Estrella

Overview
NameEstrella
Smed IDSMED30027919
Length (bp)1374
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027919

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30027919SMESG000026791.1 SmedASXL_010887SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
parenchymal cellSMED30027919SMESG000026791.1 dd_Smed_v4_1792_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30027919SMESG000026791.1 dd_Smed_v6_1792_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30027919SMESG000026791.1 OX_Smed_1.0.07343ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
glial cellSMED30027919SMESG000026791.1 dd_Smed_v6_1792_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Estrella vs. TrEMBL
Match: A0A1Z1R2Q3 (Estrella OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 718.383 bits (1853), Expect = 0.000e+0
Identity = 353/355 (99.44%), Postives = 353/355 (99.44%), Query Frame = 2
Query:  215 MLRILAKIFTLGLILATCGAVSKLNRLNLVQVNISNIIYKQLMTTKDNVLAASPLAILDVNLLKKHKCYKNIRTNSWSFMMPIIFWDDSYMTNVANSIQKMSKLKNFVSEKPFILPPSGFRSYRLNWRRDLNDVFNNLIRIDSSWYPANIDYVLPKWQNFLIEFVSDQNYTGLCVETKNRLLNESFQSFEFVIEFARNVRKTNNIQE-VIKIKDIQTVKMFNESGCDMGQSSRCTVSSDYAEKWAYDVSVEIMKNVSSNSLSLQSDIYEKVLQYLCKDKVPIESVGVKRLKKIDKDELACQIPQNMTQTNRCENRYYYGSYRYECLNYGENVVTKLLLNDAYSEVSQFSIPITKL 1276
            MLRILAKIFTLGLILATCGAVSKLNRLNLVQVNISNIIYKQLMTTKDNVLAASPLAILDVNLLKKHKCYKNIRTNSWSFMMPIIFWDDSYMTNVANSIQKMSKLKNFVSEKPFILPPSGFRSYRLNWRRDLNDVFNN IRIDSSWYPANIDYVLPKWQNFLIEFVSDQNYTGLCVETKNRLLNESFQSFEFVIEFARNVRKTNNIQE VIKIKDIQTVKMFNESGCDMGQSSRCTVSSDYAEKWAYDVSVEIMKNVSSNSLSLQSDIYEKVLQYLCKDKVPIESVGVKRLKKIDKDELACQIPQNMTQTNRCENRYYYGSYRYECLNYGENVVTKLLLNDAYSEVSQFSIPITKL
Sbjct:    1 MLRILAKIFTLGLILATCGAVSKLNRLNLVQVNISNIIYKQLMTTKDNVLAASPLAILDVNLLKKHKCYKNIRTNSWSFMMPIIFWDDSYMTNVANSIQKMSKLKNFVSEKPFILPPSGFRSYRLNWRRDLNDVFNNPIRIDSSWYPANIDYVLPKWQNFLIEFVSDQNYTGLCVETKNRLLNESFQSFEFVIEFARNVRKTNNIQEVVIKIKDIQTVKMFNESGCDMGQSSRCTVSSDYAEKWAYDVSVEIMKNVSSNSLSLQSDIYEKVLQYLCKDKVPIESVGVKRLKKIDKDELACQIPQNMTQTNRCENRYYYGSYRYECLNYGENVVTKLLLNDAYSEVSQFSIPITKL 355          
BLAST of Estrella vs. TrEMBL
Match: A0A1P8CUY3 (Estrella/neura-1 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 468.389 bits (1204), Expect = 4.945e-163
Identity = 230/232 (99.14%), Postives = 230/232 (99.14%), Query Frame = 2
Query:  452 MMPIIFWDDSYMTNVANSIQKMSKLKNFVSEKPFILPPSGFRSYRLNWRRDLNDVFNNLIRIDSSWYPANIDYVLPKWQNFLIEFVSDQNYTGLCVETKNRLLNESFQSFEFVIEFARNVRKTNNIQE-VIKIKDIQTVKMFNESGCDMGQSSRCTVSSDYAEKWAYDVSVEIMKNVSSNSLSLQSDIYEKVLQYLCKDKVPIESVGVKRLKKIDKDELACQIPQNMTQTNR 1144
            MMPIIFWDDSYMTNVANSIQKMSKLKNFVSEKPFILPPSGFRSYRLNWRRDLNDVFNN IRIDSSWYPANIDYVLPKWQNFLIEFVSDQNYTGLCVETKNRLLNESFQSFEFVIEFARNVRKTNNIQE VIKIKDIQTVKMFNESGCDMGQSSRCTVSSDYAEKWAYDVSVEIMKNVSSNSLSLQSDIYEKVLQYLCKDKVPIESVGVKRLKKIDKDELACQIPQNMTQTNR
Sbjct:    1 MMPIIFWDDSYMTNVANSIQKMSKLKNFVSEKPFILPPSGFRSYRLNWRRDLNDVFNNPIRIDSSWYPANIDYVLPKWQNFLIEFVSDQNYTGLCVETKNRLLNESFQSFEFVIEFARNVRKTNNIQEVVIKIKDIQTVKMFNESGCDMGQSSRCTVSSDYAEKWAYDVSVEIMKNVSSNSLSLQSDIYEKVLQYLCKDKVPIESVGVKRLKKIDKDELACQIPQNMTQTNR 232          
BLAST of Estrella vs. Planmine SMEST
Match: SMESG000026791.1 (SMESG000026791.1)

HSP 1 Score: 714.146 bits (1842), Expect = 0.000e+0
Identity = 351/355 (98.87%), Postives = 351/355 (98.87%), Query Frame = 2
Query:  215 MLRILAKIFTLGLILATCGAVSKLNRLNLVQVNISNIIYKQLMTTKDNVLAASPLAILDVNLLKKHKCYKNIRTNSWSFMMPIIFWDDSYMTNVANSIQKMSKLKNFVSEKPFILPPSGFRSYRLNWRRDLNDVFNNLIRIDSSWYPANIDYVLPKWQNFLIEFVSDQNYTGLCVETKNRLLNESFQSFEFVIEFARNVRKTNNIQE-VIKIKDIQTVKMFNESGCDMGQSSRCTVSSDYAEKWAYDVSVEIMKNVSSNSLSLQSDIYEKVLQYLCKDKVPIESVGVKRLKKIDKDELACQIPQNMTQTNRCENRYYYGSYRYECLNYGENVVTKLLLNDAYSEVSQFSIPITKL 1276
            MLRILAKIFTLGLILATCGAVSKLNRLNLVQVNISNIIYKQLMTTKDNVLAASPLAILDVNLLKKHKCYKNIRTNSWSFMMPIIFWDDSYMTNVANSIQKMSKLKNFVSEKPFILPPSGFRSYRLNWRRDLNDVFNN IRIDSSWYPANIDYVLPKWQNFLIE VSDQNYTGLCVETKNRLLNESFQSFEFVIEFARNVRKTNNIQE VIKIKDIQTVKMFNESGCDMGQSSRCTVSSDYAEKWAYDVSVEIMKN SSNSLSLQSDIYEKVLQYLCKDKVPIESVGVKRLKKIDKDELACQIPQNMTQTNRCENRYYYGSYRYECLNYGENVVTKLLLNDAYSEVSQFSIPITKL
Sbjct:    1 MLRILAKIFTLGLILATCGAVSKLNRLNLVQVNISNIIYKQLMTTKDNVLAASPLAILDVNLLKKHKCYKNIRTNSWSFMMPIIFWDDSYMTNVANSIQKMSKLKNFVSEKPFILPPSGFRSYRLNWRRDLNDVFNNPIRIDSSWYPANIDYVLPKWQNFLIELVSDQNYTGLCVETKNRLLNESFQSFEFVIEFARNVRKTNNIQEVVIKIKDIQTVKMFNESGCDMGQSSRCTVSSDYAEKWAYDVSVEIMKNFSSNSLSLQSDIYEKVLQYLCKDKVPIESVGVKRLKKIDKDELACQIPQNMTQTNRCENRYYYGSYRYECLNYGENVVTKLLLNDAYSEVSQFSIPITKL 355          
BLAST of Estrella vs. Planmine SMEST
Match: SMESG000041686.1 (SMESG000041686.1)

HSP 1 Score: 302.753 bits (774), Expect = 9.812e-96
Identity = 159/370 (42.97%), Postives = 242/370 (65.41%), Query Frame = 2
Query:  200 ILFEQMLRILAKIFTLGLILATCGAVSKLNRLNLVQVNISNIIYKQLMTTKDNVLAASPLAILDVNLLKKHKCYKNIRTNSWSFMMPIIFWDDSYMTNVANSIQKMSKLKNFVSEKPFILPPSGFRSYRLNWRRD-LNDVFNNLIRIDSSWYPANIDYVLPKWQNFLIEFVSDQNYTGLCVETKNRLLNESFQSFEFVIEFARNVRKTNNIQEV-IKIKDIQTVKMFNESGCDMGQSSRCTVSSDYAEKWAYDVSVEIMKNVSSNSLSLQSDIYEKVLQYLCKDKVPIESVGVKRLKKIDK---DELACQIPQNM--TQTNRCENRY-YYGSYR---YECLNYGENVVTKLLLNDAYSEVSQFSIPITKL 1276
            +L  +M+  +  +F + L      AV   N+LNLV+VNIS+ +YK+LM +KDN+L+ASPLA+LDV LLKK+ CYKNIR++ W+  +P+IFW D YM  +  S++K + L+NF  +K  ILPPSG  ++R+ WRR+ + +  N  I +D+SW     DYVLP   +FL+EF  + +   LCV+TKN+LLN+S Q  E  I+F +   +  NI ++ IKI +I++VKM+NES C      +C VS ++AEKW+YDVS  +M+NV    L+LQ DI++ V +YLCK+++ I  + +K ++++ K   +E+AC+IP  +   +   C  +Y  YG  R   +E L+YG  V++KL    +Y+E SQFSI + KL
Sbjct:  301 LLLSKMIPGIKCLFLIFLYFMNSEAVKDFNKLNLVRVNISDFVYKKLMISKDNILSASPLALLDVKLLKKYHCYKNIRSSLWALPIPVIFWTDLYMERIMASVKKGNLLRNFTGDKVSILPPSGVIAFRITWRRNYIENSENTNISLDTSWQDTQTDYVLPMRHSFLMEFSDNGDGKKLCVDTKNKLLNDSMQISEMTIDFQKTAGRKRNIPDIQIKINNIRSVKMYNESNCKTQSEDKCFVSKEFAEKWSYDVSTRMMENVEIIHLNLQKDIFDAVFEYLCKNRMSIFEIELKTVRRLSKGIDNEMACKIPNKLYVIKPKPCLPKYDRYGYLRVCPHELLDYGNEVISKLNPYQSYNENSQFSITVVKL 670          
BLAST of Estrella vs. Planmine SMEST
Match: SMESG000041686.1 (SMESG000041686.1)

HSP 1 Score: 302.753 bits (774), Expect = 1.237e-95
Identity = 159/370 (42.97%), Postives = 242/370 (65.41%), Query Frame = 2
Query:  200 ILFEQMLRILAKIFTLGLILATCGAVSKLNRLNLVQVNISNIIYKQLMTTKDNVLAASPLAILDVNLLKKHKCYKNIRTNSWSFMMPIIFWDDSYMTNVANSIQKMSKLKNFVSEKPFILPPSGFRSYRLNWRRD-LNDVFNNLIRIDSSWYPANIDYVLPKWQNFLIEFVSDQNYTGLCVETKNRLLNESFQSFEFVIEFARNVRKTNNIQEV-IKIKDIQTVKMFNESGCDMGQSSRCTVSSDYAEKWAYDVSVEIMKNVSSNSLSLQSDIYEKVLQYLCKDKVPIESVGVKRLKKIDK---DELACQIPQNM--TQTNRCENRY-YYGSYR---YECLNYGENVVTKLLLNDAYSEVSQFSIPITKL 1276
            +L  +M+  +  +F + L      AV   N+LNLV+VNIS+ +YK+LM +KDN+L+ASPLA+LDV LLKK+ CYKNIR++ W+  +P+IFW D YM  +  S++K + L+NF  +K  ILPPSG  ++R+ WRR+ + +  N  I +D+SW     DYVLP   +FL+EF  + +   LCV+TKN+LLN+S Q  E  I+F +   +  NI ++ IKI +I++VKM+NES C      +C VS ++AEKW+YDVS  +M+NV    L+LQ DI++ V +YLCK+++ I  + +K ++++ K   +E+AC+IP  +   +   C  +Y  YG  R   +E L+YG  V++KL    +Y+E SQFSI + KL
Sbjct:  309 LLLSKMIPGIKCLFLIFLYFMNSEAVKDFNKLNLVRVNISDFVYKKLMISKDNILSASPLALLDVKLLKKYHCYKNIRSSLWALPIPVIFWTDLYMERIMASVKKGNLLRNFTGDKVSILPPSGVIAFRITWRRNYIENSENTNISLDTSWQDTQTDYVLPMRHSFLMEFSDNGDGKKLCVDTKNKLLNDSMQISEMTIDFQKTAGRKRNIPDIQIKINNIRSVKMYNESNCKTQSEDKCFVSKEFAEKWSYDVSTRMMENVEIIHLNLQKDIFDAVFEYLCKNRMSIFEIELKTVRRLSKGIDNEMACKIPNKLYVIKPKPCLPKYDRYGYLRVCPHELLDYGNEVISKLNPYQSYNENSQFSITVVKL 678          
BLAST of Estrella vs. Planmine SMEST
Match: SMESG000013666.1 (SMESG000013666.1)

HSP 1 Score: 140.198 bits (352), Expect = 1.568e-37
Identity = 88/305 (28.85%), Postives = 154/305 (50.49%), Query Frame = 2
Query:  236 IFTLGLILATCGAVSKLNRLNLVQVNISNIIYKQLMTTKDNVLAASPLAILDVNLLKKHKCYKNIRTNSWSFMMPIIFWDDSYMTNVANSIQKMSKLKNFVSEKPFILPPSGFRSYRLNWRRDLNDVFNNLIRIDSSWYPANIDYVLPKWQNFLIEFVSDQNYTGLCVETKNRLLNESFQSFEFVIEFARNVRKTNNIQEV-IKIKDIQTVKMFNESGCDMGQSSRCTVSSDYAEKWAYDVSVEIMKNVSSNSLSLQSDIYEKVLQYLCKDKVPIESVGVKRL----KKIDKDELACQIPQNMTQ 1135
            +  L +I+ T    ++      +QVN+SN+ Y +L      + +A PL ILDV  L+   C++N  T  ++  +PIIFW+ SY+  + N    M+   N  ++   ILPP+G  S+++NWRR      +  + +D+S+  + ++Y LP    F++EF        LC E KN L+ E  Q  E V+ F         I  + IK+ D +   +     C  G  S C +  + A+ ++Y +++ ++K +S  +++LQ  IY + L  LC  KV   S+  +R+    + ++   L C IP++  Q
Sbjct:    5 LLVLVIIIYTLTGKTQSKFPPTIQVNLSNVAYVKLEQISSKIFSAPPLVILDVVKLRNFTCFRNFYTMKYTLGIPIIFWNYSYLQKINNLKYLMTTDTNITTK---ILPPTGVSSFQINWRRPGKS--SEHMELDTSFQRSYLNYFLPMSHTFIVEFNEGNTSKQLCNEIKNSLITEPIQRQELVVNFKGIKTIEEKIPSINIKLSDFEIEPIL---SCRNGYDSNCYIYLNSAKTFSYLLAINVLKRMSKYNINLQMQIYSRALDELCGIKVIYSSISNQRVVGTAEVVNSQILVCSIPKHFIQ 301          
The following BLAST results are available for this feature:
BLAST of Estrella vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Estrella vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Estrella vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Estrella vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Estrella vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Estrella vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Estrella vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Estrella vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 2
Match NameE-valueIdentityDescription
A0A1Z1R2Q30.000e+099.44Estrella OS=Schmidtea mediterranea OX=79327 PE=2 S... [more]
A0A1P8CUY34.945e-16399.14Estrella/neura-1 (Fragment) OS=Schmidtea mediterra... [more]
back to top
BLAST of Estrella vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Estrella vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Estrella vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Estrella vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Estrella vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Estrella vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000026791.10.000e+098.87SMESG000026791.1[more]
SMESG000041686.19.812e-9642.97SMESG000041686.1[more]
SMESG000041686.11.237e-9542.97SMESG000041686.1[more]
SMESG000013666.11.568e-3728.85SMESG000013666.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027919 ID=SMED30027919|Name=Estrella|organism=Schmidtea mediterranea sexual|type=transcript|length=1374bp
CCGATCTGAAAATTTGTTAAGTTAAATATTTGTTTATAAATTAAAATATT
ATGATTGATTTAGGAAAATTAACGTGAAAGGCACTGGAAAAGTCAATGGA
CAATTTGTTTATTCAGGAGGACTTTTTGAAGCTTAATACCCATCAGAAAA
GAGAAATAATTGAGAACTTATCCCTAATCTTTATCCGTGAGATGAAACCA
TTTTATTCGAACAAATGCTGAGAATACTGGCGAAGATATTTACCTTGGGT
CTAATACTGGCCACGTGCGGTGCGGTCTCCAAACTGAATAGACTGAACCT
CGTCCAAGTGAACATTTCAAACATCATTTACAAGCAACTGATGACAACAA
AGGACAACGTGTTAGCTGCGAGTCCTTTGGCGATTCTTGACGTCAATTTA
TTGAAGAAGCATAAATGCTACAAAAACATCAGAACCAATTCTTGGTCATT
TATGATGCCAATTATATTTTGGGACGATTCATACATGACCAATGTTGCAA
ATAGTATTCAAAAGATGAGTAAACTTAAGAATTTTGTCAGTGAAAAGCCA
TTCATACTGCCTCCGTCAGGATTCAGATCTTATCGGTTGAATTGGAGAAG
GGACCTAAATGATGTCTTTAACAATCTGATTAGAATCGACTCTTCATGGT
ACCCTGCCAACATAGATTACGTGTTACCAAAGTGGCAGAACTTTCTCATA
GAATTCGTCAGCGACCAGAATTATACAGGTTTATGTGTTGAAACGAAAAA
CCGTTTGCTGAATGAATCGTTTCAAAGCTTTGAATTCGTCATCGAATTTG
CGAGAAACGTCAGAAAAACGAATAACATTCAAGAGGTAATAAAAATTAAG
GATATTCAAACGGTAAAGATGTTTAATGAATCTGGTTGTGATATGGGCCA
AAGCAGCAGATGTACTGTGTCAAGTGATTATGCGGAAAAGTGGGCATATG
ACGTGAGCGTTGAAATAATGAAAAACGTTAGTTCGAATAGTTTGAGTCTA
CAATCTGACATCTACGAGAAAGTGTTACAATACTTGTGTAAGGATAAGGT
GCCTATCGAATCTGTAGGTGTAAAACGGCTTAAAAAGATTGATAAAGATG
AACTTGCTTGTCAAATACCTCAAAACATGACACAAACCAACCGCTGCGAA
AACCGATATTATTACGGTTCGTACCGATACGAATGTTTAAATTACGGTGA
AAATGTCGTTACAAAACTATTGCTAAACGATGCTTACTCCGAAGTTTCTC
AATTCTCTATTCCTATTACTAAATTGTAGAGAAAACATTCAGCTAGAATT
CTCGTCTGTTCCATTGACTTCAATCTTCTTTCATCCTCTTCATTCTAGTT
AAACATTTTATTAATGATTTTATG
back to top

protein sequence of SMED30027919-orf-1

>SMED30027919-orf-1 ID=SMED30027919-orf-1|Name=SMED30027919-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=355bp
MLRILAKIFTLGLILATCGAVSKLNRLNLVQVNISNIIYKQLMTTKDNVL
AASPLAILDVNLLKKHKCYKNIRTNSWSFMMPIIFWDDSYMTNVANSIQK
MSKLKNFVSEKPFILPPSGFRSYRLNWRRDLNDVFNNLIRIDSSWYPANI
DYVLPKWQNFLIEFVSDQNYTGLCVETKNRLLNESFQSFEFVIEFARNVR
KTNNIQEVIKIKDIQTVKMFNESGCDMGQSSRCTVSSDYAEKWAYDVSVE
IMKNVSSNSLSLQSDIYEKVLQYLCKDKVPIESVGVKRLKKIDKDELACQ
IPQNMTQTNRCENRYYYGSYRYECLNYGENVVTKLLLNDAYSEVSQFSIP
ITKL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
PLANA:0003116parenchymal cell
PLANA:0007528glial cell
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..20
score: 0.8