSASKDEYEHHMKELEGVCKPVMSKIYGAGMPSGMPFEMPTEMP-ASGDKSGPSIEELD 2104
            A+GIDLGTT+SCVGVFQHGKVEII NDQGNRTTPS+VAF DTERLIGDAAKNQ A+NP NTVFDAKRLIGRKF +  VQ+DMKH+ F VVN   +PK+QV +KGES++F  EEISSMVL KMKE AEAY+G  V NAV+TVPAYFNDSQRQATKDAG IAGLNVLRIINEPTAAAIAYGLD+    E+NVLIFDLGGGTFDVSIL+IDDGIFEVK+TAGDTHLGGEDFDNR+V HF++EFKRKHKKDIS+NKRAVRRLRTACERAKRTLSSS QA++E+DSLFEG+DFYTSITRARFEELC+DLFR TL+PVEK+LRDAKMDK  IH++VLVGGSTRIPKVQKLLQD+FNG++LNKSINPDEAVAYGAAVQAAIL GDKS+ VQDLLLLDVAPLSLG+ETAGGVMTALIKRNSTIPTKQTQTF+TY+DNQPGVLIQV+EGERAMT+DNNLLG+FELSGIPPAPRGVPQIEVTFDIDANGILNV+A +K TGK NKITITNDKGRLSKE+IERMV +AE+YK EDE Q++R+++KNALESYAF +KSA+EDE LK K +  +K+ V DKC E++SWLD N  A K+E+ H  +ELE VC P++S +Y      G           ASG  SGP+IEE+D
Sbjct:    6 AIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVALNPQNTVFDAKRLIGRKFGDAVVQSDMKHWPFQVVNDGDKPKVQVNYKGESRSFFPEEISSMVLTKMKEIAEAYLGHPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDRTGKGERNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVSHFVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQASLEIDSLFEGIDFYTSITRARFEELCSDLFRGTLEPVEKALRDAKMDKAQIHDLVLVGGSTRIPKVQKLLQDFFNGRDLNKSINPDEAVAYGAAVQAAILMGDKSENVQDLLLLDVAPLSLGLETAGGVMTALIKRNSTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTRDNNLLGRFELSGIPPAPRGVPQIEVTFDIDANGILNVTATDKSTGKANKITITNDKGRLSKEEIERMVQEAERYKAEDEVQRDRVAAKNALESYAFNMKSAVEDEGLKGKLSEADKKKVLDKCQEVISWLDSNTLADKEEFVHKREELERVCSPIISGLYQGAGAPGAGGFGAQAPKGASG--SGPTIEEVD 641          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Mouse
Match: Hspa8 (heat shock protein 8 [Source:MGI Symbol;Acc:MGI:105384])

HSP 1 Score: 948.347 bits (2450), Expect = 0.000e+0
Identity = 491/608 (80.76%), Postives = 546/608 (89.80%), Query Frame = 2
Query:  188 APAVGIDLGTTFSCVGVFQHGKVEIIGNDQGNRTTPSFVAFNDTERLIGDAAKNQAAMNPANTVFDAKRLIGRKFDEPSVQADMKHFSFNVVNVEGRPKIQVEFKGESKTFSAEEISSMVLLKMKETAEAYIGKEVKNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKSSEEKNVLIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRMVDHFIQEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSAQANIEVDSLFEGLDFYTSITRARFEELCADLFRSTLDPVEKSLRDAKMDKNAIHEIVLVGGSTRIPKVQKLLQDYFNGKELNKSINPDEXXXXXXXXXXXILSGDKSXXXXXXXXXXXXXXXXGIETAGGVMTALIKRNSTIPTKQTQTFSTYADNQPGVLIQVFEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKEDIERMVNDAXXXXXXXXXXXXRISSKNALESYAFQVKSAMEDEKLKDKFTAEEKQTVTDKCSEIVSWLDKNQSASKDEYEHHMKELEGVCKPVMSKIY 2011
             PAVGIDLGTT+SCVGVFQHGKVEII NDQGNRTTPS+VAF DTERLIGDAAKNQ AMNP NTVFDAKRLIGR+FD+  VQ+DMKH+ F VVN  GRPK+QVE+KGE+K+F  EE+SSMVL KMKE AEAY+GK                   ATKDAG IAGLNVLRIINEPTAAAIAYGLDKK   E+NVLIFDLGGGTFDVSIL+I+DGIFEVKSTAGDTHLGGEDFDNRMV+HFI EFKRKHKKDISENKRAVRRLRTACERAKRTLSSS QA+IE+DSL+EG+DFYTSITRARFEEL ADLFR TLDPVEK+LRDAK+DK+ IH+IVLVGGSTRIPK+QKLLQD+FNGKELNKSINPDEAVAYGAAVQAAILSGDKS+ VQDLLLLDV PLSLGIETAGGVMT LIKRN+TIPTKQTQTF+TY+DNQPGVLIQV+EGERAMTKDNNLLGKFEL+GIPPAPRGVPQIEVTFDIDANGILNVSAV+K TGKENKITITNDKGRLSKEDIERMV +AEKYK EDE+Q++++SSKN+LESYAF +K+ +EDEKL+ K   E+KQ + DKC+EI+SWLDKNQ+A K+E+EH  KELE VC P+++K+Y
Sbjct:    4 GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGK-------------------ATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLQGKINDEDKQKILDKCNEIISWLDKNQTAEKEEFEHQQKELEKVCNPIITKLY 592          
BLAST of Heat shock cognate 70 kDa protein vs. UniProt/SwissProt
Match: sp|P63018|HSP7C_RAT (Heat shock cognate 71 kDa protein OS=Rattus norvegicus OX=10116 GN=Hspa8 PE=1 SV=1)

HSP 1 Score: 995.342 bits (2572), Expect = 0.000e+0
Identity = 508/608 (83.55%), Postives = 563/608 (92.60%), Query Frame = 2
Query:  188 APAVGIDLGTTFSCVGVFQHGKVEIIGNDQGNRTTPSFVAFNDTERLIGDAAKNQAAMNPANTVFDAKRLIGRKFDEPSVQADMKHFSFNVVNVEGRPKIQVEFKGESKTFSAEEISSMVLLKMKETAEAYIGKEVKNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKSSEEKNVLIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRMVDHFIQEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSAQANIEVDSLFEGLDFYTSITRARFEELCADLFRSTLDPVEKSLRDAKMDKNAIHEIVLVGGSTRIPKVQKLLQDYFNGKELNKSINPDEXXXXXXXXXXXILSGDKSXXXXXXXXXXXXXXXXGIETAGGVMTALIKRNSTIPTKQTQTFSTYADNQPGVLIQVFEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKEDIERMVNDAXXXXXXXXXXXXRISSKNALESYAFQVKSAMEDEKLKDKFTAEEKQTVTDKCSEIVSWLDKNQSASKDEYEHHMKELEGVCKPVMSKIY 2011
             PAVGIDLGTT+SCVGVFQHGKVEII NDQGNRTTPS+VAF DTERLIGDAAKNQ AMNP NTVFDAKRLIGR+FD+  VQ+DMKH+ F VVN  GRPK+QVE+KGE+K+F  EE+SSMVL KMKE AEAY+GK V NAVVTVPAYFNDSQRQATKDAG IAGLNVLRIINEPTAAAIAYGLDKK   E+NVLIFDLGGGTFDVSIL+I+DGIFEVKSTAGDTHLGGEDFDNRMV+HFI EFKRKHKKDISENKRAVRRLRTACERAKRTLSSS QA+IE+DSL+EG+DFYTSITRARFEEL ADLFR TLDPVEK+LRDAK+DK+ IH+IVLVGGSTRIPK+QKLLQD+FNGKELNKSINPDEAVAYGAAVQAAILSGDKS+ VQDLLLLDV PLSLGIETAGGVMT LIKRN+TIPTKQTQTF+TY+DNQPGVLIQV+EGERAMTKDNNLLGKFEL+GIPPAPRGVPQIEVTFDIDANGILNVSAV+K TGKENKITITNDKGRLSKEDIERMV +AEKYK EDE+Q++++SSKN+LESYAF +K+ +EDEKL+ K   E+KQ + DKC+EI+SWLDKNQ+A K+E+EH  KELE VC P+++K+Y
Sbjct:    4 GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLQGKINDEDKQKILDKCNEIISWLDKNQTAEKEEFEHQQKELEKVCNPIITKLY 611          
BLAST of Heat shock cognate 70 kDa protein vs. UniProt/SwissProt
Match: sp|P63017|HSP7C_MOUSE (Heat shock cognate 71 kDa protein OS=Mus musculus OX=10090 GN=Hspa8 PE=1 SV=1)

HSP 1 Score: 995.342 bits (2572), Expect = 0.000e+0
Identity = 508/608 (83.55%), Postives = 563/608 (92.60%), Query Frame = 2
Query:  188 APAVGIDLGTTFSCVGVFQHGKVEIIGNDQGNRTTPSFVAFNDTERLIGDAAKNQAAMNPANTVFDAKRLIGRKFDEPSVQADMKHFSFNVVNVEGRPKIQVEFKGESKTFSAEEISSMVLLKMKETAEAYIGKEVKNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKSSEEKNVLIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRMVDHFIQEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSAQANIEVDSLFEGLDFYTSITRARFEELCADLFRSTLDPVEKSLRDAKMDKNAIHEIVLVGGSTRIPKVQKLLQDYFNGKELNKSINPDEXXXXXXXXXXXILSGDKSXXXXXXXXXXXXXXXXGIETAGGVMTALIKRNSTIPTKQTQTFSTYADNQPGVLIQVFEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKEDIERMVNDAXXXXXXXXXXXXRISSKNALESYAFQVKSAMEDEKLKDKFTAEEKQTVTDKCSEIVSWLDKNQSASKDEYEHHMKELEGVCKPVMSKIY 2011
             PAVGIDLGTT+SCVGVFQHGKVEII NDQGNRTTPS+VAF DTERLIGDAAKNQ AMNP NTVFDAKRLIGR+FD+  VQ+DMKH+ F VVN  GRPK+QVE+KGE+K+F  EE+SSMVL KMKE AEAY+GK V NAVVTVPAYFNDSQRQATKDAG IAGLNVLRIINEPTAAAIAYGLDKK   E+NVLIFDLGGGTFDVSIL+I+DGIFEVKSTAGDTHLGGEDFDNRMV+HFI EFKRKHKKDISENKRAVRRLRTACERAKRTLSSS QA+IE+DSL+EG+DFYTSITRARFEEL ADLFR TLDPVEK+LRDAK+DK+ IH+IVLVGGSTRIPK+QKLLQD+FNGKELNKSINPDEAVAYGAAVQAAILSGDKS+ VQDLLLLDV PLSLGIETAGGVMT LIKRN+TIPTKQTQTF+TY+DNQPGVLIQV+EGERAMTKDNNLLGKFEL+GIPPAPRGVPQIEVTFDIDANGILNVSAV+K TGKENKITITNDKGRLSKEDIERMV +AEKYK EDE+Q++++SSKN+LESYAF +K+ +EDEKL+ K   E+KQ + DKC+EI+SWLDKNQ+A K+E+EH  KELE VC P+++K+Y
Sbjct:    4 GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLQGKINDEDKQKILDKCNEIISWLDKNQTAEKEEFEHQQKELEKVCNPIITKLY 611          
BLAST of Heat shock cognate 70 kDa protein vs. UniProt/SwissProt
Match: sp|Q71U34|HSP7C_SAGOE (Heat shock cognate 71 kDa protein OS=Saguinus oedipus OX=9490 GN=HSPA8 PE=2 SV=1)

HSP 1 Score: 993.801 bits (2568), Expect = 0.000e+0
Identity = 507/608 (83.39%), Postives = 563/608 (92.60%), Query Frame = 2
Query:  188 APAVGIDLGTTFSCVGVFQHGKVEIIGNDQGNRTTPSFVAFNDTERLIGDAAKNQAAMNPANTVFDAKRLIGRKFDEPSVQADMKHFSFNVVNVEGRPKIQVEFKGESKTFSAEEISSMVLLKMKETAEAYIGKEVKNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKSSEEKNVLIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRMVDHFIQEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSAQANIEVDSLFEGLDFYTSITRARFEELCADLFRSTLDPVEKSLRDAKMDKNAIHEIVLVGGSTRIPKVQKLLQDYFNGKELNKSINPDEXXXXXXXXXXXILSGDKSXXXXXXXXXXXXXXXXGIETAGGVMTALIKRNSTIPTKQTQTFSTYADNQPGVLIQVFEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKEDIERMVNDAXXXXXXXXXXXXRISSKNALESYAFQVKSAMEDEKLKDKFTAEEKQTVTDKCSEIVSWLDKNQSASKDEYEHHMKELEGVCKPVMSKIY 2011
             PAVGIDLGTT+SCVGVFQHGKVEII NDQGNRTTPS+VAF DTERLIGDAAKNQ AMNP NTVFDAKRLIGR+FD+  VQ+DMKH+ F VVN  GRPK+QVE+KGE+K+F  EE+SSMVL KMKE AEAY+GK V NAVVTVPAYFNDSQRQATKDAG IAGLNVLRIINEPTAAAIAYGLDKK   E+NVLIFDLGGGTFDVSIL+I+DGIFEVKSTAGDTHLGGEDFDNRMV+HFI EFKRKHKKDISENKRAVRRLRTACERAKRTLSSS QA+IE+DSL+EG+DFYTSITRARFEEL ADLFR TLDPVEK+LRDAK+DK+ IH+IVLVGGSTRIPK+QKLLQD+FNGKELNKSINPDEAVAYGAAVQAAILSGDKS+ VQDLLLLDV PLSLGIETAGGVMT LIKRN+TIPTKQTQTF+TY+DNQPGVLIQV+EGERAMTKDNNLLGKFEL+GIPPAPRGVPQIEVTFDIDANGILNVSAV+K TGKENKITITNDKGRLSKEDIERMV +AEKYK EDE+Q++++SSKN+LESYAF +K+ +EDEKL+ K   E+KQ + DKC+EI++WLDKNQ+A K+E+EH  KELE VC P+++K+Y
Sbjct:    4 GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLQGKINDEDKQKILDKCNEIINWLDKNQTAEKEEFEHQQKELEKVCNPIITKLY 611          
BLAST of Heat shock cognate 70 kDa protein vs. UniProt/SwissProt
Match: sp|P11142|HSP7C_HUMAN (Heat shock cognate 71 kDa protein OS=Homo sapiens OX=9606 GN=HSPA8 PE=1 SV=1)

HSP 1 Score: 993.801 bits (2568), Expect = 0.000e+0
Identity = 507/608 (83.39%), Postives = 563/608 (92.60%), Query Frame = 2
Query:  188 APAVGIDLGTTFSCVGVFQHGKVEIIGNDQGNRTTPSFVAFNDTERLIGDAAKNQAAMNPANTVFDAKRLIGRKFDEPSVQADMKHFSFNVVNVEGRPKIQVEFKGESKTFSAEEISSMVLLKMKETAEAYIGKEVKNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKSSEEKNVLIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRMVDHFIQEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSAQANIEVDSLFEGLDFYTSITRARFEELCADLFRSTLDPVEKSLRDAKMDKNAIHEIVLVGGSTRIPKVQKLLQDYFNGKELNKSINPDEXXXXXXXXXXXILSGDKSXXXXXXXXXXXXXXXXGIETAGGVMTALIKRNSTIPTKQTQTFSTYADNQPGVLIQVFEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKEDIERMVNDAXXXXXXXXXXXXRISSKNALESYAFQVKSAMEDEKLKDKFTAEEKQTVTDKCSEIVSWLDKNQSASKDEYEHHMKELEGVCKPVMSKIY 2011
             PAVGIDLGTT+SCVGVFQHGKVEII NDQGNRTTPS+VAF DTERLIGDAAKNQ AMNP NTVFDAKRLIGR+FD+  VQ+DMKH+ F VVN  GRPK+QVE+KGE+K+F  EE+SSMVL KMKE AEAY+GK V NAVVTVPAYFNDSQRQATKDAG IAGLNVLRIINEPTAAAIAYGLDKK   E+NVLIFDLGGGTFDVSIL+I+DGIFEVKSTAGDTHLGGEDFDNRMV+HFI EFKRKHKKDISENKRAVRRLRTACERAKRTLSSS QA+IE+DSL+EG+DFYTSITRARFEEL ADLFR TLDPVEK+LRDAK+DK+ IH+IVLVGGSTRIPK+QKLLQD+FNGKELNKSINPDEAVAYGAAVQAAILSGDKS+ VQDLLLLDV PLSLGIETAGGVMT LIKRN+TIPTKQTQTF+TY+DNQPGVLIQV+EGERAMTKDNNLLGKFEL+GIPPAPRGVPQIEVTFDIDANGILNVSAV+K TGKENKITITNDKGRLSKEDIERMV +AEKYK EDE+Q++++SSKN+LESYAF +K+ +EDEKL+ K   E+KQ + DKC+EI++WLDKNQ+A K+E+EH  KELE VC P+++K+Y
Sbjct:    4 GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLQGKINDEDKQKILDKCNEIINWLDKNQTAEKEEFEHQQKELEKVCNPIITKLY 611          
BLAST of Heat shock cognate 70 kDa protein vs. UniProt/SwissProt
Match: sp|A2Q0Z1|HSP7C_HORSE (Heat shock cognate 71 kDa protein OS=Equus caballus OX=9796 GN=HSPA8 PE=2 SV=1)

HSP 1 Score: 993.801 bits (2568), Expect = 0.000e+0
Identity = 507/608 (83.39%), Postives = 563/608 (92.60%), Query Frame = 2
Query:  188 APAVGIDLGTTFSCVGVFQHGKVEIIGNDQGNRTTPSFVAFNDTERLIGDAAKNQAAMNPANTVFDAKRLIGRKFDEPSVQADMKHFSFNVVNVEGRPKIQVEFKGESKTFSAEEISSMVLLKMKETAEAYIGKEVKNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKSSEEKNVLIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRMVDHFIQEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSAQANIEVDSLFEGLDFYTSITRARFEELCADLFRSTLDPVEKSLRDAKMDKNAIHEIVLVGGSTRIPKVQKLLQDYFNGKELNKSINPDEXXXXXXXXXXXILSGDKSXXXXXXXXXXXXXXXXGIETAGGVMTALIKRNSTIPTKQTQTFSTYADNQPGVLIQVFEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKEDIERMVNDAXXXXXXXXXXXXRISSKNALESYAFQVKSAMEDEKLKDKFTAEEKQTVTDKCSEIVSWLDKNQSASKDEYEHHMKELEGVCKPVMSKIY 2011
             PAVGIDLGTT+SCVGVFQHGKVEII NDQGNRTTPS+VAF DTERLIGDAAKNQ AMNP NTVFDAKRLIGR+FD+  VQ+DMKH+ F VVN  GRPK+QVE+KGE+K+F  EE+SSMVL KMKE AEAY+GK V NAVVTVPAYFNDSQRQATKDAG IAGLNVLRIINEPTAAAIAYGLDKK   E+NVLIFDLGGGTFDVSIL+I+DGIFEVKSTAGDTHLGGEDFDNRMV+HFI EFKRKHKKDISENKRAVRRLRTACERAKRTLSSS QA+IE+DSL+EG+DFYTSITRARFEEL ADLFR TLDPVEK+LRDAK+DK+ IH+IVLVGGSTRIPK+QKLLQD+FNGKELNKSINPDEAVAYGAAVQAAILSGDKS+ VQDLLLLDV PLSLGIETAGGVMT LIKRN+TIPTKQTQTF+TY+DNQPGVLIQV+EGERAMTKDNNLLGKFEL+GIPPAPRGVPQIEVTFDIDANGILNVSAV+K TGKENKITITNDKGRLSKEDIERMV +AEKYK EDE+Q++++SSKN+LESYAF +K+ +EDEKL+ K   E+KQ + DKC+EI++WLDKNQ+A K+E+EH  KELE VC P+++K+Y
Sbjct:    4 GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLQGKINDEDKQKILDKCNEIINWLDKNQTAEKEEFEHQQKELEKVCNPIITKLY 611          
BLAST of Heat shock cognate 70 kDa protein vs. TrEMBL
Match: A0A0R3SCM2 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS2346 PE=3 SV=1)

HSP 1 Score: 1015.76 bits (2625), Expect = 0.000e+0
Identity = 518/644 (80.43%), Postives = 589/644 (91.46%), Query Frame = 2
Query:  188 APAVGIDLGTTFSCVGVFQHGKVEIIGNDQGNRTTPSFVAFNDTERLIGDAAKNQAAMNPANTVFDAKRLIGRKFDEPSVQADMKHFSFNVVNVEGRPKIQVEFKGESKTFSAEEISSMVLLKMKETAEAYIGKEVKNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKSSEEKNVLIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRMVDHFIQEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSAQANIEVDSLFEGLDFYTSITRARFEELCADLFRSTLDPVEKSLRDAKMDKNAIHEIVLVGGSTRIPKVQKLLQDYFNGKELNKSINPDEXXXXXXXXXXXILSGDKSXXXXXXXXXXXXXXXXGIETAGGVMTALIKRNSTIPTKQTQTFSTYADNQPGVLIQVFEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKEDIERMVNDAXXXXXXXXXXXXRISSKNALESYAFQVKSAMEDEKLKDKFTAEEKQTVTDKCSEIVSWLDKNQSASKDEYEHHMKELEGVCKPVMSKIY-----GAGMPSGMPFEMPTEMPASGDKSGPSIEELD 2104
            APAVGIDLGTTFSCVGVFQHGKVEII NDQGNRTTPS+VAF DTERLIGDAAKNQ AMNP NTVFDAKRLIGR+FD+P+VQ DMKH+ F+V N +G+PKI+VEFKGE K F  EEISSMVL KMKETAEAYIGK V +AV+TVPAYFNDSQRQATKDAG I+G+NVLRIINEPTAAAIAYGLDKK   E+NVLIFDLGGGTFDVSILSI+DGIFEVKSTAGDTHLGGEDFD+RMV+HF++EFKRKHKKD++ NKRA+RRLRTACERAKRTLSSS QANIE+DSL +G+DFYTSITRARFEELCADLFRSTL+PVEK+LRDAKMDK+++HE+VLVGGSTRIPKVQKLLQD+FNG+ELNKSINPDEAVAYGAAVQAAILSGDKS+ VQDLLLLDVAPLSLG+ETAGGVMT LIKRN+TIPTKQTQTF+TY+DNQPGVLIQV+EGERAMT+DNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSAV+K TGKENKITITNDKGRLSKE+IERMV D+EKYK EDE+Q++R+++KNALESYAF +KS +EDEK+K+K +  +++T+ +KC EIV+WLD NQ+A K+EYEH  KELEG+C PV++K+Y      +GMPSGMP   P     +G  +GP+IEE+D
Sbjct:    4 APAVGIDLGTTFSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDPTVQGDMKHWPFHVANCKGKPKIEVEFKGEKKAFFPEEISSMVLKKMKETAEAYIGKTVTDAVITVPAYFNDSQRQATKDAGVISGMNVLRIINEPTAAAIAYGLDKKVGSERNVLIFDLGGGTFDVSILSIEDGIFEVKSTAGDTHLGGEDFDSRMVNHFVEEFKRKHKKDLTTNKRAIRRLRTACERAKRTLSSSTQANIEIDSLMDGIDFYTSITRARFEELCADLFRSTLEPVEKALRDAKMDKSSVHEVVLVGGSTRIPKVQKLLQDFFNGRELNKSINPDEAVAYGAAVQAAILSGDKSEAVQDLLLLDVAPLSLGLETAGGVMTTLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTRDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEEIERMVIDSEKYKMEDEKQRDRVTAKNALESYAFTMKSTVEDEKVKEKISEADRKTIIEKCKEIVTWLDANQTAEKEEYEHKQKELEGICNPVITKMYQEVGGASGMPSGMPGGFPG--GDTGATAGPTIEEVD 645          
BLAST of Heat shock cognate 70 kDa protein vs. TrEMBL
Match: A0A2C9JTE2 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106067477 PE=3 SV=1)

HSP 1 Score: 1009.21 bits (2608), Expect = 0.000e+0
Identity = 525/646 (81.27%), Postives = 581/646 (89.94%), Query Frame = 2
Query:  188 APAVGIDLGTTFSCVGVFQHGKVEIIGNDQGNRTTPSFVAFNDTERLIGDAAKNQAAMNPANTVFDAKRLIGRKFDEPSVQADMKHFSFNVVNVEGRPKIQVEFKGESKTFSAEEISSMVLLKMKETAEAYIGKEVKNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKSSEEKNVLIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRMVDHFIQEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSAQANIEVDSLFEGLDFYTSITRARFEELCADLFRSTLDPVEKSLRDAKMDKNAIHEIVLVGGSTRIPKVQKLLQDYFNGKELNKSINPDEXXXXXXXXXXXILSGDKSXXXXXXXXXXXXXXXXGIETAGGVMTALIKRNSTIPTKQTQTFSTYADNQPGVLIQVFEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKEDIERMVNDAXXXXXXXXXXXXRISSKNALESYAFQVKSAMEDEKLKDKFTAEEKQTVTDKCSEIVSWLDKNQSASKDEYEHHMKELEGVCKPVMSKIY-----GAGMP--SGMPFEMPTEMPASGDKSGPSIEELD 2104
            APAVGIDLGTT+SCVGVFQHGKVEII NDQGNRTTPS+VAF D ERLIGDAAKNQ AMNP NTVFDAKRLIGR+FD+P+V +DMKH+ F V+N  G+PKI+VE+KGE KTF  EEISSMVL KMKETAEAY+GK V +AVVTVPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKK   E+NVLIFDLGGGTFDVSIL+I+DGIFEVKSTAGDTHLGGEDFDNRMV+HFIQEFKRKHKKDISENKRAVRRLRTACERAKRTLSSS QANIE+DSLFEG+DFYTSITRARFEEL ADLFR TL+PVEKSLRDAK+DK  +HEIVLVGGSTRIPK+QKLLQD+FNGKELNKSINPDEAVAYGAAVQAAIL GDKS+ VQDLLLLDVAPLSLGIETAGGVMTALIKRN+TIPTKQTQTF+TY+DNQPGVLIQV+EGERAMTKDNNLLGKFEL+GIPPAPRGVPQIEVTFDIDANGILNVSA +K TGKENKITITNDKGRLSKE+IERMVNDAEKYK EDE+QK RIS+KNALESYAF +KS +EDEKLKDK +A++K+ + DKC+EI+ WLD NQ A ++E++H  KE+EGVC P+++K+Y       GMP  SG           +G  SGP+IEE+D
Sbjct:    4 APAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDNERLIGDAAKNQVAMNPENTVFDAKRLIGRRFDDPTVASDMKHWPFTVINEGGKPKIRVEYKGEKKTFFPEEISSMVLTKMKETAEAYLGKTVTDAVVTVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKVGGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQANIEIDSLFEGIDFYTSITRARFEELNADLFRGTLEPVEKSLRDAKLDKAQVHEIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILHGDKSEEVQDLLLLDVAPLSLGIETAGGVMTALIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAADKSTGKENKITITNDKGRLSKEEIERMVNDAEKYKNEDEKQKTRISAKNALESYAFHMKSTVEDEKLKDKISADDKKIIIDKCNEIIHWLDANQLADEEEFQHKQKEIEGVCNPIITKLYQGMGGAGGMPDFSGAAGAGAQHSAGTGGGSGPTIEEVD 649          
BLAST of Heat shock cognate 70 kDa protein vs. TrEMBL
Match: A0A158P1Z1 (Uncharacterized protein OS=Atta cephalotes OX=12957 GN=105627126 PE=3 SV=1)

HSP 1 Score: 1008.44 bits (2606), Expect = 0.000e+0
Identity = 515/639 (80.59%), Postives = 580/639 (90.77%), Query Frame = 2
Query:  188 APAVGIDLGTTFSCVGVFQHGKVEIIGNDQGNRTTPSFVAFNDTERLIGDAAKNQAAMNPANTVFDAKRLIGRKFDEPSVQADMKHFSFNVVNVEGRPKIQVEFKGESKTFSAEEISSMVLLKMKETAEAYIGKEVKNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKSSEEKNVLIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRMVDHFIQEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSAQANIEVDSLFEGLDFYTSITRARFEELCADLFRSTLDPVEKSLRDAKMDKNAIHEIVLVGGSTRIPKVQKLLQDYFNGKELNKSINPDEXXXXXXXXXXXILSGDKSXXXXXXXXXXXXXXXXGIETAGGVMTALIKRNSTIPTKQTQTFSTYADNQPGVLIQVFEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKEDIERMVNDAXXXXXXXXXXXXRISSKNALESYAFQVKSAMEDEKLKDKFTAEEKQTVTDKCSEIVSWLDKNQSASKDEYEHHMKELEGVCKPVMSKIYGAGMPSGMPFEMPTEMPASGDKSGPSIEELD 2104
            APAVGIDLGTT+SCVGVFQHGKVEII NDQGNRTTPS+VAF +TERLIGDAAKNQ AMNP NT+FDAKRLIGR+F++P++ ADMKH+ F V+N  G+PKIQV++KGE+KTF  EE+SSMVL+KMKETAEAY+GK V NAV+TVPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKK++ E+NVLIFDLGGGTFDVSIL+I+DGIFEVKSTAGDTHLGGEDFDNRMV+HF+QEFKRK+KKD++ NKRA+RRLRTACERAKRTLSSS QA+IE+DSL+EG+DFYTSITRARFEELCADLFR TL+PVEKSLRDAKMDK  IH+IVLVGGSTRIPK+QKLLQD+FNGKELNKSINPDEAVAYGAAVQAAIL GDKS+ VQDLLLLDV PLSLGIETAGGVMTALIKRN+TIPTKQTQTF+TYADNQPGVLIQV+EGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSAV+K TGKENKITITNDKGRLSKEDIERMVN+AEKY+ EDE+QKE IS+KN LESY F +KS +EDEKLKDK +A +KQT+ DKC++I+ WLD NQ A K+EYEH  KELE +C P+++K+Y                P+SG  SGP+IEE+D
Sbjct:    4 APAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTETERLIGDAAKNQVAMNPNNTIFDAKRLIGRRFEDPTILADMKHWPFTVINDTGKPKIQVQYKGETKTFFPEEVSSMVLVKMKETAEAYLGKTVTNAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKATGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDLTSNKRALRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELCADLFRGTLEPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILHGDKSEEVQDLLLLDVTPLSLGIETAGGVMTALIKRNTTIPTKQTQTFTTYADNQPGVLIQVYEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVNEAEKYRSEDEKQKETISAKNGLESYCFNMKSTVEDEKLKDKISASDKQTILDKCNDIIKWLDANQLADKEEYEHKQKELEAICNPIVTKLYQGAAGG----ATAGGAPSSGGASGPTIEEVD 638          
BLAST of Heat shock cognate 70 kDa protein vs. TrEMBL
Match: A0A151IKI9 (Heat shock 70 kDa protein cognate 4 OS=Cyphomyrmex costatus OX=456900 GN=ALC62_04107 PE=3 SV=1)

HSP 1 Score: 1008.05 bits (2605), Expect = 0.000e+0
Identity = 520/648 (80.25%), Postives = 584/648 (90.12%), Query Frame = 2
Query:  188 APAVGIDLGTTFSCVGVFQHGKVEIIGNDQGNRTTPSFVAFNDTERLIGDAAKNQAAMNPANTVFDAKRLIGRKFDEPSVQADMKHFSFNVVNVEGRPKIQVEFKGESKTFSAEEISSMVLLKMKETAEAYIGKEVKNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKSSEEKNVLIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRMVDHFIQEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSAQANIEVDSLFEGLDFYTSITRARFEELCADLFRSTLDPVEKSLRDAKMDKNAIHEIVLVGGSTRIPKVQKLLQDYFNGKELNKSINPDEXXXXXXXXXXXILSGDKSXXXXXXXXXXXXXXXXGIETAGGVMTALIKRNSTIPTKQTQTFSTYADNQPGVLIQVFEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKEDIERMVNDAXXXXXXXXXXXXRISSKNALESYAFQVKSAMEDEKLKDKFTAEEKQTVTDKCSEIVSWLDKNQSASKDEYEHHMKELEGVCKPVMSKIY---------GAGMPSGMPFEMPTEMPASGDKSGPSIEELD 2104
            APAVGIDLGTT+SCVGVFQHGKVEII NDQGNRTTPS+VAF +TERLIGDAAKNQ AMNP NT+FDAKRLIGR+F++P+V ADMKH+ F V+N  G+PKIQV++KGE+KTF  EE+SSMVL+KMKETAEAY+GK V NAV+TVPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKK++ E+NVLIFDLGGGTFDVSIL+I+DGIFEVKSTAGDTHLGGEDFDNRMV+HF+QEFKRK+KKD++ NKRA+RRLRTACERAKRTLSSS QA+IE+DSL+EG+DFYTSITRARFEELCADLFR TL+PVEKSLRDAKMDK  IH+IVLVGGSTRIPK+QKLLQD+FNGKELNKSINPDEAVAYGAAVQAAIL GDKS+ VQDLLLLDV PLSLGIETAGGVMTALIKRN+TIPTKQTQTF+TYADNQPGVLIQV+EGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSAV+K TGKENKITITNDKGRLSKEDIERMVN+AEKY+ EDE+QKE IS+KN LESY F +KS +EDEKLKDK +A +KQT+ DKC++I+ WLD NQ A K+EYEH  KELEG+C P+++K+Y           G   G     P   P+SG  SGP+IEE+D
Sbjct:    4 APAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTETERLIGDAAKNQVAMNPNNTIFDAKRLIGRRFEDPTVLADMKHWPFTVINDSGKPKIQVQYKGETKTFFPEEVSSMVLVKMKETAEAYLGKTVTNAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKATGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKYKKDLTSNKRALRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELCADLFRGTLEPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILHGDKSEEVQDLLLLDVTPLSLGIETAGGVMTALIKRNTTIPTKQTQTFTTYADNQPGVLIQVYEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVNEAEKYRSEDEKQKETISAKNGLESYCFNMKSTVEDEKLKDKISASDKQTILDKCNDIIKWLDANQLADKEEYEHKQKELEGICNPIVTKLYQGAGGMPGGMPGGFPGAGGAAPGGTPSSGGASGPTIEEVD 651          
BLAST of Heat shock cognate 70 kDa protein vs. TrEMBL
Match: A0A0X3PU49 (Heat shock cognate protein OS=Schistocephalus solidus OX=70667 GN=HSP70 PE=3 SV=1)

HSP 1 Score: 1006.9 bits (2602), Expect = 0.000e+0
Identity = 512/647 (79.13%), Postives = 589/647 (91.04%), Query Frame = 2
Query:  188 APAVGIDLGTTFSCVGVFQHGKVEIIGNDQGNRTTPSFVAFNDTERLIGDAAKNQAAMNPANTVFDAKRLIGRKFDEPSVQADMKHFSFNVVNVEGRPKIQVEFKGESKTFSAEEISSMVLLKMKETAEAYIGKEVKNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKSSEEKNVLIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRMVDHFIQEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSAQANIEVDSLFEGLDFYTSITRARFEELCADLFRSTLDPVEKSLRDAKMDKNAIHEIVLVGGSTRIPKVQKLLQDYFNGKELNKSINPDEXXXXXXXXXXXILSGDKSXXXXXXXXXXXXXXXXGIETAGGVMTALIKRNSTIPTKQTQTFSTYADNQPGVLIQVFEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKEDIERMVNDAXXXXXXXXXXXXRISSKNALESYAFQVKSAMEDEKLKDKFTAEEKQTVTDKCSEIVSWLDKNQSASKDEYEHHMKELEGVCKPVMSKIY--GAGMPSGMPFEMPTEMPA--SGDKS----GPSIEELD 2104
            APAVGIDLGTTFSCVGVFQHGKVEII NDQGNRTTPS+VAF DTERLIGDAA+NQ AMNP+NTVFDAKRLIGR+FD+P+VQ+D KH+ F ++N  G+PKI+VE++GE K F+AEEISSMVL+KMKETAEAY+GK V +AV+TVPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKK   E+NVLIFDLGGGTFDVSILSI+DGIFEVKSTAGDTHLGGEDFD+R+V HF QEFKRKHKKD++ NKRAVRRLRTACERAKRTLSSSAQAN+E+DSL +G+DFYTSITRARFEELCADLFRSTLDPVEK+LRDAK+DK+++H++VLVGGSTRIPKVQKLLQD+FNGKELNKSINPDEAVAYGAAVQAAIL GDKS+ VQDLLLLDVAPLSLG+ETAGGVMTALIKRN+TIPTKQTQTF+TY+DNQPGVLIQV+EGERAMT+DNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSAV+K TGK+NKITITNDKGRLSKE+IERMVN+AEK+K EDE+Q++R+++KN+LESYA+ +KS +E+EK+KDK    ++Q +T+KC+E +SWL+KNQ A K+EYEH  KELE +C P+++K+Y    GMP GM   MP   P   SGD      GP+IEE+D
Sbjct:    4 APAVGIDLGTTFSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAARNQVAMNPSNTVFDAKRLIGRRFDDPAVQSDAKHWPFTIINSGGKPKIEVEYRGEKKQFNAEEISSMVLVKMKETAEAYLGKTVTDAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKVGTERNVLIFDLGGGTFDVSILSIEDGIFEVKSTAGDTHLGGEDFDSRLVSHFAQEFKRKHKKDLNTNKRAVRRLRTACERAKRTLSSSAQANVEIDSLMDGIDFYTSITRARFEELCADLFRSTLDPVEKALRDAKLDKSSVHDVVLVGGSTRIPKVQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILGGDKSEAVQDLLLLDVAPLSLGLETAGGVMTALIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTRDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKQNKITITNDKGRLSKEEIERMVNEAEKFKAEDEQQRDRVAAKNSLESYAYSMKSNVEEEKMKDKIPESDRQKITEKCNETISWLEKNQQADKEEYEHKQKELEQLCNPIITKMYQEAGGMPGGMSGNMPGGRPGGVSGDAGAGGRGPTIEEVD 650          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Cavefish
Match: hspa8 (heat shock cognate 71 kDa protein [Source:NCBI gene;Acc:103043364])

HSP 1 Score: 990.719 bits (2560), Expect = 0.000e+0
Identity = 502/608 (82.57%), Postives = 561/608 (92.27%), Query Frame = 2
Query:  188 APAVGIDLGTTFSCVGVFQHGKVEIIGNDQGNRTTPSFVAFNDTERLIGDAAKNQAAMNPANTVFDAKRLIGRKFDEPSVQADMKHFSFNVVNVEGRPKIQVEFKGESKTFSAEEISSMVLLKMKETAEAYIGKEVKNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKSSEEKNVLIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRMVDHFIQEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSAQANIEVDSLFEGLDFYTSITRARFEELCADLFRSTLDPVEKSLRDAKMDKNAIHEIVLVGGSTRIPKVQKLLQDYFNGKELNKSINPDEXXXXXXXXXXXILSGDKSXXXXXXXXXXXXXXXXGIETAGGVMTALIKRNSTIPTKQTQTFSTYADNQPGVLIQVFEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKEDIERMVNDAXXXXXXXXXXXXRISSKNALESYAFQVKSAMEDEKLKDKFTAEEKQTVTDKCSEIVSWLDKNQSASKDEYEHHMKELEGVCKPVMSKIY 2011
             PAVGIDLGTT+SCVGVFQHGKVEII NDQGNRTTPS+VAF DTERLIGDAAKNQ AMNP NT+FDAKRLIGR+FD+  VQ+DMKH+ F V+N   RPK+QV++KGE+K+F  EEISSMVL+KMKE AEAY+GK V NAV+TVPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKK   E+NVLIFDLGGGTFDVSIL+I+DGIFEVKSTAGDTHLGGEDFDNRMV+HFI EFKRKHKKDIS+NKRAVRRLRTACERAKRTLSSS QA+IE+DSL+EG+DFYTSITRARFEEL ADLFR TLDPVEKSLRDAKMDK  IH+IVLVGGSTRIPK+QKLLQD+FNGKELNKSINPDEAVAYGAAVQAAILSGDKS+ VQDLLLLDV PLSLGIETAGGVMT LIKRN+TIPTKQTQTF+TY+DNQPGVLIQV+EGERAMTKDNNLLGKFEL+GIPPAPRGVPQIEVTFDIDANGI+NVSA +K TGKENKITITNDKGRLSKEDIERMV +AEKYK ED+ Q++++SSKN+LESYAF +KS +EDEKLK K + E+KQ + DKC+E++SWLDKNQ+A +DE+EH  KELE VC P+++K+Y
Sbjct:    4 GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTIFDAKRLIGRRFDDGVVQSDMKHWPFTVINDSTRPKVQVDYKGEAKSFYPEEISSMVLVKMKEIAEAYLGKTVTNAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKVGSERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFITEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGVDFYTSITRARFEELNADLFRGTLDPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGIMNVSAADKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDDVQRDKVSSKNSLESYAFNMKSTVEDEKLKGKISDEDKQKIMDKCNEVISWLDKNQTAERDEFEHQQKELEKVCNPIITKLY 611          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Cavefish
Match: hspa8b (heat shock cognate 70 kDa protein-like [Source:NCBI gene;Acc:103047344])

HSP 1 Score: 988.408 bits (2554), Expect = 0.000e+0
Identity = 502/608 (82.57%), Postives = 561/608 (92.27%), Query Frame = 2
Query:  188 APAVGIDLGTTFSCVGVFQHGKVEIIGNDQGNRTTPSFVAFNDTERLIGDAAKNQAAMNPANTVFDAKRLIGRKFDEPSVQADMKHFSFNVVNVEGRPKIQVEFKGESKTFSAEEISSMVLLKMKETAEAYIGKEVKNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKSSEEKNVLIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRMVDHFIQEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSAQANIEVDSLFEGLDFYTSITRARFEELCADLFRSTLDPVEKSLRDAKMDKNAIHEIVLVGGSTRIPKVQKLLQDYFNGKELNKSINPDEXXXXXXXXXXXILSGDKSXXXXXXXXXXXXXXXXGIETAGGVMTALIKRNSTIPTKQTQTFSTYADNQPGVLIQVFEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKEDIERMVNDAXXXXXXXXXXXXRISSKNALESYAFQVKSAMEDEKLKDKFTAEEKQTVTDKCSEIVSWLDKNQSASKDEYEHHMKELEGVCKPVMSKIY 2011
             PAVGIDLGTT+SCVGVFQHGKVEII NDQGNRTTPS+VAF DTERLIGDAAKNQ AMNP NTVFDAKRLIGR+FD+  VQ+DMKH+ F V+N   RPK+QVE+KGE+K F  EEISSMVL+KMKE AEAY+GK V NAVVTVPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKK   E+NVLIFDLGGGTFDVSIL+I+DGIFEVKSTAGDTHLGGEDFDNRMV+HFI EFKRK+KKDIS+NKRAVRRLRTACERAKRTLSSS QA+IE+DSL+EG+DFYTSITRARFEEL ADLFR TLDPVEKSLRDAK+DK+ IH+IVLVGGSTRIPK+QKLLQD+FNGKELNKSINPDEAVAYGAAVQAAIL+GDKS+ VQDLLLLDV PLSLGIETAGGVMT LIKRN+TIPTKQTQTF+TY+DNQPGVLIQV+EGERAMTKDNNLLGKFEL+GIPPAPRGVPQIEVTFDIDANGI+NVSAV+K TGKENKITITNDKGRLSKE+IERMV DAEKYK ED+ Q++++++KN LESYAF +KS +EDEKLK K + E+KQ + DKC+E++SWLDKNQ+A KDE+EH  KELE VC P+++K+Y
Sbjct:    4 GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFTVINDSTRPKVQVEYKGETKAFYPEEISSMVLVKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKVGSERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFISEFKRKYKKDISDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGVDFYTSITRARFEELNADLFRGTLDPVEKSLRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILAGDKSENVQDLLLLDVTPLSLGIETAGGVMTILIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGIMNVSAVDKSTGKENKITITNDKGRLSKEEIERMVQDAEKYKAEDDVQRDKVAAKNGLESYAFNMKSTVEDEKLKGKISDEDKQKILDKCNEVISWLDKNQTAEKDEFEHQQKELEKVCNPIITKLY 611          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Cavefish
Match: ENSAMXT00000004733.2 (pep primary_assembly:Astyanax_mexicanus-2.0:20:27541457:27560661:-1 gene:ENSAMXG00000004628.2 transcript:ENSAMXT00000004733.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 981.86 bits (2537), Expect = 0.000e+0
Identity = 498/606 (82.18%), Postives = 562/606 (92.74%), Query Frame = 2
Query:  194 AVGIDLGTTFSCVGVFQHGKVEIIGNDQGNRTTPSFVAFNDTERLIGDAAKNQAAMNPANTVFDAKRLIGRKFDEPSVQADMKHFSFNVVNVEGRPKIQVEFKGESKTFSAEEISSMVLLKMKETAEAYIGKEVKNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKSSEEKNVLIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRMVDHFIQEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSAQANIEVDSLFEGLDFYTSITRARFEELCADLFRSTLDPVEKSLRDAKMDKNAIHEIVLVGGSTRIPKVQKLLQDYFNGKELNKSINPDEXXXXXXXXXXXILSGDKSXXXXXXXXXXXXXXXXGIETAGGVMTALIKRNSTIPTKQTQTFSTYADNQPGVLIQVFEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKEDIERMVNDAXXXXXXXXXXXXRISSKNALESYAFQVKSAMEDEKLKDKFTAEEKQTVTDKCSEIVSWLDKNQSASKDEYEHHMKELEGVCKPVMSKIY 2011
            AVGIDLGTT+SCVG+FQHGKVEII NDQGNRTTPS+VAF DTERLIGDAAKNQ AMNP NT+FDAKRLIGR+F++  VQ+DMKH+ F V++  GRPK++VE+KGE+K F  EEISSMVL+KMKE AEAY+GK + NAV+TVPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKK   E+NVLIFDLGGGTFDVSIL+I+DGIFEVKSTAGDTHLGGEDFDNRMV+HFI EFKRK+KKDIS+NKRAVRRLRTACERAKRTLSSS QA+IE+DSL+EG+DFYTSITRARFEEL ADLFR TLDPVEKSLRDAK+DK  IH+IVLVGGSTRIPK+QKLLQD+FNGKELNKSINPDEAVAYGAAVQAAILSGDKS+ VQDLLLLDV PLSLGIETAGGVMTALIKRN+TIPTKQTQTF+TY+DNQPGVLIQV+EGERAMTKDNNLLGKFEL+GIPPAPRGVPQIEVTFDIDANGILNVSAV+K TGKENKITITNDKGRLSKEDIERMV +AEKYK ED+ Q++++SSKN+LESYAF +KS +ED+KL+ K + E+KQ + DKC+EI+SWLDKNQ+A K+EYEH  +ELE VC P+++K+Y
Sbjct:    6 AVGIDLGTTYSCVGIFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTIFDAKRLIGRRFEDTVVQSDMKHWPFKVISDGGRPKVEVEYKGETKNFYPEEISSMVLVKMKEIAEAYLGKSINNAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKVGSERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKYKKDISDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGVDFYTSITRARFEELNADLFRGTLDPVEKSLRDAKLDKAQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTALIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDDVQRDKVSSKNSLESYAFNMKSTVEDDKLQGKISDEDKQKILDKCNEIISWLDKNQTAEKEEYEHQQQELEKVCNPIITKLY 611          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Cavefish
Match: ENSAMXT00000037064.1 (heat shock 70 kDa protein [Source:NCBI gene;Acc:111193176])

HSP 1 Score: 977.237 bits (2525), Expect = 0.000e+0
Identity = 496/637 (77.86%), Postives = 576/637 (90.42%), Query Frame = 2
Query:  194 AVGIDLGTTFSCVGVFQHGKVEIIGNDQGNRTTPSFVAFNDTERLIGDAAKNQAAMNPANTVFDAKRLIGRKFDEPSVQADMKHFSFNVVNVEGRPKIQVEFKGESKTFSAEEISSMVLLKMKETAEAYIGKEVKNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKSSEEKNVLIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRMVDHFIQEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSAQANIEVDSLFEGLDFYTSITRARFEELCADLFRSTLDPVEKSLRDAKMDKNAIHEIVLVGGSTRIPKVQKLLQDYFNGKELNKSINPDEXXXXXXXXXXXILSGDKSXXXXXXXXXXXXXXXXGIETAGGVMTALIKRNSTIPTKQTQTFSTYADNQPGVLIQVFEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKEDIERMVNDAXXXXXXXXXXXXRISSKNALESYAFQVKSAMEDEKLKDKFTAEEKQTVTDKCSEIVSWLDKNQSASKDEYEHHMKELEGVCKPVMSKIYGAGMPSGMPFEMPTEMPASGDKSGPSIEELD 2104
            A+GIDLGTT+SCVGVFQHGKVEII NDQGNRTTPS+VAF DTERLIGDAAKNQ AMNP NTVFDAKRLIGRKFD+P VQ+DMKH+ F VV+  G+PK+QVE+KGE KTF+ EEISSMVL+KMKE AEAY+G++V NAV+TVPAYFNDSQRQATKDAG IAGLNVLRIINEPTAAAIAYGLDK    E++VLIFDLGGGTFDVSIL+I+DGIFEVK+TAGDTHLGGEDFDNR+V+HF++EFKRKHKKDIS+NKRA+RRLRTACERAKRTLSSS+QA+IE+DSL EG+DFYTSITRARFEE+C+DLFR TL+PVEK+LRDAKMDK+ IHEIVLVGGSTRIPK+QKLLQD+FNG++LNKSINPDEAVAYGAAVQAAIL GD S  VQDLLLLDVAPLSLGIETAGGVM  LIKRN+TIPTKQTQTFSTYADNQPGVLIQVFEGERAMTKDNNLLGKF+L+GIPPAPRGVPQIEVTFDIDANGILNVSAV+K TGK+NKITITNDKGRLSKE+IERMV +A++YK ED+ Q+E+I++KN+LES+AF +K+++EDE LK K + ++K+ V +KC++ +SWL+ NQ A K+E+EH +KELE VC P+++K+Y  GMP+G          + G   GP+IEE+D
Sbjct:    8 AIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDDPVVQSDMKHWPFQVVSDGGKPKVQVEYKGEQKTFNPEEISSMVLVKMKEIAEAYLGQKVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKGKKGERHVLIFDLGGGTFDVSILTIEDGIFEVKATAGDTHLGGEDFDNRLVNHFVEEFKRKHKKDISQNKRALRRLRTACERAKRTLSSSSQASIEIDSLHEGVDFYTSITRARFEEMCSDLFRGTLEPVEKALRDAKMDKSQIHEIVLVGGSTRIPKIQKLLQDFFNGRDLNKSINPDEAVAYGAAVQAAILMGDTSGNVQDLLLLDVAPLSLGIETAGGVMATLIKRNTTIPTKQTQTFSTYADNQPGVLIQVFEGERAMTKDNNLLGKFDLTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKQNKITITNDKGRLSKEEIERMVQEADQYKAEDDLQREKIAAKNSLESFAFNMKNSVEDENLKGKISEDDKKKVIEKCNQAISWLENNQLADKEEFEHQLKELEKVCNPIITKLYQGGMPAG-GCGAQARASSGGSAQGPTIEEVD 643          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Cavefish
Match: hsc70 (heat shock cognate 71 kDa protein-like [Source:NCBI gene;Acc:103045816])

HSP 1 Score: 974.541 bits (2518), Expect = 0.000e+0
Identity = 494/608 (81.25%), Postives = 560/608 (92.11%), Query Frame = 2
Query:  188 APAVGIDLGTTFSCVGVFQHGKVEIIGNDQGNRTTPSFVAFNDTERLIGDAAKNQAAMNPANTVFDAKRLIGRKFDEPSVQADMKHFSFNVVNVEGRPKIQVEFKGESKTFSAEEISSMVLLKMKETAEAYIGKEVKNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKSSEEKNVLIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRMVDHFIQEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSAQANIEVDSLFEGLDFYTSITRARFEELCADLFRSTLDPVEKSLRDAKMDKNAIHEIVLVGGSTRIPKVQKLLQDYFNGKELNKSINPDEXXXXXXXXXXXILSGDKSXXXXXXXXXXXXXXXXGIETAGGVMTALIKRNSTIPTKQTQTFSTYADNQPGVLIQVFEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKEDIERMVNDAXXXXXXXXXXXXRISSKNALESYAFQVKSAMEDEKLKDKFTAEEKQTVTDKCSEIVSWLDKNQSASKDEYEHHMKELEGVCKPVMSKIY 2011
             PAVGIDLGTT+SCVG+FQHGKVEII NDQGNRTTPS+VAF DTERLIGDAAKNQ AMNP NTVFDAKRLIGR+FD+  VQ+DMKH+ F VV+  G+PK++VE+KGE KTF  EE+SSMVL KMKE +EAY+GK V NAV+TVPAYFNDSQRQATKDAG IAGLNVLRIINEPTAAAIAYGLDKK   E+NVLIFDLGGGTFDVSIL+I+DGIFEVKSTAGDTHLGGEDFDNRMV+HFI EFKRK KKDI+ NKRAVRRLRTACERAKRTLSSS QA+IE+DSL+EG+DFYTSITRARFEEL +DLFR TLDPVEK+LRDAK+DK  IH+IVLVGGSTRIPK+QKLLQD+FNG++LNKSINPDEAVAYGAAVQAAILSGDKS+ VQDLLLLDV PLSLGIETAGGVMT LIKRN+TIPTKQTQTF+TY+DNQPGVLIQV+EGERAMTKDNN+LGKFEL+GIPPAPRGVPQIEVTFDIDANGILNVSAV+K TGKENKITITNDKGRLSKEDIERMV +A++Y+ EDE Q+E+++SKN LES AF +KS +EDEKLKDK +AE+K+T+ DKC+E+++WLD+NQ+A K+EYEH  KELE VC P+++K+Y
Sbjct:    4 GPAVGIDLGTTYSCVGIFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRRFDDAVVQSDMKHWPFKVVSDGGKPKMEVEYKGEIKTFYPEEVSSMVLTKMKEISEAYLGKPVTNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFITEFKRKFKKDITGNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGVDFYTSITRARFEELNSDLFRGTLDPVEKALRDAKLDKAQIHDIVLVGGSTRIPKIQKLLQDFFNGRDLNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNILGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEADQYRAEDEAQREKVTSKNTLESLAFNMKSTVEDEKLKDKISAEDKKTIVDKCNEVIAWLDRNQTAEKEEYEHQQKELEKVCNPIITKLY 611          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Sea Lamprey
Match: hspa5 (heat shock protein 5 [Source:NCBI gene;Acc:378848])

HSP 1 Score: 743.806 bits (1919), Expect = 0.000e+0
Identity = 391/608 (64.31%), Postives = 497/608 (81.74%), Query Frame = 2
Query:  197 VGIDLGTTFSCVGVFQHGKVEIIGNDQGNRTTPSFVAFN-DTERLIGDAAKNQAAMNPANTVFDAKRLIGRKFDEPSVQADMKHFSFNVVNVEGRPKIQVE-FKGESKTFSAEEISSMVLLKMKETAEAYIGKEVKNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKSSEEKNVLIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRMVDHFIQEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSAQANIEVDSLFEGLDFYTSITRARFEELCADLFRSTLDPVEKSLRDAKMDKNAIHEIVLVGGSTRIPKVQKLLQDYFNGKELNKSINPDEXXXXXXXXXXXILSGDKSXXXXXXXXXXXXXXXXGIETAGGVMTALIKRNSTIPTKQTQTFSTYADNQPGVLIQVFEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKEDIERMVNDAXXXXXXXXXXXXRISSKNALESYAFQVKSAMED-EKLKDKFTAEEKQTVTDKCSEIVSWLDKNQSASKDEYEHHMKELEGVCKPVMSKIY 2011
            +GIDLGTT+SCVGVF++G+VEII NDQGNR TPS+VAF  + ERLIGDAAKNQ   NP NTVFDAKRLIGR + +P+VQ D+K + F V+  +G+P IQVE   GESKTF+ EEIS+MVL KMKETAEAY+GK+V +AVVTVPAYFND+QRQATKDAG IAGLNVLRIINEPTAAAIAYGLDKK  E KN+L+FDLGGGTFDVS+L+ID G+FEV +T GDTHLGGEDFD R+++HFI+ +K+K  KD+ ++ RAV++LR   E+AKRTLS+  QA I+++S ++G DF  ++TRA+FEEL  DLFRST+ PV+K + D+ + K  I EIVLVGGSTRIPK+Q+L+++ FNGKE ++ INPDEAVAYGAAVQA +LSG+ +    DL+LLDV PL+LGIET GGVMT LI RN+ +PTK++Q FST ADNQP V IQVFEGER MTKDN+LLGKF+L+GIPPAPRGVPQIEVTF+ID NGIL VSA +KGTG +NKITITND+ RL+ E+IERMV+DAE++  +D+  KER+ ++N LESYA+ +K+ + D EKL  K + E+++TV     + ++WL+ +Q A  D+++   KELE V +P++SK+Y
Sbjct:   36 IGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTAEGERLIGDAAKNQLTSNPENTVFDAKRLIGRSWTDPTVQHDIKFWPFTVLEKKGKPHIQVEVIAGESKTFAPEEISAMVLTKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKEGE-KNILVFDLGGGTFDVSLLTIDHGVFEVVATNGDTHLGGEDFDQRVMEHFIKLYKKKTGKDVRKDHRAVQKLRREVEKAKRTLSTQHQARIDIESFYDGDDFSETLTRAKFEELNMDLFRSTMKPVQKVMEDSDLKKTDIDEIVLVGGSTRIPKIQQLVKELFNGKEPSRGINPDEAVAYGAAVQAGVLSGEDN--TGDLVLLDVCPLTLGIETVGGVMTKLIPRNTVVPTKKSQIFSTAADNQPTVTIQVFEGERPMTKDNHLLGKFDLTGIPPAPRGVPQIEVTFEIDVNGILRVSAEDKGTGNKNKITITNDQNRLTPEEIERMVSDAERFADDDKRVKERVEARNELESYAYSLKNQIGDKEKLGGKLSDEDRETVEKAVEDKIAWLEGHQEADTDDFKAQKKELEEVVQPIVSKLY 640          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Sea Lamprey
Match: hspa9 (heat shock protein 9 [Source:ZFIN;Acc:ZDB-GENE-030828-12])

HSP 1 Score: 529.635 bits (1363), Expect = 1.236e-180
Identity = 301/601 (50.08%), Postives = 415/601 (69.05%), Query Frame = 2
Query:  197 VGIDLGTTFSCVGVFQHGKVEIIGNDQGNRTTPSFVAFN-DTERLIGDAAKNQAAMNPANTVFDAKRLIGRKFDEPSVQADMKHFSFNVVNVEGRPKIQVEFKGESKTFSAEEISSMVLLKMKETAEAYIGKEVKNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKSSEEKNVLIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRMVDHFIQEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSAQANIEVDSLFEGLD------FYTSITRARFEELCADLFRSTLDPVEKSLRDAKMDKNAIHEIVLVGGSTRIPKVQKLLQDYFNGKELNKSINPDEXXXXXXXXXXXILSGDKSXXXXXXXXXXXXXXXXGIETAGGVMTALIKRNSTIPTKQTQTFSTYADNQPGVLIQVFEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKEDIERMVNDAXXXXXXXXXXXXRISSKNALESYAFQVKSAMEDEKLKDKFTAEEKQTVTDKCSEIVSWLDKNQSASKDEYEHHMKELE 1978
            +GIDLGTT SCV V +  + +++ N +G RTTPS VAF  D ERL+G  AK QA  NP NT +  KRLIGR+FD+  VQ DM + S+ +V         VE  G  K +S  +I + VLLKMKETAE ++G  VKNAV+TVPAYFNDSQRQATKDAG I+GLNVLR+INEPTAAA+AYGLDK  +++K + ++DLGGGTFD+SIL I  G+FEVKST GDT LGGEDFDN ++ + ++EFKR+   D++++  A++R+R A E+AK  LSSS Q +I +  L   +D          +TR++FE +  DL R T+ P +K+L+D ++ K+ I +++LVGG TR+PKVQ+ +Q+ F G+  +K++NPDEAVA GAA+Q  +L+GD +DV+   +         GIET GGV T LI RN+TIPTK++Q FST AD Q  V I+VF+GER M  DN  LG+F L G+PPAPRGVPQIEVTFDIDANGI++VSA +KGTG+E +I I +  G LSK++IE MV +AEKY +ED  +K+R+ + N  E     ++S ME+   KD+  A+E   + ++ +++   L +  + + +  +     L+
Sbjct:   56 IGIDLGTTNSCVAVMEGKQAKVLENAEGARTTPSVVAFTADGERLVGMPAKRQAVTNPNNTFYATKRLIGRRFDDSDVQKDMNNLSYKIVRAS-NGDAWVEAHG--KMYSPSQIGAFVLLKMKETAENFMGTSVKNAVITVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDK--ADDKVIAVYDLGGGTFDISILEIQKGVFEVKSTNGDTFLGGEDFDNALLKYIVKEFKRESGVDLTKDSMALQRVREAAEKAKCELSSSLQTDINLPYLT--MDSSGPKHLNMKLTRSQFENIVGDLIRKTIAPCQKALQDGEVAKSDIGDVILVGGMTRMPKVQQTVQEVF-GRAPSKAVNPDEAVAIGAAIQGGVLAGDVTDVLLLDVTPLSL----GIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVFQGEREMAGDNKNLGQFTLVGVPPAPRGVPQIEVTFDIDANGIVHVSAKDKGTGREQQIVIQSSGG-LSKDEIENMVKNAEKYAEEDRRRKDRVEAVNQAEGIVHDIESKMEE--FKDQLPADECTKLKEEIAKVRELLTRKDTETGEAIKQAASTLQ 641          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Sea Lamprey
Match: hspa14 (heat shock protein 14 [Source:NCBI gene;Acc:565232])

HSP 1 Score: 295.434 bits (755), Expect = 4.180e-92
Identity = 171/505 (33.86%), Postives = 277/505 (54.85%), Query Frame = 2
Query:  194 AVGIDLGTTFSCVGVFQHGKVEIIGNDQGNRTTPSFVAFNDTERLIGDAAKNQAAMNPANTVFDAKRLIGRKFDEPSVQADMKHFSFNVVNVEGRPKIQVEFKGESKTFSAEEISSMVLLKMKETAEAYIGKEVKNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKSSEEK-NVLIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRMVDHFIQEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSAQANIEVDSLFEGLDFYTSITRARFEELCADLFRSTLDPVEKSLRDAKMDKNAIHEIVLVGGSTRIPKVQKLLQDYFNGKELNKSINPDEXXXXXXXXXXXILSGDKSXXXXXXXXXXXXXXXXGI-----ETAGGVMTALIKRNSTIPTKQTQTFSTYADNQPGVLIQVFEG-ERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITI 1687
            AVG+ LG+T +CV +++ G+ ++I ND G+R TP+ VAF D+E+++G AAK     N   TV   KR++G +F++  VQ  +   S  V+  +G P   +      K  +  E+++++L KMKETA   +G + K+AV+T P  F   Q    + A   AG NVLRI++EP AA +A+G+ ++SS  K  VL++ LGG     + + ++ G++ V  +  D  +GGE+F   + ++   EF++ H++D+  N RA+ +L T  E AK  LS+ A +N  VDSL +GLDF  +ITRARF+ LC+ LF+ +L P+   L    +  +   ++VL GGS RIPK+Q+LLQ+ F G EL  SI  DE +A GAA +A IL G  +   +   L         +     E      T +    + +P ++  TF       P VL+ V+EG  +  + +   L +  L  +     G+  I   F +  +G L ++  ++ +G    +T+
Sbjct:    3 AVGVHLGSTCACVAIYKDGRADVIANDAGDRVTPAMVAFRDSEKIVGLAAKQGRIRNATTTVVGVKRILGHRFEDDVVQKYISSSSCPVIEKDGCPVFSINNGTVKKHITRHEVATLILQKMKETALFAVGADAKDAVITTPLNFTTQQVDELRQAAESAGFNVLRILSEPAAALLAFGIGQESSHSKCKVLVYKLGGTCAYATAIEVNSGLYRVLGSVSDDTVGGEEFTEALAEYLATEFQKFHRQDLRGNSRAMMKLHTNAEMAKHVLSTMAISNCFVDSLHDGLDFECNITRARFDSLCSVLFQQSLQPIHDLLAQINLTTSDFQKVVLCGGSARIPKLQQLLQEQFVGSELMCSIPVDEVIALGAAAEAGILLGRDAVRFEPEALSIECASLDILVKEQDEAGQDCYTVVFPVGTPLPARRQHTFQA-PGTLPSVLVDVYEGVAKGSSFEGVHLAQLVLKDLQQQDNGLRDISTVFTMKRDGSLLITCTDQLSGTSETVTV 506          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Sea Lamprey
Match: hspa13 (heat shock protein 70 family, member 13 [Source:ZFIN;Acc:ZDB-GENE-070410-58])

HSP 1 Score: 243.432 bits (620), Expect = 6.253e-73
Identity = 154/422 (36.49%), Postives = 230/422 (54.50%), Query Frame = 2
Query:  197 VGIDLGTTFSCVGVFQHG--KVEIIGNDQGNRTTPSFVAF-NDTERLIGDAAKNQAAMNPANTVFDAKRLIGRKFDEPSVQADMKHFSFNVVNVEGRPKIQVE-FKGESKTFSAEEISSMVLLKMKETAEAYIGKEVKNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKSSEEKNVLIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRMVDHFIQEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSAQANIEV---------------------------------DSLFEGL---------DFYTSITRARFEELCADLFRSTLDPVEKSLRDAKMDKNAIHEIVLVGGSTRIPKVQKLLQDYFNGKELNKSINPDEXXXXXXXXXXXILSG 1324
            VGIDLGTT+  +GV+  G  +VE++ +  G R  PS VA  +D   L G  A  QAA NP  T++DAKR IGR F    ++ +   + F V  V G     +    G  +T + E + + +L +++  AE  +G  V+ AV+ VPA F++ QR +T  A  +AGL VLR++NEPTAAA+AYGL ++ S   +VL+ DLGGGT DVS+L+   G+F  ++ AG+ HLGG+DF  R+V+H       +H       +   + LR A E AK  L+ + +A + +                                   LF GL         +   ++TR  FE L  DLF+  ++P+ + LR  ++    +  +VLVGGSTRIP+V+++L DYF G E + S++P+ AV  G AVQA +L+G
Sbjct:   34 VGIDLGTTYCSIGVYHAGVGEVEVLADADGRRAFPSVVAAGSDGRVLAGFPALQQAADNPHATLYDAKRFIGRAFSPGELEREAGRYQFTVRQVSGEVVFVLRGHGGAEQTVTPEWVGAQMLDQLRLLAEERLGLPVRYAVLAVPAEFDERQRNSTIKAATMAGLEVLRVVNEPTAAALAYGLHEEESV-SSVLVVDLGGGTTDVSLLTKQGGMFFTRAMAGNNHLGGQDFTQRLVEHLTGRLADRHGGGRPWGRADTQLLREAAEMAKLELTHNDRARVSLRLSLVFMPDNRPCCVHQETTVYIRRPLCTGGNAHVLFFGLKLKGTHNTVEMDETVTRQEFESLNEDLFQKVMEPIVEVLRSGRLVAKQVDRVVLVGGSTRIPRVRRMLADYF-GSEPDTSVDPELAVVTGVAVQAGVLAG 453          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003663.1 (pep scaffold:Pmarinus_7.0:GL498042:47:1690:1 gene:ENSPMAG00000003351.1 transcript:ENSPMAT00000003663.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 47.3654 bits (111), Expect = 8.714e-6
Identity = 24/69 (34.78%), Postives = 38/69 (55.07%), Query Frame = 2
Query: 1073 RARFEELCADLFRSTLDPVEKSLRDAKMDKNAIHEIVLVGGSTRIPKVQKLLQDYFNGKELNKSINPDE 1279
            R  FE+  A LF   + PV + L+ A +  + + +I L+GG  RIPK+Q++L       +L   +N DE
Sbjct:    1 REEFEDASAHLFDRAITPVYEVLKRANLSIDEVDQIELLGGGIRIPKIQEMLIQTLQKNDLGVHLNGDE 69          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Yeast
Match: SSA1 (ATPase involved in protein folding and NLS-directed nuclear transport; member of HSP70 family; required for ubiquitin-dependent degradation of short-lived proteins; forms chaperone complex with Ydj1p; localized to nucleus, cytoplasm, cell wall; 98% identical to paralog Ssa2p with different functional specificity in propagation of yeast [URE3] prions, vacuolar-mediated degradations of gluconeogenesis enzymes; general targeting factor of Hsp104p to prion fibrils [Source:SGD;Acc:S000000004])

HSP 1 Score: 913.294 bits (2359), Expect = 0.000e+0
Identity = 475/606 (78.38%), Postives = 545/606 (89.93%), Query Frame = 2
Query:  194 AVGIDLGTTFSCVGVFQHGKVEIIGNDQGNRTTPSFVAFNDTERLIGDAAKNQAAMNPANTVFDAKRLIGRKFDEPSVQADMKHFSFNVVNVEGRPKIQVEFKGESKTFSAEEISSMVLLKMKETAEAYIGKEVKNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKSSEEKNVLIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRMVDHFIQEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSAQANIEVDSLFEGLDFYTSITRARFEELCADLFRSTLDPVEKSLRDAKMDKNAIHEIVLVGGSTRIPKVQKLLQDYFNGKELNKSINPDEXXXXXXXXXXXILSGDKSXXXXXXXXXXXXXXXXGIETAGGVMTALIKRNSTIPTKQTQTFSTYADNQPGVLIQVFEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKEDIERMVNDAXXXXXXXXXXXXRISSKNALESYAFQVKSAMEDEKLKDKFTAEEKQTVTDKCSEIVSWLDKNQSASKDEYEHHMKELEGVCKPVMSKIY 2011
            AVGIDLGTT+SCV  F + +V+II NDQGNRTTPSFVAF DTERLIGDAAKNQAAMNP+NTVFDAKRLIGR F++P VQADMKHF F +++V+G+P+IQVEFKGE+K F+ E+ISSMVL KMKETAE+Y+G +V +AVVTVPAYFNDSQRQATKDAG IAGLNVLRIINEPTAAAIAYGLDKK  EE +VLIFDLGGGTFDVS+LSI+DGIFEVK+TAGDTHLGGEDFDNR+V+HFIQEFKRK+KKD+S N+RA+RRLRTACERAKRTLSSSAQ ++E+DSLFEG+DFYTSITRARFEELCADLFRSTLDPVEK LRDAK+DK+ + EIVLVGGSTRIPKVQKL+ DYFNGKE N+SINPDEAVAYGAAVQAAIL+GD+S   QDLLLLDVAPLSLGIETAGGVMT LI RNSTIPTK+++ FSTYADNQPGVLIQVFEGERA TKDNNLLGKFELSGIPPAPRGVPQIEVTFD+D+NGILNVSAVEKGTGK NKITITNDKGRLSKEDIE+MV +AEK+K+EDE++ +RI+SKN LES A+ +K+ + +    DK    +K TVT K  E +SWLD N +ASK+E++  +KEL+ +  P+MSK+Y
Sbjct:    4 AVGIDLGTTYSCVAHFANDRVDIIANDQGNRTTPSFVAFTDTERLIGDAAKNQAAMNPSNTVFDAKRLIGRNFNDPEVQADMKHFPFKLIDVDGKPQIQVEFKGETKNFTPEQISSMVLGKMKETAESYLGAKVNDAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKGKEE-HVLIFDLGGGTFDVSLLSIEDGIFEVKATAGDTHLGGEDFDNRLVNHFIQEFKRKNKKDLSTNQRALRRLRTACERAKRTLSSSAQTSVEIDSLFEGIDFYTSITRARFEELCADLFRSTLDPVEKVLRDAKLDKSQVDEIVLVGGSTRIPKVQKLVTDYFNGKEPNRSINPDEAVAYGAAVQAAILTGDESSKTQDLLLLDVAPLSLGIETAGGVMTKLIPRNSTIPTKKSEIFSTYADNQPGVLIQVFEGERAKTKDNNLLGKFELSGIPPAPRGVPQIEVTFDVDSNGILNVSAVEKGTGKSNKITITNDKGRLSKEDIEKMVAEAEKFKEEDEKESQRIASKNQLESIAYSLKNTISEA--GDKLEQADKDTVTKKAEETISWLDSNTTASKEEFDDKLKELQDIANPIMSKLY 606          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Yeast
Match: SSA2 (HSP70 family ATP-binding protein; involved in protein folding, vacuolar import of proteins; required for ubiquitin-dependent degradation of short-lived proteins; associated with chaperonin-containing T-complex; 98% identical to paralog Ssa1p with distinct functional specificity in propagation of yeast [URE3] prions and vacuolar-mediated degradation of gluconeogenesis enzymes; binds tRNA, has role in tRNA nuclear import during starvation [Source:SGD;Acc:S000003947])

HSP 1 Score: 913.294 bits (2359), Expect = 0.000e+0
Identity = 483/642 (75.23%), Postives = 558/642 (86.92%), Query Frame = 2
Query:  194 AVGIDLGTTFSCVGVFQHGKVEIIGNDQGNRTTPSFVAFNDTERLIGDAAKNQAAMNPANTVFDAKRLIGRKFDEPSVQADMKHFSFNVVNVEGRPKIQVEFKGESKTFSAEEISSMVLLKMKETAEAYIGKEVKNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKSSEEKNVLIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRMVDHFIQEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSAQANIEVDSLFEGLDFYTSITRARFEELCADLFRSTLDPVEKSLRDAKMDKNAIHEIVLVGGSTRIPKVQKLLQDYFNGKELNKSINPDEXXXXXXXXXXXILSGDKSXXXXXXXXXXXXXXXXGIETAGGVMTALIKRNSTIPTKQTQTFSTYADNQPGVLIQVFEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKEDIERMVNDAXXXXXXXXXXXXRISSKNALESYAFQVKSAMEDEKLKDKFTAEEKQTVTDKCSEIVSWLDKNQSASKDEYEHHMKELEGVCKPVMSKIYGAGMPSGMP-----FEMPTEMPASGDKSGPSIEELD 2104
            AVGIDLGTT+SCV  F + +V+II NDQGNRTTPSFV F DTERLIGDAAKNQAAMNPANTVFDAKRLIGR F++P VQ DMKHF F +++V+G+P+IQVEFKGE+K F+ E+ISSMVL KMKETAE+Y+G +V +AVVTVPAYFNDSQRQATKDAG IAGLNVLRIINEPTAAAIAYGLDKK  EE +VLIFDLGGGTFDVS+LSI+DGIFEVK+TAGDTHLGGEDFDNR+V+HFIQEFKRK+KKD+S N+RA+RRLRTACERAKRTLSSSAQ ++E+DSLFEG+DFYTSITRARFEELCADLFRSTLDPVEK LRDAK+DK+ + EIVLVGGSTRIPKVQKL+ DYFNGKE N+SINPDEAVAYGAAVQAAIL+GD+S   QDLLLLDVAPLSLGIETAGGVMT LI RNSTIPTK+++ FSTYADNQPGVLIQVFEGERA TKDNNLLGKFELSGIPPAPRGVPQIEVTFD+D+NGILNVSAVEKGTGK NKITITNDKGRLSKEDIE+MV +AEK+K+EDE++ +RI+SKN LES A+ +K+ + +    DK    +K  VT K  E ++WLD N +A+K+E++  +KEL+ V  P+MSK+Y AG   G P        P   P + +  GP++EE+D
Sbjct:    4 AVGIDLGTTYSCVAHFSNDRVDIIANDQGNRTTPSFVGFTDTERLIGDAAKNQAAMNPANTVFDAKRLIGRNFNDPEVQGDMKHFPFKLIDVDGKPQIQVEFKGETKNFTPEQISSMVLGKMKETAESYLGAKVNDAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKGKEE-HVLIFDLGGGTFDVSLLSIEDGIFEVKATAGDTHLGGEDFDNRLVNHFIQEFKRKNKKDLSTNQRALRRLRTACERAKRTLSSSAQTSVEIDSLFEGIDFYTSITRARFEELCADLFRSTLDPVEKVLRDAKLDKSQVDEIVLVGGSTRIPKVQKLVTDYFNGKEPNRSINPDEAVAYGAAVQAAILTGDESSKTQDLLLLDVAPLSLGIETAGGVMTKLIPRNSTIPTKKSEVFSTYADNQPGVLIQVFEGERAKTKDNNLLGKFELSGIPPAPRGVPQIEVTFDVDSNGILNVSAVEKGTGKSNKITITNDKGRLSKEDIEKMVAEAEKFKEEDEKESQRIASKNQLESIAYSLKNTISEA--GDKLEQADKDAVTKKAEETIAWLDSNTTATKEEFDDQLKELQEVANPIMSKLYQAG---GAPEGAAPGGFPGGAPPAPEAEGPTVEEVD 639          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Yeast
Match: SSA3 (ATPase involved in protein folding and the response to stress; plays a role in SRP-dependent cotranslational protein-membrane targeting and translocation; member of the heat shock protein 70 (HSP70) family; localized to the cytoplasm; SSA3 has a paralog, SSA4, that arose from the whole genome duplication [Source:SGD;Acc:S000000171])

HSP 1 Score: 893.264 bits (2307), Expect = 0.000e+0
Identity = 466/649 (71.80%), Postives = 544/649 (83.82%), Query Frame = 2
Query:  194 AVGIDLGTTFSCVGVFQHGKVEIIGNDQGNRTTPSFVAFNDTERLIGDAAKNQAAMNPANTVFDAKRLIGRKFDEPSVQADMKHFSFNVVNVEGRPKIQVEFKGESKTFSAEEISSMVLLKMKETAEAYIGKEVKNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKSSEEKNVLIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRMVDHFIQEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSAQANIEVDSLFEGLDFYTSITRARFEELCADLFRSTLDPVEKSLRDAKMDKNAIHEIVLVGGSTRIPKVQKLLQDYFNGKELNKSINPDEXXXXXXXXXXXILSGDKSXXXXXXXXXXXXXXXXGIETAGGVMTALIKRNSTIPTKQTQTFSTYADNQPGVLIQVFEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKEDIERMVNDAXXXXXXXXXXXXRISSKNALESYAFQVKSAMEDEKLKDKFTAEEKQTVTDKCSEIVSWLDKNQSASKDEYEHHMKELEGVCKPVMSKIY------------GAGMPSGMPFEMPTEMPASGDKSGPSIEELD 2104
            AVGIDLGTT+SCV  F + +VEII NDQGNRTTPS+VAF DTERLIGDAAKNQAA+NP NTVFDAKRLIGRKFD+P V  D KHF F V++ +G+P +QVE+KGE+KTF+ EEISSMVL KMKETAE Y+G  V +AVVTVPAYFNDSQRQATKDAG IAG+NVLRIINEPTAAAIAYGLDKK   E NVLIFDLGGGTFDVS+LSID+G+FEVK+TAGDTHLGGEDFDNR+V+H   EFKRK KKDIS N+R++RRLRTA ERAKR LSSS+Q +IE+DSLFEG+DFYTS+TRARFEELCADLFRSTL+PVEK L+D+K+DK+ I EIVLVGGSTRIPK+QKL+ D+FNGKE N+SINPDEAVAYGAAVQAAIL+GD+S   QDLLLLDVAPLSLGIETAGG+MT LI RNSTIPTK+++TFSTYADNQPGVLIQVFEGER  TKDNNLLGKFELSGIPPAPRGVPQI+VTFDIDANGILNVSA+EKGTGK NKITITNDKGRLSK+DI+RMV++AEKY+ +DE + ER+ +KN LESYAF +K+ + +   K+K   ++ + +     E + WLD +Q+AS DEY+   KELEG+  P+M+K Y              G P  MP    T     G+ +GP++EE+D
Sbjct:    4 AVGIDLGTTYSCVAHFSNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQAAINPHNTVFDAKRLIGRKFDDPEVTTDAKHFPFKVISRDGKPVVQVEYKGETKTFTPEEISSMVLSKMKETAENYLGTTVNDAVVTVPAYFNDSQRQATKDAGTIAGMNVLRIINEPTAAAIAYGLDKKGRAEHNVLIFDLGGGTFDVSLLSIDEGVFEVKATAGDTHLGGEDFDNRLVNHLATEFKRKTKKDISNNQRSLRRLRTAAERAKRALSSSSQTSIEIDSLFEGMDFYTSLTRARFEELCADLFRSTLEPVEKVLKDSKLDKSQIDEIVLVGGSTRIPKIQKLVSDFFNGKEPNRSINPDEAVAYGAAVQAAILTGDQSTKTQDLLLLDVAPLSLGIETAGGIMTKLIPRNSTIPTKKSETFSTYADNQPGVLIQVFEGERTRTKDNNLLGKFELSGIPPAPRGVPQIDVTFDIDANGILNVSALEKGTGKSNKITITNDKGRLSKDDIDRMVSEAEKYRADDEREAERVQAKNQLESYAFTLKNTINEASFKEKVGEDDAKRLETASQETIDWLDASQAASTDEYKDRQKELEGIANPIMTKFYGAGAGAGPGAGESGGFPGSMPNSGAT---GGGEDTGPTVEEVD 649          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Yeast
Match: SSA4 (Heat shock protein that is highly induced upon stress; plays a role in SRP-dependent cotranslational protein-membrane targeting and translocation; member of the HSP70 family; cytoplasmic protein that concentrates in nuclei upon starvation; SSA4 has a paralog, SSA3, that arose from the whole genome duplication [Source:SGD;Acc:S000000905])

HSP 1 Score: 889.797 bits (2298), Expect = 0.000e+0
Identity = 459/606 (75.74%), Postives = 533/606 (87.95%), Query Frame = 2
Query:  194 AVGIDLGTTFSCVGVFQHGKVEIIGNDQGNRTTPSFVAFNDTERLIGDAAKNQAAMNPANTVFDAKRLIGRKFDEPSVQADMKHFSFNVVNVEGRPKIQVEFKGESKTFSAEEISSMVLLKMKETAEAYIGKEVKNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKSSEEKNVLIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRMVDHFIQEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSAQANIEVDSLFEGLDFYTSITRARFEELCADLFRSTLDPVEKSLRDAKMDKNAIHEIVLVGGSTRIPKVQKLLQDYFNGKELNKSINPDEXXXXXXXXXXXILSGDKSXXXXXXXXXXXXXXXXGIETAGGVMTALIKRNSTIPTKQTQTFSTYADNQPGVLIQVFEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKEDIERMVNDAXXXXXXXXXXXXRISSKNALESYAFQVKSAMEDEKLKDKFTAEEKQTVTDKCSEIVSWLDKNQSASKDEYEHHMKELEGVCKPVMSKIY 2011
            AVGIDLGTT+SCV  F + +VEII NDQGNRTTPS+VAF DTERLIGDAAKNQAAMNP NTVFDAKRLIGRKFD+P V  D KH+ F V++  G+P +QVE+KGE+KTF+ EEISSM+L KMKETAE ++G EVK+AVVTVPAYFNDSQRQATKDAG IAGLNVLRIINEPTAAAIAYGLDKKS +E NVLIFDLGGGTFDVS+LSID+G+FEVK+TAGDTHLGGEDFD+R+V+   +EFKRK+KKD++ N+R++RRLRTA ERAKRTLSSSAQ +IE+DSLFEG+DFYTSITRARFEELCADLFRSTL+PVEK L D+K+DK+ I EIVLVGGSTRIPKVQKL+ D+FNGKE N+SINPDEAVAYGAAVQAAIL+GD+S   QDLLLLDVAPLSLGIETAGG+MT LI RNSTIPTK+++ FSTYADNQPGVLIQVFEGER  TKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGK NKITITNDKGRLSKEDI++MV +AEK+K EDE++ +R+ +KN LESYAF +K+++ +   K+K   E+ + +     + ++WLD +Q+AS +EY+   KELEGV  P+MSK Y
Sbjct:    4 AVGIDLGTTYSCVAHFANDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQAAMNPHNTVFDAKRLIGRKFDDPEVTNDAKHYPFKVIDKGGKPVVQVEYKGETKTFTPEEISSMILTKMKETAENFLGTEVKDAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKSQKEHNVLIFDLGGGTFDVSLLSIDEGVFEVKATAGDTHLGGEDFDSRLVNFLAEEFKRKNKKDLTTNQRSLRRLRTAAERAKRTLSSSAQTSIEIDSLFEGIDFYTSITRARFEELCADLFRSTLEPVEKVLADSKLDKSQIDEIVLVGGSTRIPKVQKLVSDFFNGKEPNRSINPDEAVAYGAAVQAAILTGDQSSTTQDLLLLDVAPLSLGIETAGGIMTKLIPRNSTIPTKKSEVFSTYADNQPGVLIQVFEGERTRTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKSNKITITNDKGRLSKEDIDKMVAEAEKFKAEDEQEAQRVQAKNQLESYAFTLKNSVSENNFKEKVGEEDARKLEAAAQDAINWLDASQAASTEEYKERQKELEGVANPIMSKFY 609          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Yeast
Match: KAR2 (ATPase involved in protein import into the ER; also acts as a chaperone to mediate protein folding in the ER and may play a role in ER export of soluble proteins; regulates the unfolded protein response via interaction with Ire1p [Source:SGD;Acc:S000003571])

HSP 1 Score: 721.465 bits (1861), Expect = 0.000e+0
Identity = 372/613 (60.69%), Postives = 485/613 (79.12%), Query Frame = 2
Query:  197 VGIDLGTTFSCVGVFQHGKVEIIGNDQGNRTTPSFVAFNDTERLIGDAAKNQAAMNPANTVFDAKRLIGRKFDEPSVQADMKHFSFNVVNVEGRPKIQVEFKGESKTFSAEEISSMVLLKMKETAEAYIGKEVKNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKSSEEKNVLIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRMVDHFIQEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSAQANIEVDSLFEGLDFYTSITRARFEELCADLFRSTLDPVEKSLRDAKMDKNAIHEIVLVGGSTRIPKVQKLLQDYFNGKELNKSINPDEXXXXXXXXXXXILSGDKSXXXXXXXXXXXXXXXXGIETAGGVMTALIKRNSTIPTKQTQTFSTYADNQPGVLIQVFEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKEDIERMVNDAXXXXXXXXXXXXRISSKNALESYAFQVKSAMEDEKLKDKFTAEEKQTVTDKCSEIVSWLDKN-QSASKDEYEHHMKELEGVCKPVMSKIYGAGMPSG 2032
            +GIDLGTT+SCV V ++GK EI+ N+QGNR TPS+VAF D ERLIGDAAKNQ A NP NT+FD KRLIG K+++ SVQ D+KH  FNVVN +G+P ++V  KGE K F+ EEIS M+L KMK+ AE Y+G +V +AVVTVPAYFND+QRQATKDAG IAGLNVLRI+NEPTAAAIAYGLD KS +E  ++++DLGGGTFDVS+LSI++G+FEV++T+GDTHLGGEDFD ++V   I+ FK+KH  D+S+N +A+ +L+   E+AKR LSS     IE+DS  +G+D   ++TRA+FEEL  DLF+ TL PVEK L+D+ ++K  + +IVLVGGSTRIPKVQ+LL+ YF+GK+ +K INPDEAVAYGAAVQA +LSG++   V+D++LLDV  L+LGIET GGVMT LIKRN+ IPTK++Q FST  DNQP V+I+V+EGERAM+KDNNLLGKFEL+GIPPAPRGVPQIEVTF +DANGIL VSA +KGTGK   ITITNDKGRL++E+I+RMV +AEK+  ED   K ++ S+N LE+YA  +K+ +  + L +K   E+K+T+ D  ++++ WLD N ++A  ++++   + L  V  P+ SK+YG    SG
Sbjct:   53 IGIDLGTTYSCVAVMKNGKTEILANEQGNRITPSYVAFTDDERLIGDAAKNQVAANPQNTIFDIKRLIGLKYNDRSVQKDIKHLPFNVVNKDGKPAVEVSVKGEKKVFTPEEISGMILGKMKQIAEDYLGTKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVLRIVNEPTAAAIAYGLD-KSDKEHQIIVYDLGGGTFDVSLLSIENGVFEVQATSGDTHLGGEDFDYKIVRQLIKAFKKKHGIDVSDNNKALAKLKREAEKAKRALSSQMSTRIEIDSFVDGIDLSETLTRAKFEELNLDLFKKTLKPVEKVLQDSGLEKKDVDDIVLVGGSTRIPKVQQLLESYFDGKKASKGINPDEAVAYGAAVQAGVLSGEEG--VEDIVLLDVNALTLGIETTGGVMTPLIKRNTAIPTKKSQIFSTAVDNQPTVMIKVYEGERAMSKDNNLLGKFELTGIPPAPRGVPQIEVTFALDANGILKVSATDKGTGKSESITITNDKGRLTQEEIDRMVEEAEKFASEDASIKAKVESRNKLENYAHSLKNQVNGD-LGEKLEEEDKETLLDAANDVLEWLDDNFETAIAEDFDEKFESLSKVAYPITSKLYGGADGSG 661          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Nematostella
Match: EDO37280 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SG65])

HSP 1 Score: 942.184 bits (2434), Expect = 0.000e+0
Identity = 481/609 (78.98%), Postives = 554/609 (90.97%), Query Frame = 2
Query:  191 PAVGIDLGTTFSCVGVFQHGKVEIIGNDQGNRTTPSFVAFNDTERLIGDAAKNQAAMNPANTVFDAKRLIGRKFDEPSVQADMKHFSFNVVNVEGRPKIQVEFKGESKTFSAEEISSMVLLKMKETAEAYIGKEVKNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKSSEEKNVLIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRMVDHFIQEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSAQANIEVDSLFEGLDFYTSITRARFEELCADLFRSTLDPVEKSLRDAKM--DKNAIHEIVLVGGSTRIPKVQKLLQDYFNGKELNKSINPDEXXXXXXXXXXXILSGDKSXXXXXXXXXXXXXXXXGIETAGGVMTALIKRNSTIPTKQTQTFSTYADNQPGVLIQVFEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKEDIERMVNDAXXXXXXXXXXXXRISSKNALESYAFQVKSAMEDEKLKDKFTAEEKQTVTDKCSEIVSWLDKNQSASKDEYEHHMKELEGVCKPVMSKIY 2011
            PAVGIDLGTT+SCVGVFQHGKVEII NDQGNRTTPS+VAF+DTERLIGDAAKNQ AMNP NTVFDAKRLIGRKFD+P V  DM H+ F+V+    RPKIQVEFKGE K+F  EEISSMVL KMKETAEAY+G +V +AVVTVPAYFNDSQRQATKDAG IAGLNVLRIINEPTAAAIAYGLDKK   E+NVLI+DLGGGTFDVS+L+I+DGIFEVKSTAGDTHLGGEDFDN+MVDHF+++FK+K+KKDI+ NKRA+RRLRTACERAKRTLSSS QA+IE+DSLFEG+DFYTSITRARFEEL  DLF+ T +PVE+++RD+K+   K +IH+IVLVGGSTRIPK+QK+LQ+ F GKELNKSINPDEAVAYGAAVQAAIL GDK D V+DLLLLDVAPLS+GIETAGGVM+ LIKRNSTIPTKQTQTF+TY+DNQPGVLIQVFEGER+MT  NNLLGKFEL+GIPPAPRGVPQIEVTFDIDANGILNVSAV+K TGKENKITITNDKGRLSKEDIERMVN+A KYK+EDE+Q++RI +KN+LESYA+ +KS +ED+K+KDK + E+K+ + DKC+E++ WLD NQ+A KDE+E+H KELE VC P+++K+Y
Sbjct:    5 PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFSDTERLIGDAAKNQVAMNPENTVFDAKRLIGRKFDDPVVARDMTHWPFHVIREGERPKIQVEFKGEKKSFFPEEISSMVLTKMKETAEAYLGAKVTDAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGVERNVLIYDLGGGTFDVSVLTIEDGIFEVKSTAGDTHLGGEDFDNKMVDHFVKQFKQKYKKDITPNKRAMRRLRTACERAKRTLSSSTQASIEIDSLFEGIDFYTSITRARFEELNQDLFKKTTEPVEQAIRDSKIPGGKESIHDIVLVGGSTRIPKIQKMLQELFGGKELNKSINPDEAVAYGAAVQAAILHGDKDDTVKDLLLLDVAPLSMGIETAGGVMSVLIKRNSTIPTKQTQTFTTYSDNQPGVLIQVFEGERSMTAHNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVNEASKYKEEDEKQRDRIQTKNSLESYAYSMKSTVEDDKVKDKISEEDKKAILDKCTEVLKWLDTNQTAEKDEFEYHQKELEKVCNPIITKLY 613          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Nematostella
Match: EDO30323 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T144])

HSP 1 Score: 929.472 bits (2401), Expect = 0.000e+0
Identity = 471/609 (77.34%), Postives = 549/609 (90.15%), Query Frame = 2
Query:  188 APAVGIDLGTTFSCVGVFQHGKVEIIGNDQGNRTTPSFVAFNDTERLIGDAAKNQAAMNPANTVFDAKRLIGRKFDEPSVQADMKHFSFNVVNVEGRPKIQVEFKGESKTFSAEEISSMVLLKMKETAEAYIGKEVKNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKSSEEKNVLIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRMVDHFIQEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSAQANIEVDSLFEGLDFYTSITRARFEELCADLFRSTLDPVEKSLRDAKMD-KNAIHEIVLVGGSTRIPKVQKLLQDYFNGKELNKSINPDEXXXXXXXXXXXILSGDKSXXXXXXXXXXXXXXXXGIETAGGVMTALIKRNSTIPTKQTQTFSTYADNQPGVLIQVFEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKEDIERMVNDAXXXXXXXXXXXXRISSKNALESYAFQVKSAMEDEKLKDKFTAEEKQTVTDKCSEIVSWLDKNQSASKDEYEHHMKELEGVCKPVMSKIY 2011
            APA+GIDLGTT+SCVGVFQHGKVEII NDQGNRTTPS+VAF D ERL+GDAAKNQ AMNP NT+FDAKRLIGR+FD+P V+ DMKH+SF VVN  GRPK++VE+KGE+KTF AEEISSMVL KMKETAEAY+G +V +AVVTVPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKK  +E+NVLIFDLGGGTFDVS+LSI+DGIFEVKST GDTHLGGEDFDN MVD F+++FK+K+KKDI+ NKRA+RRLRTACERAKRTLSSS QA+IE+DSL++G+DFYTSITRARFEE+ A LF+ TL+PVEK+++D+K++ K  I EIV+VGGSTRIPK+Q LLQ++FNGKELNKSINPDEAVAYGAAVQAAIL GDKS+  QDLLLLDVAPL+LG+ETAGGVMTA IKRN+TIPTKQTQTF+TY+DNQ  VLIQV+EGER++TKDNNLLGKFELSGIPPAPRGVPQI+VTFD+D+NGILNVSAV+K TGKENKITITNDKGRLSKEDIERMV +AEK+K  DE  +ERI SKN+LESYAF +KS MEDEK+KDK + +E++ V  +C   + WL+ NQSA K+E + H KELEGVC P+++K+Y
Sbjct:    4 APAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDEERLVGDAAKNQVAMNPTNTIFDAKRLIGRRFDDPGVKDDMKHWSFEVVNEAGRPKVKVEYKGETKTFFAEEISSMVLNKMKETAEAYLGCKVTDAVVTVPAYFNDSQRQATKDAGVISGLNVLRIINEPTAAAIAYGLDKKVGQERNVLIFDLGGGTFDVSVLSIEDGIFEVKSTHGDTHLGGEDFDNNMVDFFVKQFKQKYKKDITPNKRALRRLRTACERAKRTLSSSTQASIEIDSLYDGIDFYTSITRARFEEMNAHLFKKTLEPVEKAIKDSKLESKEKIDEIVMVGGSTRIPKIQSLLQNFFNGKELNKSINPDEAVAYGAAVQAAILHGDKSEATQDLLLLDVAPLTLGLETAGGVMTAAIKRNTTIPTKQTQTFTTYSDNQTSVLIQVYEGERSLTKDNNLLGKFELSGIPPAPRGVPQIDVTFDVDSNGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVKEAEKFKAADEAVRERIQSKNSLESYAFSMKSTMEDEKVKDKLSEDEREKVISRCKATLDWLEHNQSAEKEEIDAHQKELEGVCNPIITKLY 612          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Nematostella
Match: EDO44530 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RV88])

HSP 1 Score: 883.634 bits (2282), Expect = 0.000e+0
Identity = 464/640 (72.50%), Postives = 556/640 (86.88%), Query Frame = 2
Query:  188 APAVGIDLGTTFSCVGVFQHGKVEIIGNDQGNRTTPSFVAFNDTERLIGDAAKNQAAMNPANTVFDAKRLIGRKFDEPSVQADMKHFSFNVVNVEGRPKIQVEFKGESKTFSAEEISSMVLLKMKETAEAYIGKEVKNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKSSEEKNVLIFDLGGGTFDVSILSIDDG-IFEVKSTAGDTHLGGEDFDNRMVDHFIQEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSAQANIEVDSLFEGLDFYTSITRARFEELCADLFRSTLDPVEKSLRDAKMDKNAIHEIVLVGGSTRIPKVQKLLQDYFNGKELNKSINPDEXXXXXXXXXXXILSGDKSXXXXXXXXXXXXXXXXGIETAGGVMTALIKRNSTIPTKQTQTFSTYADNQPGVLIQVFEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKEDIERMVNDAXXXXXXXXXXXXRISSKNALESYAFQVKSAMEDEKLKDKFTAEEKQTVTDKCSEIVSWLDKNQSASKDEYEHHMKELEGVCKPVMSKIYGAGMPSGMPFEMPTEMPASGDKSGPSIEELD 2104
            APA+GIDLGTT+SCVGVFQ+GKVEII NDQGNRTTPS+V F DTERL+GDAAKNQ A+NP NT+FDAKRLIGR++D+ +VQ+DMK + F +++   +PKIQVE+KGE KTF+AEEISSMVL KMKETAEAY+G++V +AV+TVPAYFNDSQRQATKDAG IAGLNVLR+INEPTAAA+AYGLDK  S EKNVLIFDLGGGTFDVSIL+IDDG +FEVKSTAGDTHLGGEDFDNR+V+HF+ EFKRK+KKD+S+N RA+RRLRTACERAKRTLSSS +A+IEVDSLFEG+DFYT I+RARFE+LC+DLF S LDPV K+L DAK  K+ IHE+VLVGGSTR+PK+QK+L++YF+GK LNKSINPDEAVAYGAAVQAAILSGDKSD V+D+LL+DVAPLSLGIETAG VMT LI+RN+ IPTK TQTF+TY+DNQP V I+VFEGER +TK NNLLGKF+LSGIPPAPRGVPQIEVTFDIDANGILNVSA +K TGK   ITITNDKGRLSKE+I+RM+NDAEKYK EDE Q+E+I+++N LESYAF VKSA+ +  L+ K +  +K TV +K  E+++WL+KN  A K+E+E   KEL+ VC P+M+K++G    + MP +      ++G   GP+IEE+D
Sbjct:    4 APAIGIDLGTTYSCVGVFQNGKVEIIANDQGNRTTPSYVGFTDTERLVGDAAKNQVALNPENTIFDAKRLIGRRYDDATVQSDMKLWPFKIISDNNKPKIQVEYKGERKTFAAEEISSMVLGKMKETAEAYLGQKVTSAVITVPAYFNDSQRQATKDAGTIAGLNVLRVINEPTAAALAYGLDKSLSGEKNVLIFDLGGGTFDVSILTIDDGSLFEVKSTAGDTHLGGEDFDNRLVNHFVAEFKRKYKKDMSKNSRAMRRLRTACERAKRTLSSSTEASIEVDSLFEGIDFYTKISRARFEDLCSDLFLSCLDPVNKALSDAKFSKSDIHEVVLVGGSTRVPKIQKMLEEYFSGKSLNKSINPDEAVAYGAAVQAAILSGDKSDEVKDVLLVDVAPLSLGIETAGEVMTKLIERNARIPTKATQTFTTYSDNQPAVTIRVFEGERPLTKHNNLLGKFDLSGIPPAPRGVPQIEVTFDIDANGILNVSAKDKSTGKTGSITITNDKGRLSKEEIDRMINDAEKYKSEDEAQREKIAARNRLESYAFGVKSAISEPSLEGKLSQSDKDTVKNKVEEVLNWLEKNSLAEKEEFEEQEKELQRVCSPIMAKVHGGSGGTQMPGQTAGHGQSAG---GPTIEEVD 640          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Nematostella
Match: EDO33296 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSL5])

HSP 1 Score: 740.725 bits (1911), Expect = 0.000e+0
Identity = 394/607 (64.91%), Postives = 496/607 (81.71%), Query Frame = 2
Query:  197 VGIDLGTTFSCVGVFQHGKVEIIGNDQGNRTTPSFVAFNDT-ERLIGDAAKNQAAMNPANTVFDAKRLIGRKFDEPSVQADMKHFSFNVVNVEGRPKIQVEFKGESKTFSAEEISSMVLLKMKETAEAYIGKEVKNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKSSEEKNVLIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRMVDHFIQEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSAQANIEVDSLFEGLDFYTSITRARFEELCADLFRSTLDPVEKSLRDAKMDKNAIHEIVLVGGSTRIPKVQKLLQDYFNGKELNKSINPDEXXXXXXXXXXXILSGDKSXXXXXXXXXXXXXXXXGIETAGGVMTALIKRNSTIPTKQTQTFSTYADNQPGVLIQVFEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKEDIERMVNDAXXXXXXXXXXXXRISSKNALESYAFQVKSAMED-EKLKDKFTAEEKQTVTDKCSEIVSWLDKNQSASKDEYEHHMKELEGVCKPVMSKIY 2011
            +GIDLGTT+SCVGVF++G+VEII NDQGNR TPS+VAF +  ERLIGD AKNQ   NP NTVFDAKRLIGR +D+ SVQ D+K F F VV+   +P +QV+ K E KTF+AEEIS+MVL KMKETAEAY+GK+V +AVVTVPAYFND+QRQATKDAGAIAGL V+RIINEPTAAAIAYG+DKK  E KN+L+FDLGGGTFDVS+L+ID+G+FEV +T GDTHLGGEDFD  +++HFI+ +K+K  K+I ++ RAV++LR   E+AKR LS+  QA +E++S FEG DF   +TRARFEEL A LF+STL PV+K L DA + K+ IHEIVLVGGSTRIPKVQ+L++D+F GKE ++ INPDEAVAYGAAVQA +L G++     +++LLDV PL+LGIET GGVMT LI RN+ IPTK++Q FST ADNQ  V IQVFEGER MTKDN+ LGKF+L+GIPPAPRGVPQIEVTF+ID NGIL VSA +KGTG + KITITND+ RL+ EDIERMVNDAEK+  ED++ KE++ ++N LESYA+ +K+ + D EKL  K + ++K+T+T+   + +SW+DKNQ AS ++++   KELE V +P++SK+Y
Sbjct:   36 IGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTEEGERLIGDGAKNQLTTNPENTVFDAKRLIGRSWDDTSVQNDLKFFPFKVVDKNKKPHVQVKVKDEIKTFAAEEISAMVLTKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGAIAGLTVMRIINEPTAAAIAYGMDKKEGE-KNILVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQNVMEHFIKLYKKKKGKNIRKDNRAVQKLRREVEKAKRALSTQHQARVEIESFFEGEDFSEMLTRARFEELNAKLFKSTLKPVQKVLEDADLKKSEIHEIVLVGGSTRIPKVQQLVKDFFEGKEPSRGINPDEAVAYGAAVQAGVLGGEED--TGEVVLLDVNPLTLGIETVGGVMTKLISRNTVIPTKKSQVFSTAADNQNTVTIQVFEGERPMTKDNHPLGKFDLNGIPPAPRGVPQIEVTFEIDVNGILRVSAEDKGTGNKEKITITNDQNRLTPEDIERMVNDAEKFADEDKKTKEKVEARNELESYAYSLKNQVGDKEKLGGKLSEDDKKTITEAVEKAISWMDKNQDASVEDFKKEKKELEDVVQPIVSKLY 639          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Nematostella
Match: EDO47723 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLN7])

HSP 1 Score: 526.554 bits (1355), Expect = 1.924e-179
Identity = 306/598 (51.17%), Postives = 417/598 (69.73%), Query Frame = 2
Query:  200 GIDLGTTFSCVGVFQHGKVEIIGNDQGNRTTPSFVAFN-DTERLIGDAAKNQAAMNPANTVFDAKRLIGRKFDEPSVQADMKHFSFNVVNVEGRPKIQVEFKGESKTFSAEEISSMVLLKMKETAEAYIGKEVKNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKSSEEKNVLIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRMVDHFIQEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSAQANIEVDSLFEGLD----FYTSITRARFEELCADLFRSTLDPVEKSLRDAKMDKNAIHEIVLVGGSTRIPKVQKLLQDYFNGKELNKSINPDEXXXXXXXXXXXILSGDKSXXXXXXXXXXXXXXXXGIETAGGVMTALIKRNSTIPTKQTQTFSTYADNQPGVLIQVFEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKEDIERMVNDAXXXXXXXXXXXXRISSKNALESYAFQVKSAMEDEKLKDKFTAEEKQTVTDKCSEIVSWLDKNQSASKDEYEHHMKELE 1978
            GIDLGTT SCV V      ++I N +G+RTTPS VAF  + ERL+G  A+ QA  NP NT++  KR IGR+FD P ++ D+K+ S+ +V           F+   K +S  ++ + VL+KMKETAE+Y+G  V NAVVTVPAYFNDSQRQATKDAG IAGLNVLR+INEPTAAA+AYG+DK  +E+K + ++DLGGGTFD+SIL I  G+FEVK+T GDT+LGGEDFDN ++   I EFK++   D+S++  A++RLR A E+AK  LSSS Q +I +  +             ++R++FE L ADL   T+ P +K L+DA+++K  I +++LVGG TR+PKVQ+ +QD F G+  +K++NPDEAVA GAA+Q  +L+GD    V+D+LLLDV PLSLGIET GGV T LI RN+TIPTK++Q FST AD Q  V I+VF+GER M  DN LLG+F+L GIPPAPRGVPQ+EVTFDIDANGI+NVSA +KGTG+E +I I +  G LSK+ IE M+ +AEKY + D+++KE   + N  E      ++ ME+   KD+  +EE + + ++ +++   L    + + +       EL+
Sbjct:   16 GIDLGTTNSCVAVMDGKTPKVIENAEGSRTTPSVVAFTPEGERLVGAPARRQAITNPQNTLYATKRYIGRRFDAPEIKKDLKNVSYKIVRASNG---DAWFEVAGKVYSPSQVGAFVLMKMKETAESYLGTNVNNAVVTVPAYFNDSQRQATKDAGQIAGLNVLRVINEPTAAALAYGMDK--TEDKIIAVYDLGGGTFDISILEIQKGVFEVKATNGDTYLGGEDFDNTLLKFLIAEFKKESGVDLSKDSMALQRLREAAEKAKIELSSSVQTDINLPYITVDASGPKHLNMKLSRSKFESLVADLINRTVGPCKKCLQDAEINKGEIGDVLLVGGMTRMPKVQQTVQDIF-GRVPSKAVNPDEAVAIGAAIQGGVLAGD----VKDVLLLDVTPLSLGIETLGGVFTKLITRNTTIPTKKSQVFSTAADGQTQVEIKVFQGEREMAIDNKLLGQFQLVGIPPAPRGVPQVEVTFDIDANGIVNVSARDKGTGREQQIVIQSSGG-LSKDAIENMIKEAEKYAEADKQKKETTEAVNQAEGMIHDTETKMEE--FKDQLPSEEVEKLKEEIAKVREVLANKDNETGETIRQAYSELQ 600          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Medaka
Match: hsc70 (heat shock protein 70 cognate [Source:NCBI gene;Acc:100049425])

HSP 1 Score: 988.023 bits (2553), Expect = 0.000e+0
Identity = 504/608 (82.89%), Postives = 560/608 (92.11%), Query Frame = 2
Query:  188 APAVGIDLGTTFSCVGVFQHGKVEIIGNDQGNRTTPSFVAFNDTERLIGDAAKNQAAMNPANTVFDAKRLIGRKFDEPSVQADMKHFSFNVVNVEGRPKIQVEFKGESKTFSAEEISSMVLLKMKETAEAYIGKEVKNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKSSEEKNVLIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRMVDHFIQEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSAQANIEVDSLFEGLDFYTSITRARFEELCADLFRSTLDPVEKSLRDAKMDKNAIHEIVLVGGSTRIPKVQKLLQDYFNGKELNKSINPDEXXXXXXXXXXXILSGDKSXXXXXXXXXXXXXXXXGIETAGGVMTALIKRNSTIPTKQTQTFSTYADNQPGVLIQVFEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKEDIERMVNDAXXXXXXXXXXXXRISSKNALESYAFQVKSAMEDEKLKDKFTAEEKQTVTDKCSEIVSWLDKNQSASKDEYEHHMKELEGVCKPVMSKIY 2011
             PAVGIDLGTT+SCVGVFQHGKVEII NDQGNRTTPS+VAF DTERLIGDAAKNQ AMNP NTVFDAKRLIGR+FD+  VQ+DMKH+ FNV+N   RPK+QVE+KGE+K+F  EEISSMVL KMKE AEAY+GK V NAV+TVPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKK   E+NVLIFDLGGGTFDVSIL+I+DGIFEVKSTAGDTHLGGEDFDNRMV+HFI EFKRK+KKDIS+NKRAVRRLRTACERAKRTLSSS QA+IE+DSL+EG+DFYTSITRARFEEL ADLFR TLDPVEKSLRDAKMDK  IH+IVLVGGSTRIPK+QKLLQD+FNGKELNKSINPDEAVAYGAAVQAAILSGDKS+ VQDLLLLDV PLSLGIETAGGVMT LIKRN+TIPTKQTQTF+TY+DNQPGVLIQV+EGERAMTKDNNLLGKFEL+GIPPAPRGVPQIEVTFDIDANGI+NVSAV+K TGKENKITITNDKGRLSKEDIERMV +AEKYK ED+ Q++++S+KN LESYAF +KS +EDEKL  K + E+KQ + DKC+E++SWLDKNQ+A +DEYEH  KELE VC P+++K+Y
Sbjct:   54 GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDHVVQSDMKHWPFNVINDNTRPKVQVEYKGETKSFYPEEISSMVLTKMKEIAEAYLGKTVNNAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKVGSERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKYKKDISDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGVDFYTSITRARFEELNADLFRGTLDPVEKSLRDAKMDKGQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGIMNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDDVQRDKVSAKNGLESYAFNMKSTVEDEKLAGKISDEDKQKILDKCNEVISWLDKNQTAERDEYEHQQKELEKVCNPIITKLY 661          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Medaka
Match: hsc70 (heat shock protein 70 cognate [Source:NCBI gene;Acc:100049425])

HSP 1 Score: 986.482 bits (2549), Expect = 0.000e+0
Identity = 501/605 (82.81%), Postives = 558/605 (92.23%), Query Frame = 2
Query:  197 VGIDLGTTFSCVGVFQHGKVEIIGNDQGNRTTPSFVAFNDTERLIGDAAKNQAAMNPANTVFDAKRLIGRKFDEPSVQADMKHFSFNVVNVEGRPKIQVEFKGESKTFSAEEISSMVLLKMKETAEAYIGKEVKNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKSSEEKNVLIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRMVDHFIQEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSAQANIEVDSLFEGLDFYTSITRARFEELCADLFRSTLDPVEKSLRDAKMDKNAIHEIVLVGGSTRIPKVQKLLQDYFNGKELNKSINPDEXXXXXXXXXXXILSGDKSXXXXXXXXXXXXXXXXGIETAGGVMTALIKRNSTIPTKQTQTFSTYADNQPGVLIQVFEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKEDIERMVNDAXXXXXXXXXXXXRISSKNALESYAFQVKSAMEDEKLKDKFTAEEKQTVTDKCSEIVSWLDKNQSASKDEYEHHMKELEGVCKPVMSKIY 2011
            +GIDLGTT+SCVGVFQHGKVEII NDQGNRTTPS+VAF DTERLIGDAAKNQ AMNP NTVFDAKRLIGR+FD+  VQ+DMKH+ FNV+N   RPK+QVE+KGE+K+F  EEISSMVL KMKE AEAY+GK V NAV+TVPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKK   E+NVLIFDLGGGTFDVSIL+I+DGIFEVKSTAGDTHLGGEDFDNRMV+HFI EFKRK+KKDIS+NKRAVRRLRTACERAKRTLSSS QA+IE+DSL+EG+DFYTSITRARFEEL ADLFR TLDPVEKSLRDAKMDK  IH+IVLVGGSTRIPK+QKLLQD+FNGKELNKSINPDEAVAYGAAVQAAILSGDKS+ VQDLLLLDV PLSLGIETAGGVMT LIKRN+TIPTKQTQTF+TY+DNQPGVLIQV+EGERAMTKDNNLLGKFEL+GIPPAPRGVPQIEVTFDIDANGI+NVSAV+K TGKENKITITNDKGRLSKEDIERMV +AEKYK ED+ Q++++S+KN LESYAF +KS +EDEKL  K + E+KQ + DKC+E++SWLDKNQ+A +DEYEH  KELE VC P+++K+Y
Sbjct:    4 IGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDHVVQSDMKHWPFNVINDNTRPKVQVEYKGETKSFYPEEISSMVLTKMKEIAEAYLGKTVNNAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKVGSERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKYKKDISDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGVDFYTSITRARFEELNADLFRGTLDPVEKSLRDAKMDKGQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGIMNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDDVQRDKVSAKNGLESYAFNMKSTVEDEKLAGKISDEDKQKILDKCNEVISWLDKNQTAERDEYEHQQKELEKVCNPIITKLY 608          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Medaka
Match: hspa8b (heat shock cognate 70 kDa protein [Source:NCBI gene;Acc:100125490])

HSP 1 Score: 984.171 bits (2543), Expect = 0.000e+0
Identity = 501/608 (82.40%), Postives = 561/608 (92.27%), Query Frame = 2
Query:  188 APAVGIDLGTTFSCVGVFQHGKVEIIGNDQGNRTTPSFVAFNDTERLIGDAAKNQAAMNPANTVFDAKRLIGRKFDEPSVQADMKHFSFNVVNVEGRPKIQVEFKGESKTFSAEEISSMVLLKMKETAEAYIGKEVKNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKSSEEKNVLIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRMVDHFIQEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSAQANIEVDSLFEGLDFYTSITRARFEELCADLFRSTLDPVEKSLRDAKMDKNAIHEIVLVGGSTRIPKVQKLLQDYFNGKELNKSINPDEXXXXXXXXXXXILSGDKSXXXXXXXXXXXXXXXXGIETAGGVMTALIKRNSTIPTKQTQTFSTYADNQPGVLIQVFEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKEDIERMVNDAXXXXXXXXXXXXRISSKNALESYAFQVKSAMEDEKLKDKFTAEEKQTVTDKCSEIVSWLDKNQSASKDEYEHHMKELEGVCKPVMSKIY 2011
             PAVGIDLGTT+SCVGVFQHGKVEII NDQGNRTTPS+VAF DTERLIGDAAKNQ A+NP NTVFDAKRLIGR+FD+  VQ+DMKH+ F V+N   RPK++VE+KGE+KTF  EEISSMVL+KMKE AEAY+GK V NAVVTVPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKK   E+NVLIFDLGGGTFDVSIL+I+DGIFEVKSTAGDTHLGGEDFDNRMV+HFI EFKRK+KKDIS+NKRAVRRLRTACERAKRTLSSS QA+IE+DSL+EG+DFYTSITRARFEEL ADLFR TLDPVEK+LRDAKMDK  IH+IVLVGGSTRIPK+QKLLQD+FNGKELNKSINPDEAVAYGAAVQAAIL GDKS+ VQDLLLLDV PLSLGIETAGGVMT LIKRN+TIPTKQTQTF+TYADNQPGVLIQVFEGERAMTKDNNLLGKF+L+GIPPAPRGVPQIEVTFDIDANGI+NVSAV+K TGKENKITITNDKGRLSKEDIERMV +AEKYK ED+ Q+E++S+KN LESYAF +KS +E+EKLKDK + ++++ + DKC+E++SWLD+NQSA K+E+EH  KELE VC P+M+K+Y
Sbjct:    4 GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVALNPNNTVFDAKRLIGRRFDDSVVQSDMKHWPFTVINDNTRPKVKVEYKGETKTFYPEEISSMVLVKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFISEFKRKYKKDISDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGVDFYTSITRARFEELNADLFRGTLDPVEKALRDAKMDKAQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILCGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYADNQPGVLIQVFEGERAMTKDNNLLGKFDLTGIPPAPRGVPQIEVTFDIDANGIMNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDDVQREKVSAKNGLESYAFNMKSTVEEEKLKDKISEDDRKKILDKCNEVISWLDRNQSAEKEEFEHQQKELEKVCNPIMTKLY 611          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Medaka
Match: hsp70-3 (heat shock protein 70 [Source:NCBI gene;Acc:100125493])

HSP 1 Score: 975.696 bits (2521), Expect = 0.000e+0
Identity = 494/608 (81.25%), Postives = 559/608 (91.94%), Query Frame = 2
Query:  188 APAVGIDLGTTFSCVGVFQHGKVEIIGNDQGNRTTPSFVAFNDTERLIGDAAKNQAAMNPANTVFDAKRLIGRKFDEPSVQADMKHFSFNVVNVEGRPKIQVEFKGESKTFSAEEISSMVLLKMKETAEAYIGKEVKNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKSSEEKNVLIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRMVDHFIQEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSAQANIEVDSLFEGLDFYTSITRARFEELCADLFRSTLDPVEKSLRDAKMDKNAIHEIVLVGGSTRIPKVQKLLQDYFNGKELNKSINPDEXXXXXXXXXXXILSGDKSXXXXXXXXXXXXXXXXGIETAGGVMTALIKRNSTIPTKQTQTFSTYADNQPGVLIQVFEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKEDIERMVNDAXXXXXXXXXXXXRISSKNALESYAFQVKSAMEDEKLKDKFTAEEKQTVTDKCSEIVSWLDKNQSASKDEYEHHMKELEGVCKPVMSKIY 2011
             PAVGIDLGTT+SCVG+FQHGKVEII NDQGNRTTPS+VAF DTERLIGDAAKNQ AMNPANTVFDAKRLIGRKFD+  VQ+DMKH+ F VVN   +PK++VE+KGE KTF  EEISSMVL KMKE +EAY+GK V NAV+TVPAYFNDSQRQATKDAG IAGLNVLRIINEPTAAAIAYGLDKK   E+NVLIFDLGGGTFDVSIL+I+DGIFEVK+TAGDTHLGGEDFDNRMV+HFI EFKRK KK+I+ NKRAVRRLRTACERAKRTLSSS QA+IE+DSL+EG DFYTSITRARFEEL ADLFR T++PVEK+LRDAKMDK+ IH++VLVGGSTRIPK+QKLLQD FNG++LNKSINPDEAVAYGAAVQAAIL+GDKS+ VQDLLLLDV PLSLGIETAGGVMT LIKRN+TIPTKQTQTF+TY+DNQPGVLIQV+EGERAMTKDNN+LGKFEL+GIPPAPRGVPQIEVTFDIDANGILNVSAV+K TGKENKITITNDKGRLSKEDIERMV +AE++K EDE Q+++I++KN+LES AF +KS ++DEKL+DK ++E+K+T+ DKC+EI++WLDKNQ A KDEYEH  KELE VC P++SK+Y
Sbjct:    4 GPAVGIDLGTTYSCVGIFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPANTVFDAKRLIGRKFDDAVVQSDMKHWPFKVVNDSSKPKVEVEYKGEIKTFYPEEISSMVLTKMKEISEAYLGKSVTNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGGERNVLIFDLGGGTFDVSILTIEDGIFEVKATAGDTHLGGEDFDNRMVNHFITEFKRKFKKEITNNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGTDFYTSITRARFEELNADLFRGTIEPVEKALRDAKMDKSQIHDVVLVGGSTRIPKIQKLLQDLFNGRDLNKSINPDEAVAYGAAVQAAILAGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNILGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEQFKAEDESQRDKITAKNSLESLAFNMKSTVDDEKLQDKISSEDKKTIVDKCNEIIAWLDKNQMAEKDEYEHQQKELEKVCNPIISKLY 611          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Medaka
Match: hsp70-3 (heat shock protein 70 [Source:NCBI gene;Acc:100125493])

HSP 1 Score: 966.837 bits (2498), Expect = 0.000e+0
Identity = 491/606 (81.02%), Postives = 558/606 (92.08%), Query Frame = 2
Query:  194 AVGIDLGTTFSCVGVFQHGKVEIIGNDQGNRTTPSFVAFNDTERLIGDAAKNQAAMNPANTVFDAKRLIGRKFDEPSVQADMKHFSFNVVNVEGRPKIQVEFKGESKTFSAEEISSMVLLKMKETAEAYIGKEVKNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKSSEEKNVLIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRMVDHFIQEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSAQANIEVDSLFEGLDFYTSITRARFEELCADLFRSTLDPVEKSLRDAKMDKNAIHEIVLVGGSTRIPKVQKLLQDYFNGKELNKSINPDEXXXXXXXXXXXILSGDKSXXXXXXXXXXXXXXXXGIETAGGVMTALIKRNSTIPTKQTQTFSTYADNQPGVLIQVFEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKEDIERMVNDAXXXXXXXXXXXXRISSKNALESYAFQVKSAMEDEKLKDKFTAEEKQTVTDKCSEIVSWLDKNQSASKDEYEHHMKELEGVCKPVMSKIY 2011
            ++GIDLGTT+SCVG+FQHGKVEII NDQGNRTTPS+VAF DTERLIGDAAKNQ AMNPANTVFDAKRLIGRKFD+  VQ+DMKH+ F VVN   +PK++VE+KGE KTF  EEISSMVL KMKE +EAY+GK V NAV+TVPAYFNDSQRQATKDAG IAGLNVLRIINEPTAAAIAYGLDKK   E+NVLIFDLGGGTFDVSIL+I+DGIFEVK+TAGDTHLGGEDFDNRMV+HFI EFKRK KK+I+ NKRAVRRLRTACERAKRTLSSS QA+IE+DSL+EG DFYTSITRARFEEL ADLFR T++PVEK+LRDAKMDK+ IH++VLVGGSTRIPK+QKLLQD FNG++LNKSINPDEAVAYGAAVQAAIL+GDKS+ VQDLLLLDV PLSLGIETAGGVMT LIKRN+TIPTKQTQTF+TY+DNQPGVLIQV+EGERAMTKDNN+LGKFEL+GIPPAPRGVPQIEVTFDIDANGILNVSAV+K TGKENKITITNDKGRLSKEDIERMV +AE++K EDE Q+++I++KN+LES AF +KS ++DEKL+DK ++E+K+T+ DKC+EI++WLDKNQ A KDEYEH  KELE VC P++SK+Y
Sbjct:   23 SLGIDLGTTYSCVGIFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPANTVFDAKRLIGRKFDDAVVQSDMKHWPFKVVNDSSKPKVEVEYKGEIKTFYPEEISSMVLTKMKEISEAYLGKSVTNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGGERNVLIFDLGGGTFDVSILTIEDGIFEVKATAGDTHLGGEDFDNRMVNHFITEFKRKFKKEITNNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGTDFYTSITRARFEELNADLFRGTIEPVEKALRDAKMDKSQIHDVVLVGGSTRIPKIQKLLQDLFNGRDLNKSINPDEAVAYGAAVQAAILAGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNILGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEQFKAEDESQRDKITAKNSLESLAFNMKSTVDDEKLQDKISSEDKKTIVDKCNEIIAWLDKNQMAEKDEYEHQQKELEKVCNPIISKLY 628          
BLAST of Heat shock cognate 70 kDa protein vs. Planmine SMEST
Match: SMESG000080711.1 (SMESG000080711.1)

HSP 1 Score: 1196.42 bits (3094), Expect = 0.000e+0
Identity = 618/641 (96.41%), Postives = 620/641 (96.72%), Query Frame = 2
Query:  182 MSAPAVGIDLGTTFSCVGVFQHGKVEIIGNDQGNRTTPSFVAFNDTERLIGDAAKNQAAMNPANTVFDAKRLIGRKFDEPSVQADMKHFSFNVVNVEGRPKIQVEFKGESKTFSAEEISSMVLLKMKETAEAYIGKEVKNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKSSEEKNVLIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRMVDHFIQEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSAQANIEVDSLFEGLDFYTSITRARFEELCADLFRSTLDPVEKSLRDAKMDKNAIHEIVLVGGSTRIPKVQKLLQDYFNGKELNKSINPDEXXXXXXXXXXXILSGDKSXXXXXXXXXXXXXXXXGIETAGGVMTALIKRNSTIPTKQTQTFSTYADNQPGVLIQVFEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKEDIERMVNDAXXXXXXXXXXXXRISSKNALESYAFQVKSAMEDEKLKDKFTAEEKQTVTDKCSEIVSWLDKNQSASKDEYEHHMKELEGVCKPVMSKIYGAGMPSGMPFEMPTEMPASGDKSGPSIEELD 2104
            MSAPAVGIDLGTTFSCVGVFQHGKVEIIGNDQGNRTTPSFVAFNDTERLIGDAAKNQAAMNPANTVFDAKRLIGRKFDEPSVQADMKHFSFNVVNVEGRPKIQVEFKGESKTFSAEEISSMVLLKMKETAEAYIGKEVKNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKSS+EKNVLIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRMVDHFIQEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSAQANIEVDSLFEGLDFYTSITRARFEELCADLFRSTLDPVEKSLRDAKMDKNAIHEIVLVGGSTRIPKVQKLLQDYFNGKELNKSINPDEAVAYGAAVQAAILSGDKSDVVQDLLLLDVAPLSLGIETAGGVMTALIKRNSTIPTKQTQTFSTYADNQPGVLIQVFEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKEDIERM                     NALESYAFQVKSAMEDEKLKDKFTAEEK+TVTDKCSEIVSWLDKNQSASKDEYEHHMKELEGVCKPVMSKIYGAGMPSGMPFEMPTEMPASGDKSGPSIEELD
Sbjct:    1 MSAPAVGIDLGTTFSCVGVFQHGKVEIIGNDQGNRTTPSFVAFNDTERLIGDAAKNQAAMNPANTVFDAKRLIGRKFDEPSVQADMKHFSFNVVNVEGRPKIQVEFKGESKTFSAEEISSMVLLKMKETAEAYIGKEVKNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKSSDEKNVLIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRMVDHFIQEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSAQANIEVDSLFEGLDFYTSITRARFEELCADLFRSTLDPVEKSLRDAKMDKNAIHEIVLVGGSTRIPKVQKLLQDYFNGKELNKSINPDEAVAYGAAVQAAILSGDKSDVVQDLLLLDVAPLSLGIETAGGVMTALIKRNSTIPTKQTQTFSTYADNQPGVLIQVFEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKEDIERM---------------------NALESYAFQVKSAMEDEKLKDKFTAEEKKTVTDKCSEIVSWLDKNQSASKDEYEHHMKELEGVCKPVMSKIYGAGMPSGMPFEMPTEMPASGDKSGPSIEELD 620          
BLAST of Heat shock cognate 70 kDa protein vs. Planmine SMEST
Match: SMESG000080727.1 (SMESG000080727.1)

HSP 1 Score: 1171.38 bits (3029), Expect = 0.000e+0
Identity = 621/641 (96.88%), Postives = 621/641 (96.88%), Query Frame = 2
Query:  182 MSAPAVGIDLGTTFSCVGVFQHGKVEIIGNDQGNRTTPSFVAFNDTERLIGDAAKNQAAMNPANTVFDAKRLIGRKFDEPSVQADMKHFSFNVVNVEGRPKIQVEFKGESKTFSAEEISSMVLLKMKETAEAYIGKEVKNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKSSEEKNVLIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRMVDHFIQEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSAQANIEVDSLFEGLDFYTSITRARFEELCADLFRSTLDPVEKSLRDAKMDKNAIHEIVLVGGSTRIPKVQKLLQDYFNGKELNKSINPDEXXXXXXXXXXXILSGDKSXXXXXXXXXXXXXXXXGIETAGGVMTALIKRNSTIPTKQTQTFSTYADNQPGVLIQVFEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKEDIERMVNDAXXXXXXXXXXXXRISSKNALESYAFQVKSAMEDEKLKDKFTAEEKQTVTDKCSEIVSWLDKNQSASKDEYEHHMKELEGVCKPVMSKIYGAGMPSGMPFEMPTEMPASGDKSGPSIEELD 2104
            MSAPAVGIDLGTTFSCVGVFQHGKVEIIGNDQGNRTTPSFVAFNDTERLIGDAAKNQAAMNPANTVFDAKRLIGRKFDEPSVQADMKHFSFNVVNVEGRPKIQVEFKGESKTFSAEEISSMVLLKMKETAEAYIGKEVKNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKSSEEKNVLIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRM                    RAVRRLRTACERAKRTLSSSAQANIEVDSLFEGLDFYTSITRARFEELCADLFRSTLDPVEKSLRDAKMDKNAIHEIVLVGGSTRIPKVQKLLQDYFNGKELNKSINPDEAVAYGAAVQAAILSGDKSDVVQDLLLLDVAPLSLGIETAGGVMTALIKRNSTIPTKQTQTFSTYADNQPGVLIQVFEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKEDIERMVNDAEKYKKEDEEQKERISSKNALESYAFQVKSAMEDEKLKDKFTAEEKQTVTDKCSEIVSWLDKNQSASKDEYEHHMKELEGVCKPVMSKIYGAGMPSGMPFEMPTEMPASGDKSGPSIEELD
Sbjct:    1 MSAPAVGIDLGTTFSCVGVFQHGKVEIIGNDQGNRTTPSFVAFNDTERLIGDAAKNQAAMNPANTVFDAKRLIGRKFDEPSVQADMKHFSFNVVNVEGRPKIQVEFKGESKTFSAEEISSMVLLKMKETAEAYIGKEVKNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKSSEEKNVLIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRM--------------------RAVRRLRTACERAKRTLSSSAQANIEVDSLFEGLDFYTSITRARFEELCADLFRSTLDPVEKSLRDAKMDKNAIHEIVLVGGSTRIPKVQKLLQDYFNGKELNKSINPDEAVAYGAAVQAAILSGDKSDVVQDLLLLDVAPLSLGIETAGGVMTALIKRNSTIPTKQTQTFSTYADNQPGVLIQVFEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKEDIERMVNDAEKYKKEDEEQKERISSKNALESYAFQVKSAMEDEKLKDKFTAEEKQTVTDKCSEIVSWLDKNQSASKDEYEHHMKELEGVCKPVMSKIYGAGMPSGMPFEMPTEMPASGDKSGPSIEELD 621          
BLAST of Heat shock cognate 70 kDa protein vs. Planmine SMEST
Match: SMESG000040632.1 (SMESG000040632.1)

HSP 1 Score: 1022.31 bits (2642), Expect = 0.000e+0
Identity = 530/646 (82.04%), Postives = 590/646 (91.33%), Query Frame = 2
Query:  188 APAVGIDLGTTFSCVGVFQHGKVEIIGNDQGNRTTPSFVAFNDTERLIGDAAKNQAAMNPANTVFDAKRLIGRKFDEPSVQADMKHFSFNVVNVEGRPKIQVEFKGESKTFSAEEISSMVLLKMKETAEAYIGKEVKNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKSSEEKNVLIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRMVDHFIQEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSAQANIEVDSLFEGLDFYTSITRARFEELCADLFRSTLDPVEKSLRDAKMDKNAIHEIVLVGGSTRIPKVQKLLQDYFNGKELNKSINPDEXXXXXXXXXXXILSGDKSXXXXXXXXXXXXXXXXGIETAGGVMTALIKRNSTIPTKQTQTFSTYADNQPGVLIQVFEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKEDIERMVNDAXXXXXXXXXXXXRISSKNALESYAFQVKSAMEDEKLKDKFTAEEKQTVTDKCSEIVSWLDKNQSASKDEYEHHMKELEGVCKPVMSKIYGA--GMPSGMP-----FEMPTEMPASGDKSGPSIEELD 2104
             PAVGIDLGTT+SCVGVFQHGKVEII NDQGNRTTPS+VAF DTERLIGDAAKNQ AMNP NTVFDAKRLIGR+F++ SVQ+DMKH+SF+VV   GRPKIQV++KGE K F  EEISSMVLLKMKETAEAY+G+ V +AVVTVPAYFNDSQRQATKDAGAI+GLNVLRIINEPTAAAIAYGLDKK   E+NVLIFDLGGGTFDVSIL+I+DGIFEVKSTAGDTHLGGEDFDNRMV+HFIQEFKRKHKKDIS+NKRAVRRLRTACERAKRTLSSSAQANIE+DSL+EG+DFYTSITRARFEEL ADLFRSTL+PVEKSLRDAKMDK  IHEIVLVGGSTRIPK+QKLLQD F+GKELNKSINPDEAVAYGAAVQAAILSGDKS+ VQDLLLLDVAPLSLGIETAGGVMTALIKRN+TIPTKQTQTF+TY+DNQPGVLIQV+EGERAMT+DNNLLGKFELSGIPPAPRGVPQ+EVTFDIDANGILNVSAVEK TGKENKITI+NDKGRLSK+DIERMV++AEKYK++DE QKER+++KNALESYA+Q+K+ MEDEKLKDK +  +++ + DKC+E++ WL+ NQ+A K+EYEHH KELE VC P+M+K Y A  GMPSG P      + P   P SG   GP+IEE+D
Sbjct:    4 GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRRFEDASVQSDMKHWSFDVVTEGGRPKIQVDYKGEVKKFFPEEISSMVLLKMKETAEAYLGRNVTDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGIERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANIEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKSLRDAKMDKKDIHEIVLVGGSTRIPKIQKLLQDLFHGKELNKSINPDEAVAYGAAVQAAILSGDKSEAVQDLLLLDVAPLSLGIETAGGVMTALIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTRDNNLLGKFELSGIPPAPRGVPQVEVTFDIDANGILNVSAVEKSTGKENKITISNDKGRLSKDDIERMVSEAEKYKQQDELQKERVTAKNALESYAYQMKATMEDEKLKDKLSEPDRKAIVDKCAEVIGWLEHNQTAEKEEYEHHQKELEKVCNPIMTKFYQASGGMPSGFPGAPGAGQAPPGAPGSG--QGPTIEEVD 647          
BLAST of Heat shock cognate 70 kDa protein vs. Planmine SMEST
Match: SMESG000051815.1 (SMESG000051815.1)

HSP 1 Score: 1016.53 bits (2627), Expect = 0.000e+0
Identity = 527/644 (81.83%), Postives = 591/644 (91.77%), Query Frame = 2
Query:  182 MSAPAVGIDLGTTFSCVGVFQHGKVEIIGNDQGNRTTPSFVAFNDTERLIGDAAKNQAAMNPANTVFDAKRLIGRKFDEPSVQADMKHFSFNVVNVEGRPKIQVEFKGESKTFSAEEISSMVLLKMKETAEAYIGKEVKNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKSSEEKNVLIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRMVDHFIQEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSAQANIEVDSLFEGLDFYTSITRARFEELCADLFRSTLDPVEKSLRDAKMDKNAIHEIVLVGGSTRIPKVQKLLQDYFNGKELNKSINPDEXXXXXXXXXXXILSGDKSXXXXXXXXXXXXXXXXGIETAGGVMTALIKRNSTIPTKQTQTFSTYADNQPGVLIQVFEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKEDIERMVNDAXXXXXXXXXXXXRISSKNALESYAFQVKSAMEDEKLKDKFTAEEKQTVTDKCSEIVSWLDKNQSASKDEYEHHMKELEGVCKPVMSKIY---GAGMPSGMPFEMPTEMPASGDKSGPSIEELD 2104
            MS  A+GIDLGTT+SCVGVFQHGKVEII NDQGNRTTPS+VAF DTERLIGDAAKNQ AMNP NTVFDAKRLIGRKFDEPSVQ+DMKH+SF+V++  GRPKI++EFKGE KTF  EEISSMVL+KMKE AEAY+GK VK+AV+TVPAYFNDSQRQATKDAGAI+GLNVLRIINEPTAAAIAYGLDKK   E+NVLIFDLGGGTFDVSIL+I+DGIFEVKSTAGDTHLGGEDFDNRMV+HFIQEFKRKHKKDIS+NKRAVRRLRTACERAKRTLSSSAQAN+E+DSL+EG+DFYTSITRARFEEL ADLFRSTL+PVEKSLRDAK+DKNAIH+IVLVGGSTRIPK+QKLLQD FNGKELNKSINPDEAVAYGAAVQAAILSGDKS+ VQDLLLLDVAPLSLGIETAGGVMTALIKRN+TIPTKQTQ F+TY+DNQPGVLIQV+EGERAMTKDNNLLGKFEL+GIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSK+DIERMVN+AEKYKKEDE+QKERI++KN+LESY++Q+KS +EDEKLKDK +  +++ + +KC E ++WL+KNQ ASKDE+++H KELE +C P+M+K+Y   G        F       +  DK GP++EE+D
Sbjct:    1 MSVNAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDEPSVQSDMKHWSFDVISEAGRPKIKIEFKGEKKTFYPEEISSMVLIKMKEIAEAYLGKIVKDAVITVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANVEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKSLRDAKLDKNAIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEAVAYGAAVQAAILSGDKSEAVQDLLLLDVAPLSLGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNEAEKYKKEDEDQKERIAAKNSLESYSYQMKSTVEDEKLKDKISESDRKKIIEKCQEAITWLEKNQQASKDEFDYHYKELEKLCNPIMAKMYQGAGGAGGFPGGFPGAPGAHSGDDKQGPTVEEVD 644          
BLAST of Heat shock cognate 70 kDa protein vs. Planmine SMEST
Match: SMESG000051570.1 (SMESG000051570.1)

HSP 1 Score: 1010.75 bits (2612), Expect = 0.000e+0
Identity = 519/610 (85.08%), Postives = 576/610 (94.43%), Query Frame = 2
Query:  182 MSAPAVGIDLGTTFSCVGVFQHGKVEIIGNDQGNRTTPSFVAFNDTERLIGDAAKNQAAMNPANTVFDAKRLIGRKFDEPSVQADMKHFSFNVVNVEGRPKIQVEFKGESKTFSAEEISSMVLLKMKETAEAYIGKEVKNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKSSEEKNVLIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRMVDHFIQEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSAQANIEVDSLFEGLDFYTSITRARFEELCADLFRSTLDPVEKSLRDAKMDKNAIHEIVLVGGSTRIPKVQKLLQDYFNGKELNKSINPDEXXXXXXXXXXXILSGDKSXXXXXXXXXXXXXXXXGIETAGGVMTALIKRNSTIPTKQTQTFSTYADNQPGVLIQVFEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKEDIERMVNDAXXXXXXXXXXXXRISSKNALESYAFQVKSAMEDEKLKDKFTAEEKQTVTDKCSEIVSWLDKNQSASKDEYEHHMKELEGVCKPVMSKIY 2011
            MS  A+GIDLGTT+SCVGVFQHGKVEII NDQGNRTTPS+VAF DTERLIGDAAKNQ AMNP NTVFDAKRLIGRKFDE SVQ+DMKH+SF+V+N  GRPKI+VEFKGE+KTF  EEISSMVL+KMKE AEAY+GK VK+AVVTVPAYFNDSQRQATKDAGAI+GLNVLRIINEPTAAAIAYGLDKK   E+NVLIFDLGGGTFDVSIL+I+DGIFEVKSTAGDTHLGGEDFDNRMV+HFIQEFKRKHKKDIS+NKRAVRRLRTACERAKRTLSSSAQAN+E+DSL+EG+DFYTSITRARFEEL ADLFRSTL+PVEK+LRDAK+DKN IH+IVLVGGSTRIPK+QKLLQD FNGKELNKSINPDEAVAYGAAVQAAILSGDKS+ VQDLLLLDVAPLSLGIETAGGVMTALIKRN+TIPTKQTQ F+TY+DNQPGVLIQV+EGERAMTKDNNLLGKFEL+GIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSK+DIERMVN+AEKYKKEDEEQK+RI+ KN+LESYA+Q+KS +EDEKLKDK +  +++ + DKC E ++WL+KNQ A+K+E+E+H KELE +C P+M+K+Y
Sbjct:    1 MSGNAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQDLFNGKELNKSINPDEAVAYGAAVQAAILSGDKSEAVQDLLLLDVAPLSLGIETAGGVMTALIKRNTTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKITITNDKGRLSKDDIERMVNEAEKYKKEDEEQKDRIAGKNSLESYAYQMKSTVEDEKLKDKISESDRKLIIDKCQEAINWLEKNQQATKEEFEYHYKELEKLCNPIMTKMY 610          
The following BLAST results are available for this feature:
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HSPA80.000e+083.39heat shock protein family A (Hsp70) member 8 [Sour... [more]
HSPA80.000e+083.39heat shock protein family A (Hsp70) member 8 [Sour... [more]
HSPA80.000e+083.39heat shock protein family A (Hsp70) member 8 [Sour... [more]
HSPA1B0.000e+080.92heat shock protein family A (Hsp70) member 1B [Sou... [more]
HSPA1A0.000e+080.92heat shock protein family A (Hsp70) member 1A [Sou... [more]
back to top
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hsp-10.000e+082.37Heat shock 70 kDa protein A [Source:UniProtKB/Swi... [more]
hsp-10.000e+082.37Heat shock 70 kDa protein A [Source:UniProtKB/Swi... [more]
F44E5.50.000e+067.54pep chromosome:WBcel235:II:11759681:11761808:1 gen... [more]
F44E5.50.000e+067.54pep chromosome:WBcel235:II:11759640:11761853:1 gen... [more]
F44E5.40.000e+067.54pep chromosome:WBcel235:II:11757106:11759323:-1 ge... [more]
back to top
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hsc70-40.000e+081.25gene:FBgn0266599 transcript:FBtr0083059[more]
Hsc70-40.000e+081.25gene:FBgn0266599 transcript:FBtr0337053[more]
Hsc70-40.000e+081.25gene:FBgn0266599 transcript:FBtr0083058[more]
Hsc70-40.000e+081.25gene:FBgn0266599 transcript:FBtr0083060[more]
Hsc70-40.000e+081.25gene:FBgn0266599 transcript:FBtr0083057[more]
back to top
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hspa80.000e+082.89heat shock protein 8 [Source:NCBI gene;Acc:573376][more]
hsp70l0.000e+079.19heat shock cognate 70-kd protein, like [Source:ZFI... [more]
hspa80.000e+082.89heat shock protein 8 [Source:NCBI gene;Acc:573376][more]
hspa80.000e+082.89heat shock protein 8 [Source:NCBI gene;Acc:573376][more]
hspa80.000e+082.89heat shock protein 8 [Source:NCBI gene;Acc:573376][more]
back to top
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wdr260.000e+080.03WD repeat domain 26 [Source:Xenbase;Acc:XB-GENE-99... [more]
wdr260.000e+082.03WD repeat domain 26 [Source:Xenbase;Acc:XB-GENE-99... [more]
wdr260.000e+082.40WD repeat domain 26 [Source:Xenbase;Acc:XB-GENE-99... [more]
wdr260.000e+082.40WD repeat domain 26 [Source:Xenbase;Acc:XB-GENE-99... [more]
ENSXETT00000032295.10.000e+081.91heat shock protein family A (Hsp70) member 1A [Sou... [more]
back to top
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hspa80.000e+083.55heat shock protein 8 [Source:MGI Symbol;Acc:MGI:10... [more]
Hspa1l0.000e+078.02heat shock protein 1-like [Source:MGI Symbol;Acc:M... [more]
Hspa1b0.000e+077.55heat shock protein 1B [Source:MGI Symbol;Acc:MGI:9... [more]
Hspa1a0.000e+077.74heat shock protein 1A [Source:MGI Symbol;Acc:MGI:9... [more]
Hspa80.000e+080.76heat shock protein 8 [Source:MGI Symbol;Acc:MGI:10... [more]
back to top
BLAST of Heat shock cognate 70 kDa protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P63018|HSP7C_RAT0.000e+083.55Heat shock cognate 71 kDa protein OS=Rattus norveg... [more]
sp|P63017|HSP7C_MOUSE0.000e+083.55Heat shock cognate 71 kDa protein OS=Mus musculus ... [more]
sp|Q71U34|HSP7C_SAGOE0.000e+083.39Heat shock cognate 71 kDa protein OS=Saguinus oedi... [more]
sp|P11142|HSP7C_HUMAN0.000e+083.39Heat shock cognate 71 kDa protein OS=Homo sapiens ... [more]
sp|A2Q0Z1|HSP7C_HORSE0.000e+083.39Heat shock cognate 71 kDa protein OS=Equus caballu... [more]
back to top
BLAST of Heat shock cognate 70 kDa protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0R3SCM20.000e+080.43Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
A0A2C9JTE20.000e+081.27Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A158P1Z10.000e+080.59Uncharacterized protein OS=Atta cephalotes OX=1295... [more]
A0A151IKI90.000e+080.25Heat shock 70 kDa protein cognate 4 OS=Cyphomyrmex... [more]
A0A0X3PU490.000e+079.13Heat shock cognate protein OS=Schistocephalus soli... [more]
back to top
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hspa80.000e+082.57heat shock cognate 71 kDa protein [Source:NCBI gen... [more]
hspa8b0.000e+082.57heat shock cognate 70 kDa protein-like [Source:NCB... [more]
ENSAMXT00000004733.20.000e+082.18pep primary_assembly:Astyanax_mexicanus-2.0:20:275... [more]
ENSAMXT00000037064.10.000e+077.86heat shock 70 kDa protein [Source:NCBI gene;Acc:11... [more]
hsc700.000e+081.25heat shock cognate 71 kDa protein-like [Source:NCB... [more]
back to top
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hspa50.000e+064.31heat shock protein 5 [Source:NCBI gene;Acc:378848][more]
hspa91.236e-18050.08heat shock protein 9 [Source:ZFIN;Acc:ZDB-GENE-030... [more]
hspa144.180e-9233.86heat shock protein 14 [Source:NCBI gene;Acc:565232... [more]
hspa136.253e-7336.49heat shock protein 70 family, member 13 [Source:ZF... [more]
ENSPMAT00000003663.18.714e-634.78pep scaffold:Pmarinus_7.0:GL498042:47:1690:1 gene:... [more]
back to top
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
SSA10.000e+078.38ATPase involved in protein folding and NLS-directe... [more]
SSA20.000e+075.23HSP70 family ATP-binding protein; involved in prot... [more]
SSA30.000e+071.80ATPase involved in protein folding and the respons... [more]
SSA40.000e+075.74Heat shock protein that is highly induced upon str... [more]
KAR20.000e+060.69ATPase involved in protein import into the ER; als... [more]
back to top
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO372800.000e+078.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO303230.000e+077.34Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO445300.000e+072.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO332960.000e+064.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO477231.924e-17951.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hsc700.000e+082.89heat shock protein 70 cognate [Source:NCBI gene;Ac... [more]
hsc700.000e+082.81heat shock protein 70 cognate [Source:NCBI gene;Ac... [more]
hspa8b0.000e+082.40heat shock cognate 70 kDa protein [Source:NCBI gen... [more]
hsp70-30.000e+081.25heat shock protein 70 [Source:NCBI gene;Acc:100125... [more]
hsp70-30.000e+081.02heat shock protein 70 [Source:NCBI gene;Acc:100125... [more]
back to top
BLAST of Heat shock cognate 70 kDa protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000080711.10.000e+096.41SMESG000080711.1[more]
SMESG000080727.10.000e+096.88SMESG000080727.1[more]
SMESG000040632.10.000e+082.04SMESG000040632.1[more]
SMESG000051815.10.000e+081.83SMESG000051815.1[more]
SMESG000051570.10.000e+085.08SMESG000051570.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027920 ID=SMED30027920|Name=Heat shock cognate 70 kDa protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2167bp
TTGTTTATACAATGACAACTAATTATCCAATTATAATCAAATTTAATTAA
TTTATTAAAATTATCAGTATATATTTAAAATTAATTTGAATTTACTCATG
GAAATCTAGAACATTCTTGATAGAATTTTCTTTGTTTTAAAAACTTTAAT
TTCAATTACATTCAAAAGAATTCTATTAAAAATGTCTGCACCAGCCGTTG
GTATTGATTTAGGAACCACATTCTCATGTGTCGGTGTATTCCAACACGGT
AAAGTTGAGATTATTGGAAATGATCAAGGAAACAGAACAACTCCATCATT
CGTTGCTTTCAACGACACAGAAAGATTGATTGGAGACGCTGCTAAAAACC
AGGCAGCAATGAATCCAGCAAACACTGTATTTGATGCCAAACGTTTGATT
GGTAGAAAATTTGACGAACCATCAGTTCAAGCTGATATGAAGCATTTCTC
ATTCAACGTTGTCAATGTTGAAGGTCGTCCTAAAATTCAAGTTGAATTCA
AAGGAGAGTCGAAAACATTTTCAGCTGAAGAAATTTCGTCAATGGTTCTT
CTTAAGATGAAAGAAACTGCTGAAGCTTATATTGGAAAGGAAGTAAAAAA
TGCTGTTGTTACAGTGCCAGCATATTTTAATGACAGCCAACGTCAAGCCA
CCAAGGATGCTGGTGCAATTGCTGGTTTGAATGTATTGAGAATTATCAAT
GAACCAACTGCAGCAGCTATTGCATATGGTCTTGATAAGAAGAGTAGTGA
AGAAAAGAATGTTTTGATCTTTGATCTCGGAGGAGGAACTTTTGATGTAT
CAATCTTATCGATCGATGATGGTATTTTTGAAGTTAAGTCAACTGCTGGA
GATACTCATTTGGGCGGTGAAGATTTTGATAACCGAATGGTTGATCATTT
CATTCAAGAGTTCAAGAGAAAACACAAAAAAGATATAAGTGAAAACAAGA
GAGCTGTTCGAAGATTGAGAACTGCTTGTGAAAGGGCAAAGAGAACATTA
TCTTCAAGTGCTCAAGCTAATATTGAAGTCGACTCATTATTCGAAGGACT
TGATTTCTATACTTCCATTACTCGTGCAAGATTCGAAGAATTGTGTGCTG
ATTTATTTAGATCTACTTTGGACCCAGTTGAAAAGTCTTTAAGAGACGCT
AAGATGGATAAGAATGCTATTCATGAAATCGTTCTTGTAGGTGGATCAAC
TAGAATTCCAAAAGTACAAAAGTTATTACAAGATTATTTCAACGGTAAAG
AATTGAACAAATCAATCAATCCTGATGAAGCTGTAGCTTATGGTGCTGCT
GTTCAAGCTGCTATCTTATCTGGAGACAAGAGCGATGTCGTTCAAGATTT
ATTGTTGCTTGATGTTGCTCCATTGAGTTTAGGTATTGAAACTGCTGGAG
GAGTAATGACAGCTCTTATTAAGAGAAACTCTACTATTCCAACAAAACAA
ACTCAAACATTTTCAACTTACGCCGACAACCAACCAGGTGTCTTGATTCA
AGTATTTGAAGGTGAAAGAGCCATGACTAAAGATAATAACCTACTCGGTA
AATTTGAACTATCTGGAATTCCACCTGCTCCAAGAGGTGTTCCTCAAATT
GAAGTCACATTCGATATCGATGCCAATGGTATTTTGAACGTGTCTGCAGT
TGAAAAAGGCACTGGAAAAGAAAACAAGATCACCATTACTAATGACAAAG
GTCGTCTATCAAAAGAAGATATTGAAAGAATGGTAAATGATGCCGAAAAG
TACAAGAAAGAAGATGAAGAACAAAAAGAAAGAATTTCATCAAAGAATGC
ATTAGAAAGCTATGCTTTTCAAGTGAAATCGGCTATGGAAGATGAAAAAT
TGAAAGACAAATTCACCGCTGAGGAGAAACAGACTGTTACCGATAAGTGT
AGTGAAATAGTGTCATGGTTAGACAAAAATCAATCGGCTTCAAAAGATGA
ATACGAACACCACATGAAAGAATTGGAAGGTGTCTGTAAGCCAGTTATGA
GCAAAATCTATGGAGCTGGTATGCCATCAGGAATGCCTTTTGAAATGCCA
ACTGAGATGCCAGCTTCAGGTGACAAATCTGGACCAAGCATTGAAGAACT
TGACTAAATTTAATAAAATTTATGGATATTTGATATCTTATTTTTGAATT
TAATGCAGATCGGAAGA
back to top

protein sequence of SMED30027920-orf-1

>SMED30027920-orf-1 ID=SMED30027920-orf-1|Name=SMED30027920-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=642bp
MSAPAVGIDLGTTFSCVGVFQHGKVEIIGNDQGNRTTPSFVAFNDTERLI
GDAAKNQAAMNPANTVFDAKRLIGRKFDEPSVQADMKHFSFNVVNVEGRP
KIQVEFKGESKTFSAEEISSMVLLKMKETAEAYIGKEVKNAVVTVPAYFN
DSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKSSEEKNVLIFDLG
GGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRMVDHFIQEFKRKHKK
DISENKRAVRRLRTACERAKRTLSSSAQANIEVDSLFEGLDFYTSITRAR
FEELCADLFRSTLDPVEKSLRDAKMDKNAIHEIVLVGGSTRIPKVQKLLQ
DYFNGKELNKSINPDEAVAYGAAVQAAILSGDKSDVVQDLLLLDVAPLSL
GIETAGGVMTALIKRNSTIPTKQTQTFSTYADNQPGVLIQVFEGERAMTK
DNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKENKI
TITNDKGRLSKEDIERMVNDAEKYKKEDEEQKERISSKNALESYAFQVKS
AMEDEKLKDKFTAEEKQTVTDKCSEIVSWLDKNQSASKDEYEHHMKELEG
VCKPVMSKIYGAGMPSGMPFEMPTEMPASGDKSGPSIEELD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000499cell
PLANA:0000074oocyte
PLANA:0000099neuron
PLANA:0000204ovary
PLANA:0000231vitelline gland
PLANA:0002089reproductive organ
PLANA:0002109X1 cell
Vocabulary: biological process
TermDefinition
GO:0046686response to cadmium ion
GO:0046688response to copper ion
GO:1903842response to arsenite ion
GO:0043624cellular protein complex disassembly
GO:0044743protein transmembrane import into intracellular organelle
GO:0044849estrous cycle
GO:0045471response to ethanol
GO:0045862positive regulation of proteolysis
GO:0045892negative regulation of transcription, DNA-templated
GO:0046777protein autophosphorylation
GO:0050766positive regulation of phagocytosis
GO:0051085chaperone mediated protein folding requiring cofactor
GO:0061077chaperone-mediated protein folding
GO:0061635regulation of protein complex stability
GO:0061684chaperone-mediated autophagy
GO:0061741chaperone-mediated protein transport involved in chaperone-mediated autophagy
GO:0071276cellular response to cadmium ion
GO:0072318clathrin coat disassembly
GO:0097214positive regulation of lysosomal membrane permeability
GO:1903206negative regulation of hydrogen peroxide-induced cell death
GO:1904592positive regulation of protein refolding
GO:1904764chaperone-mediated autophagy translocation complex disassembly
GO:0032355response to estradiol
GO:0032570response to progesterone
GO:0034605cellular response to heat
GO:0042026protein refolding
GO:0042493response to drug
GO:0042594response to starvation
GO:0043085positive regulation of catalytic activity
GO:0000082G1/S transition of mitotic cell cycle
GO:0001822kidney development
GO:0001916positive regulation of T cell mediated cytotoxicity
GO:0006351transcription, DNA-templated
GO:0006355regulation of transcription, DNA-templated
GO:0006397mRNA processing
GO:0006606protein import into nucleus
GO:0007519skeletal muscle tissue development
GO:0007568aging
GO:0007608sensory perception of smell
GO:0010045response to nickel cation
GO:0010628positive regulation of gene expression
GO:0010667negative regulation of cardiac muscle cell apoptotic process
GO:0014823response to activity
GO:0016191synaptic vesicle uncoating
GO:0021549cerebellum development
GO:0030900forebrain development
GO:1990832slow axonal transport
GO:1990834response to odorant
GO:0008088axo-dendritic transport
GO:0008380RNA splicing
GO:0009408response to heat
Vocabulary: INTERPRO
TermDefinition
IPR043129ATPase_NBD
IPR019651Glutamate_DH_NAD-spec
IPR013126Hsp_70_fam
IPR029048HSP70_C_sf
IPR029047HSP70_peptide-bd_sf
IPR018181Heat_shock_70_CS
Vocabulary: cellular component
TermDefinition
GO:0043204perikaryon
GO:0043234protein complex
GO:0044309neuron spine
GO:0045121membrane raft
GO:0048471perinuclear region of cytoplasm
GO:0070062extracellular exosome
GO:0099523presynaptic cytosol
GO:0099524postsynaptic cytosol
GO:0032279asymmetric synapse
GO:0042470melanosome
GO:0043005neuron projection
GO:0043025neuronal cell body
GO:0043195terminal bouton
GO:0043197dendritic spine
GO:0043198dendritic shaft
GO:0000974Prp19 complex
GO:0001917photoreceptor inner segment
GO:0005634nucleus
GO:0005681spliceosomal complex
GO:0005730nucleolus
GO:0005737cytoplasm
GO:0005764lysosome
GO:0005765lysosomal membrane
GO:0005776autophagosome
GO:0005829cytosol
GO:0005874microtubule
GO:0005882intermediate filament
GO:0005886plasma membrane
GO:0008021synaptic vesicle
GO:0014069postsynaptic density
GO:0016020membrane
GO:0030424axon
GO:0030425dendrite
GO:0030529intracellular ribonucleoprotein complex
GO:1990124messenger ribonucleoprotein complex
GO:1990836lysosomal matrix
GO:0009986cell surface
Vocabulary: molecular function
TermDefinition
GO:0043531ADP binding
GO:0051082unfolded protein binding
GO:1904593prostaglandin binding
GO:0031686A1 adenosine receptor binding
GO:0042277peptide binding
GO:0042623ATPase activity, coupled
GO:0000166nucleotide binding
GO:0003723RNA binding
GO:0005102signaling receptor binding
GO:0005515protein binding
GO:0005524ATP binding
GO:0016887ATPase activity
GO:0019899enzyme binding
GO:1990833clathrin-uncoating ATPase activity
GO:0008134transcription factor binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 313..317
NoneNo IPR availableCOILSCoilCoilcoord: 187..214
NoneNo IPR availablePRINTSPR00301HEATSHOCK70coord: 6..22
score: 80.33
coord: 38..58
score: 81.87
coord: 65..84
score: 84.67
coord: 146..162
score: 86.34
NoneNo IPR availableGENE3DG3DSA:3.30.420.40coord: 1..40
e-value: 1.5E-20
score: 75.2
NoneNo IPR availableGENE3DG3DSA:3.30.420.40coord: 41..53
e-value: 1.5E-20
score: 75.2
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 298..317
NoneNo IPR availablePANTHERPTHR19375:SF239HEAT SHOCK COGNATE 71 KDA PROTEINcoord: 1..293
IPR029048Heat shock protein 70kD, C-terminal domain superfamilyGENE3DG3DSA:1.20.1270.10coord: 185..288
e-value: 1.8E-37
score: 129.6
IPR029048Heat shock protein 70kD, C-terminal domain superfamilySUPERFAMILYSSF100934Heat shock protein 70kD (HSP70), C-terminal subdomaincoord: 213..290
IPR013126Heat shock protein 70 familyPFAMPF00012HSP70coord: 2..286
e-value: 3.0E-102
score: 342.8
IPR013126Heat shock protein 70 familyPANTHERPTHR19375HEAT SHOCK PROTEIN 70KDAcoord: 1..293
IPR029047Heat shock protein 70kD, peptide-binding domain superfamilyGENE3DG3DSA:2.60.34.10coord: 56..184
e-value: 2.7E-65
score: 219.9
IPR029047Heat shock protein 70kD, peptide-binding domain superfamilySUPERFAMILYSSF100920Heat shock protein 70kD (HSP70), peptide-binding domaincoord: 63..218
IPR018181Heat shock protein 70, conserved sitePROSITEPS01036HSP70_3coord: 9..23
IPR043129ATPase, nucleotide binding domainSUPERFAMILYSSF53067Actin-like ATPase domaincoord: 2..57