SMED30027918

Overview
NameSMED30027918
Smed IDSMED30027918
Length (bp)1784
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30027918 (SMED30027918) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30027918 (SMED30027918) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30027918 (SMED30027918) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30027918 (SMED30027918) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027918

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X2 cellSMED30027918SMESG000017254.1 SmedASXL_008315SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
posterior sideSMED30027918SMESG000017254.1 dd_Smed_v4_6909_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30027918SMESG000017254.1 dd_Smed_v4_6909_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30027918SMESG000017254.1 SMESG000017252.1 SMESG000017256.1 Contig30222newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30027918SMESG000017254.1 SMESG000017252.1 SMESG000017256.1 Contig30222uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
reproductive organSMED30027918SMESG000022262.1 SMESG000048632.1 Contig2760newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30027918 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.002144:24053..28064 -8709
Homology
BLAST of SMED30027918 vs. Ensembl Human
Match: ZFAND6 (zinc finger AN1-type containing 6 [Source:HGNC Symbol;Acc:HGNC:30164])

HSP 1 Score: 117.857 bits (294), Expect = 9.605e-30
Identity = 77/229 (33.62%), Postives = 117/229 (51.09%), Query Frame = -3
Query: 1024 LCKQGCGFYGNAQNMDMCSKCYQNFLKSSNQEEAPRSQSSNQSPYASQISINELYQSRAKLVESTVNQCKEKNRKRLAQSDIESLHKVPKTCKNKDSEQYGVEADSIADM-FTSQDAALHQPTAVADIINKLGPDDPDASPENSMRDNG---SGGTTQIMKKPR----RCEFCRRKVGLTGFDCRCGGHYCAVHRYSDKHSCTFDYQAHGQEQIKHQNPMICGSKIKKI 1686
            LC  GCGFYGN +   MCS CY+  L+  N      S +   SP A+ +S          L ES   QC + +              VP+     DS    ++   +++    S+  A  Q  + +  ++K  P+  D   + S+ D     S   ++ ++KP+    RC  CR+KVGLTGF+CRCG  YC VHRYSD H+C+++Y+A   E+I+ +NP++ G KI+KI
Sbjct:   13 LCSTGCGFYGNPRTNGMCSVCYKEHLQRQN------SSNGRISPPATSVS---------SLSESLPVQCTDGS--------------VPEAQSALDSTSSSMQPSPVSNQSLLSESVASSQLDSTS--VDKAVPETEDV--QASVSDTAQQPSEEQSKSLEKPKQKKNRCFMCRKKVGLTGFECRCGNVYCGVHRYSDVHNCSYNYKADAAEKIRKENPVVVGEKIQKI 208          
BLAST of SMED30027918 vs. Ensembl Human
Match: ZFAND6 (zinc finger AN1-type containing 6 [Source:HGNC Symbol;Acc:HGNC:30164])

HSP 1 Score: 117.857 bits (294), Expect = 9.605e-30
Identity = 77/229 (33.62%), Postives = 117/229 (51.09%), Query Frame = -3
Query: 1024 LCKQGCGFYGNAQNMDMCSKCYQNFLKSSNQEEAPRSQSSNQSPYASQISINELYQSRAKLVESTVNQCKEKNRKRLAQSDIESLHKVPKTCKNKDSEQYGVEADSIADM-FTSQDAALHQPTAVADIINKLGPDDPDASPENSMRDNG---SGGTTQIMKKPR----RCEFCRRKVGLTGFDCRCGGHYCAVHRYSDKHSCTFDYQAHGQEQIKHQNPMICGSKIKKI 1686
            LC  GCGFYGN +   MCS CY+  L+  N      S +   SP A+ +S          L ES   QC + +              VP+     DS    ++   +++    S+  A  Q  + +  ++K  P+  D   + S+ D     S   ++ ++KP+    RC  CR+KVGLTGF+CRCG  YC VHRYSD H+C+++Y+A   E+I+ +NP++ G KI+KI
Sbjct:   13 LCSTGCGFYGNPRTNGMCSVCYKEHLQRQN------SSNGRISPPATSVS---------SLSESLPVQCTDGS--------------VPEAQSALDSTSSSMQPSPVSNQSLLSESVASSQLDSTS--VDKAVPETEDV--QASVSDTAQQPSEEQSKSLEKPKQKKNRCFMCRKKVGLTGFECRCGNVYCGVHRYSDVHNCSYNYKADAAEKIRKENPVVVGEKIQKI 208          
BLAST of SMED30027918 vs. Ensembl Human
Match: ZFAND6 (zinc finger AN1-type containing 6 [Source:HGNC Symbol;Acc:HGNC:30164])

HSP 1 Score: 117.857 bits (294), Expect = 9.605e-30
Identity = 77/229 (33.62%), Postives = 117/229 (51.09%), Query Frame = -3
Query: 1024 LCKQGCGFYGNAQNMDMCSKCYQNFLKSSNQEEAPRSQSSNQSPYASQISINELYQSRAKLVESTVNQCKEKNRKRLAQSDIESLHKVPKTCKNKDSEQYGVEADSIADM-FTSQDAALHQPTAVADIINKLGPDDPDASPENSMRDNG---SGGTTQIMKKPR----RCEFCRRKVGLTGFDCRCGGHYCAVHRYSDKHSCTFDYQAHGQEQIKHQNPMICGSKIKKI 1686
            LC  GCGFYGN +   MCS CY+  L+  N      S +   SP A+ +S          L ES   QC + +              VP+     DS    ++   +++    S+  A  Q  + +  ++K  P+  D   + S+ D     S   ++ ++KP+    RC  CR+KVGLTGF+CRCG  YC VHRYSD H+C+++Y+A   E+I+ +NP++ G KI+KI
Sbjct:   13 LCSTGCGFYGNPRTNGMCSVCYKEHLQRQN------SSNGRISPPATSVS---------SLSESLPVQCTDGS--------------VPEAQSALDSTSSSMQPSPVSNQSLLSESVASSQLDSTS--VDKAVPETEDV--QASVSDTAQQPSEEQSKSLEKPKQKKNRCFMCRKKVGLTGFECRCGNVYCGVHRYSDVHNCSYNYKADAAEKIRKENPVVVGEKIQKI 208          
BLAST of SMED30027918 vs. Ensembl Human
Match: ZFAND6 (zinc finger AN1-type containing 6 [Source:HGNC Symbol;Acc:HGNC:30164])

HSP 1 Score: 117.857 bits (294), Expect = 9.605e-30
Identity = 77/229 (33.62%), Postives = 117/229 (51.09%), Query Frame = -3
Query: 1024 LCKQGCGFYGNAQNMDMCSKCYQNFLKSSNQEEAPRSQSSNQSPYASQISINELYQSRAKLVESTVNQCKEKNRKRLAQSDIESLHKVPKTCKNKDSEQYGVEADSIADM-FTSQDAALHQPTAVADIINKLGPDDPDASPENSMRDNG---SGGTTQIMKKPR----RCEFCRRKVGLTGFDCRCGGHYCAVHRYSDKHSCTFDYQAHGQEQIKHQNPMICGSKIKKI 1686
            LC  GCGFYGN +   MCS CY+  L+  N      S +   SP A+ +S          L ES   QC + +              VP+     DS    ++   +++    S+  A  Q  + +  ++K  P+  D   + S+ D     S   ++ ++KP+    RC  CR+KVGLTGF+CRCG  YC VHRYSD H+C+++Y+A   E+I+ +NP++ G KI+KI
Sbjct:   13 LCSTGCGFYGNPRTNGMCSVCYKEHLQRQN------SSNGRISPPATSVS---------SLSESLPVQCTDGS--------------VPEAQSALDSTSSSMQPSPVSNQSLLSESVASSQLDSTS--VDKAVPETEDV--QASVSDTAQQPSEEQSKSLEKPKQKKNRCFMCRKKVGLTGFECRCGNVYCGVHRYSDVHNCSYNYKADAAEKIRKENPVVVGEKIQKI 208          
BLAST of SMED30027918 vs. Ensembl Human
Match: ZFAND6 (zinc finger AN1-type containing 6 [Source:HGNC Symbol;Acc:HGNC:30164])

HSP 1 Score: 117.857 bits (294), Expect = 9.605e-30
Identity = 77/229 (33.62%), Postives = 117/229 (51.09%), Query Frame = -3
Query: 1024 LCKQGCGFYGNAQNMDMCSKCYQNFLKSSNQEEAPRSQSSNQSPYASQISINELYQSRAKLVESTVNQCKEKNRKRLAQSDIESLHKVPKTCKNKDSEQYGVEADSIADM-FTSQDAALHQPTAVADIINKLGPDDPDASPENSMRDNG---SGGTTQIMKKPR----RCEFCRRKVGLTGFDCRCGGHYCAVHRYSDKHSCTFDYQAHGQEQIKHQNPMICGSKIKKI 1686
            LC  GCGFYGN +   MCS CY+  L+  N      S +   SP A+ +S          L ES   QC + +              VP+     DS    ++   +++    S+  A  Q  + +  ++K  P+  D   + S+ D     S   ++ ++KP+    RC  CR+KVGLTGF+CRCG  YC VHRYSD H+C+++Y+A   E+I+ +NP++ G KI+KI
Sbjct:   13 LCSTGCGFYGNPRTNGMCSVCYKEHLQRQN------SSNGRISPPATSVS---------SLSESLPVQCTDGS--------------VPEAQSALDSTSSSMQPSPVSNQSLLSESVASSQLDSTS--VDKAVPETEDV--QASVSDTAQQPSEEQSKSLEKPKQKKNRCFMCRKKVGLTGFECRCGNVYCGVHRYSDVHNCSYNYKADAAEKIRKENPVVVGEKIQKI 208          
BLAST of SMED30027918 vs. Ensembl Celegans
Match: F22D6.2 (pep chromosome:WBcel235:I:7079868:7081520:-1 gene:WBGene00009050.1 transcript:F22D6.2.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F22D6.2)

HSP 1 Score: 95.1301 bits (235), Expect = 2.414e-22
Identity = 65/220 (29.55%), Postives = 97/220 (44.09%), Query Frame = -3
Query: 1024 CKQGCGFYGNAQNMDMCSKCYQNFLKSSNQEEAPRSQSSNQSPYASQISINELYQSRAKLVESTVNQCKEKNRKRLAQSDIESLHKVPKTCKNKDSEQYGVEADSIADMFTSQDAALHQPTAVADIINKLGPDDPDASPENSMRDNGSGGTTQIMKKPRRCEFCRRKVGLTGFDCRCGGHYCAVHRYSDKHSCTFDYQAHGQEQIKHQNPMICGSKIKKI 1683
            C+ GCGF+G +     CS+C++N LK   Q++  R  S   SP +   + + L     K   S+V+ C +                                A S++D     D        V D IN    DD     E++     +      +KK  RC  C+++VGLTGF CRCGG YC  HRY   H+C FDY+   +E I+  NP++   K+++I
Sbjct:   14 CRAGCGFFGASATEGYCSQCFKNTLK--RQQDTVRLTSPVVSPSSMAATSSAL-----KSEPSSVDMCMKA-------------------------------AVSVSDETAKMDC--EDIINVCDQIN----DDSVTVAESTAPTTITVDVPVPVKKANRCHMCKKRVGLTGFSCRCGGLYCGDHRYDQAHNCQFDYKTMERETIRKNNPVVVSDKVQRI 189          
BLAST of SMED30027918 vs. Ensembl Fly
Match: CG45050 (gene:FBgn0266410 transcript:FBtr0344364)

HSP 1 Score: 123.635 bits (309), Expect = 3.527e-32
Identity = 80/223 (35.87%), Postives = 106/223 (47.53%), Query Frame = -3
Query: 1024 LCKQGCGFYGNAQNMDMCSKCYQNFLKSSNQEEAPRSQSSNQSPYASQISINELYQSRAKLVESTVNQCKEKNRKRLAQSDIESLHKVPKTCKNKDSEQYGVEADSIADMFTSQDAALHQPTAVADIINKLGPDDPD--ASPENSMRDNGSGGTTQIMKKPRRCEFCRRKVGLTGFDCRCGGHYCAVHRYSDKHSCTFDYQAHGQEQIKHQNPMICGSKIKKI 1686
            +C+ GCGFYGN     +CS CY++ L+   Q     +  S  SP  S         S A  + +T            AQ  + SL +     K K +E+    A   ++  TS                  GP+     A+  N   D          KK  RC  CR+KVGLTGF CRCGG YCAVHRYSDKH+CTFDY+ HG ++I+  NP++ G KI+KI
Sbjct:   11 MCRSGCGFYGNPATDGLCSVCYKDSLRKKQQPPVSSTPVSVPSPQPSPTF------SPAIAITNT------------AQPTVTSLQQPHNDVKEKITEEAAAAAKVNSEAITS----------------ATGPNTSTQAAASANEEDDKDKEDDKDAKKKKNRCGECRKKVGLTGFQCRCGGLYCAVHRYSDKHNCTFDYREHGAQEIRRNNPVVVGEKIQKI 199          
BLAST of SMED30027918 vs. Ensembl Fly
Match: CG45050 (gene:FBgn0266410 transcript:FBtr0344368)

HSP 1 Score: 123.635 bits (309), Expect = 3.527e-32
Identity = 80/223 (35.87%), Postives = 106/223 (47.53%), Query Frame = -3
Query: 1024 LCKQGCGFYGNAQNMDMCSKCYQNFLKSSNQEEAPRSQSSNQSPYASQISINELYQSRAKLVESTVNQCKEKNRKRLAQSDIESLHKVPKTCKNKDSEQYGVEADSIADMFTSQDAALHQPTAVADIINKLGPDDPD--ASPENSMRDNGSGGTTQIMKKPRRCEFCRRKVGLTGFDCRCGGHYCAVHRYSDKHSCTFDYQAHGQEQIKHQNPMICGSKIKKI 1686
            +C+ GCGFYGN     +CS CY++ L+   Q     +  S  SP  S         S A  + +T            AQ  + SL +     K K +E+    A   ++  TS                  GP+     A+  N   D          KK  RC  CR+KVGLTGF CRCGG YCAVHRYSDKH+CTFDY+ HG ++I+  NP++ G KI+KI
Sbjct:   11 MCRSGCGFYGNPATDGLCSVCYKDSLRKKQQPPVSSTPVSVPSPQPSPTF------SPAIAITNT------------AQPTVTSLQQPHNDVKEKITEEAAAAAKVNSEAITS----------------ATGPNTSTQAAASANEEDDKDKEDDKDAKKKKNRCGECRKKVGLTGFQCRCGGLYCAVHRYSDKHNCTFDYREHGAQEIRRNNPVVVGEKIQKI 199          
BLAST of SMED30027918 vs. Ensembl Fly
Match: CG45050 (gene:FBgn0266410 transcript:FBtr0344366)

HSP 1 Score: 123.635 bits (309), Expect = 3.527e-32
Identity = 80/223 (35.87%), Postives = 106/223 (47.53%), Query Frame = -3
Query: 1024 LCKQGCGFYGNAQNMDMCSKCYQNFLKSSNQEEAPRSQSSNQSPYASQISINELYQSRAKLVESTVNQCKEKNRKRLAQSDIESLHKVPKTCKNKDSEQYGVEADSIADMFTSQDAALHQPTAVADIINKLGPDDPD--ASPENSMRDNGSGGTTQIMKKPRRCEFCRRKVGLTGFDCRCGGHYCAVHRYSDKHSCTFDYQAHGQEQIKHQNPMICGSKIKKI 1686
            +C+ GCGFYGN     +CS CY++ L+   Q     +  S  SP  S         S A  + +T            AQ  + SL +     K K +E+    A   ++  TS                  GP+     A+  N   D          KK  RC  CR+KVGLTGF CRCGG YCAVHRYSDKH+CTFDY+ HG ++I+  NP++ G KI+KI
Sbjct:   11 MCRSGCGFYGNPATDGLCSVCYKDSLRKKQQPPVSSTPVSVPSPQPSPTF------SPAIAITNT------------AQPTVTSLQQPHNDVKEKITEEAAAAAKVNSEAITS----------------ATGPNTSTQAAASANEEDDKDKEDDKDAKKKKNRCGECRKKVGLTGFQCRCGGLYCAVHRYSDKHNCTFDYREHGAQEIRRNNPVVVGEKIQKI 199          
BLAST of SMED30027918 vs. Ensembl Fly
Match: CG45050 (gene:FBgn0266410 transcript:FBtr0344363)

HSP 1 Score: 123.635 bits (309), Expect = 3.527e-32
Identity = 80/223 (35.87%), Postives = 106/223 (47.53%), Query Frame = -3
Query: 1024 LCKQGCGFYGNAQNMDMCSKCYQNFLKSSNQEEAPRSQSSNQSPYASQISINELYQSRAKLVESTVNQCKEKNRKRLAQSDIESLHKVPKTCKNKDSEQYGVEADSIADMFTSQDAALHQPTAVADIINKLGPDDPD--ASPENSMRDNGSGGTTQIMKKPRRCEFCRRKVGLTGFDCRCGGHYCAVHRYSDKHSCTFDYQAHGQEQIKHQNPMICGSKIKKI 1686
            +C+ GCGFYGN     +CS CY++ L+   Q     +  S  SP  S         S A  + +T            AQ  + SL +     K K +E+    A   ++  TS                  GP+     A+  N   D          KK  RC  CR+KVGLTGF CRCGG YCAVHRYSDKH+CTFDY+ HG ++I+  NP++ G KI+KI
Sbjct:   11 MCRSGCGFYGNPATDGLCSVCYKDSLRKKQQPPVSSTPVSVPSPQPSPTF------SPAIAITNT------------AQPTVTSLQQPHNDVKEKITEEAAAAAKVNSEAITS----------------ATGPNTSTQAAASANEEDDKDKEDDKDAKKKKNRCGECRKKVGLTGFQCRCGGLYCAVHRYSDKHNCTFDYREHGAQEIRRNNPVVVGEKIQKI 199          
BLAST of SMED30027918 vs. Ensembl Fly
Match: CG45050 (gene:FBgn0266410 transcript:FBtr0344367)

HSP 1 Score: 123.635 bits (309), Expect = 3.527e-32
Identity = 80/223 (35.87%), Postives = 106/223 (47.53%), Query Frame = -3
Query: 1024 LCKQGCGFYGNAQNMDMCSKCYQNFLKSSNQEEAPRSQSSNQSPYASQISINELYQSRAKLVESTVNQCKEKNRKRLAQSDIESLHKVPKTCKNKDSEQYGVEADSIADMFTSQDAALHQPTAVADIINKLGPDDPD--ASPENSMRDNGSGGTTQIMKKPRRCEFCRRKVGLTGFDCRCGGHYCAVHRYSDKHSCTFDYQAHGQEQIKHQNPMICGSKIKKI 1686
            +C+ GCGFYGN     +CS CY++ L+   Q     +  S  SP  S         S A  + +T            AQ  + SL +     K K +E+    A   ++  TS                  GP+     A+  N   D          KK  RC  CR+KVGLTGF CRCGG YCAVHRYSDKH+CTFDY+ HG ++I+  NP++ G KI+KI
Sbjct:   11 MCRSGCGFYGNPATDGLCSVCYKDSLRKKQQPPVSSTPVSVPSPQPSPTF------SPAIAITNT------------AQPTVTSLQQPHNDVKEKITEEAAAAAKVNSEAITS----------------ATGPNTSTQAAASANEEDDKDKEDDKDAKKKKNRCGECRKKVGLTGFQCRCGGLYCAVHRYSDKHNCTFDYREHGAQEIRRNNPVVVGEKIQKI 199          
BLAST of SMED30027918 vs. Ensembl Zebrafish
Match: zfand5a (zinc finger, AN1-type domain 5a [Source:ZFIN;Acc:ZDB-GENE-040426-1979])

HSP 1 Score: 129.028 bits (323), Expect = 8.145e-34
Identity = 75/224 (33.48%), Postives = 117/224 (52.23%), Query Frame = -3
Query: 1024 LCKQGCGFYGNAQNMDMCSKCYQNFL-KSSNQEEAPRSQSSNQSPYASQISINELYQSRAKLVESTVNQCKEKNRKRLAQSDIESLHKVPKTCKNKDSEQYGVEADSIADMFTSQDAALHQPTAVADIINKLGPDDPDASPENSMRDNGSGGTTQIMKKPR--RCEFCRRKVGLTGFDCRCGGHYCAVHRYSDKHSCTFDYQAHGQEQIKHQNPMICGSKIKKI 1686
            LC  GCGFYGN +   MCS CY+  L +  + + +P S  +  SP A   +I  L  S  K  E+      E  R+ +  S +    K+ +   +++ +    +A+++  + T       QPT+    I     +D   SP++S              KP+  RC  CR++VGLTGFDCRCG  +C +HRYSDKH+CT+DY+A    +I+ +NP++   KI++I
Sbjct:   13 LCTTGCGFYGNPRTNGMCSVCYKEHLNRQQSSDRSPMSPLAAGSPSAEASAIQRLEASINK-AETLPAPSTETMRESIPSSSLPVTQKMTEMSISREEKALSPKAETVEPVIT-------QPTSSYSPIPVAQANDDAKSPDSS--------------KPKKNRCFTCRKRVGLTGFDCRCGNLFCGIHRYSDKHNCTYDYKAEAAAKIRKENPVVVADKIQRI 214          
BLAST of SMED30027918 vs. Ensembl Zebrafish
Match: zfand5a (zinc finger, AN1-type domain 5a [Source:ZFIN;Acc:ZDB-GENE-040426-1979])

HSP 1 Score: 128.642 bits (322), Expect = 1.112e-33
Identity = 74/230 (32.17%), Postives = 119/230 (51.74%), Query Frame = -3
Query: 1024 LCKQGCGFYGNAQNMDMCSKCYQNFLKSSNQEEAPRSQSSNQSPYASQISINELYQSRAKLVESTVNQCK-------EKNRKRLAQSDIESLHKVPKTCKNKDSEQYGVEADSIADMFTSQDAALHQPTAVADIINKLGPDDPDASPENSMRDNGSGGTTQIMKKPR--RCEFCRRKVGLTGFDCRCGGHYCAVHRYSDKHSCTFDYQAHGQEQIKHQNPMICGSKIKKI 1686
            LC  GCGFYGN +   MCS CY+  L         R QSS++SP +          S  + +E+++N+ +       E  R+ +  S +    K+ +   +++ +    +A+++  + T       QPT+    I     +D   SP++S              KP+  RC  CR++VGLTGFDCRCG  +C +HRYSDKH+CT+DY+A    +I+ +NP++   KI++I
Sbjct:   13 LCTTGCGFYGNPRTNGMCSVCYKEHLN--------RQQSSDRSPMSPLAGSPSAEASAIQRLEASINKAETLPAPSTETMRESIPSSSLPVTQKMTEMSISREEKALSPKAETVEPVIT-------QPTSSYSPIPVAQANDDAKSPDSS--------------KPKKNRCFTCRKRVGLTGFDCRCGNLFCGIHRYSDKHNCTYDYKAEAAAKIRKENPVVVADKIQRI 213          
BLAST of SMED30027918 vs. Ensembl Zebrafish
Match: zfand5a (zinc finger, AN1-type domain 5a [Source:ZFIN;Acc:ZDB-GENE-040426-1979])

HSP 1 Score: 128.642 bits (322), Expect = 1.112e-33
Identity = 74/230 (32.17%), Postives = 119/230 (51.74%), Query Frame = -3
Query: 1024 LCKQGCGFYGNAQNMDMCSKCYQNFLKSSNQEEAPRSQSSNQSPYASQISINELYQSRAKLVESTVNQCK-------EKNRKRLAQSDIESLHKVPKTCKNKDSEQYGVEADSIADMFTSQDAALHQPTAVADIINKLGPDDPDASPENSMRDNGSGGTTQIMKKPR--RCEFCRRKVGLTGFDCRCGGHYCAVHRYSDKHSCTFDYQAHGQEQIKHQNPMICGSKIKKI 1686
            LC  GCGFYGN +   MCS CY+  L         R QSS++SP +          S  + +E+++N+ +       E  R+ +  S +    K+ +   +++ +    +A+++  + T       QPT+    I     +D   SP++S              KP+  RC  CR++VGLTGFDCRCG  +C +HRYSDKH+CT+DY+A    +I+ +NP++   KI++I
Sbjct:   13 LCTTGCGFYGNPRTNGMCSVCYKEHLN--------RQQSSDRSPMSPLAGSPSAEASAIQRLEASINKAETLPAPSTETMRESIPSSSLPVTQKMTEMSISREEKALSPKAETVEPVIT-------QPTSSYSPIPVAQANDDAKSPDSS--------------KPKKNRCFTCRKRVGLTGFDCRCGNLFCGIHRYSDKHNCTYDYKAEAAAKIRKENPVVVADKIQRI 213          
BLAST of SMED30027918 vs. Ensembl Zebrafish
Match: zfand6 (zinc finger, AN1-type domain 6 [Source:ZFIN;Acc:ZDB-GENE-030131-8405])

HSP 1 Score: 117.472 bits (293), Expect = 1.850e-29
Identity = 79/227 (34.80%), Postives = 119/227 (52.42%), Query Frame = -3
Query: 1024 LCKQGCGFYGNAQNMDMCSKCYQNFLKSSNQE----EAPRSQSSNQSPYASQISINELYQSRAKLVESTVNQCKEKNRKRLAQSDIESLHKVPKTCKNKDSEQYGVEADSIADMFTSQDAALHQPTAVAD--IINKLGPDDPDASPENSMRDNGSGGTTQIMKKPRRCEFCRRKVGLTGFDCRCGGHYCAVHRYSDKHSCTFDYQAHGQEQIKHQNPMICGSKIKKI 1686
            LC  GCGFYGN +N  MCS CY++ L+  N      +   S  S++    +  S ++  Q+  + + ST      K+   +A     S  K P  C     ++  +E+ S     T++  +L + T+     +     P +  ++  +S+ +  S    Q   K  RC  CR+KVGLTGFDCRCG  +C +HRYSD HSC+FDY+A   E+I+ +NP+I G KIKKI
Sbjct:   11 LCSNGCGFYGNPRNNGMCSVCYKDSLQRQNNSGRSSDPVSSSLSSKGESLTVQSTSQHEQNSQRFLTSTPAAVTHKDGASVA---APSGQKTPVQCSKL--KRSSLES-STEKQLTARSPSLEESTSRGKRKLDETCQPVETVSASASSVSEQTSDEPEQSKPKKNRCFTCRKKVGLTGFDCRCGQLFCGIHRYSDVHSCSFDYKADAAEKIRKENPLIVGEKIKKI 231          
BLAST of SMED30027918 vs. Ensembl Zebrafish
Match: zfand6 (zinc finger, AN1-type domain 6 [Source:ZFIN;Acc:ZDB-GENE-030131-8405])

HSP 1 Score: 115.546 bits (288), Expect = 9.716e-29
Identity = 79/227 (34.80%), Postives = 121/227 (53.30%), Query Frame = -3
Query: 1024 LCKQGCGFYGNAQNMDMCSKCYQNFLKSSNQE----EAPRSQSSNQSPYASQISINELYQSRAKLVESTVNQCKEKNRKRLAQSDIESLHKVPKTCKNKDSEQYGVEADSIADMFTSQDAALHQPTAVAD--IINKLGPDDPDASPENSMRDNGSGGTTQIMKKPRRCEFCRRKVGLTGFDCRCGGHYCAVHRYSDKHSCTFDYQAHGQEQIKHQNPMICGSKIKKI 1686
            LC  GCGFYGN +N  MCS CY++ L+  N      +   S  S++    +  S ++  Q+  + + ST      K+   +A     S  K P+   +K  ++  +E+ S     T++  +L + T+     +     P +  ++  +S+ +  S    Q   K  RC  CR+KVGLTGFDCRCG  +C +HRYSD HSC+FDY+A   E+I+ +NP+I G KIKKI
Sbjct:   11 LCSNGCGFYGNPRNNGMCSVCYKDSLQRQNNSGRSSDPVSSSLSSKGESLTVQSTSQHEQNSQRFLTSTPAAVTHKDGASVA---APSGQKTPEVQCSK-LKRSSLES-STEKQLTARSPSLEESTSRGKRKLDETCQPVETVSASASSVSEQTSDEPEQSKPKKNRCFTCRKKVGLTGFDCRCGQLFCGIHRYSDVHSCSFDYKADAAEKIRKENPLIVGEKIKKI 232          
BLAST of SMED30027918 vs. Ensembl Xenopus
Match: hmg20a (high mobility group 20A [Source:Xenbase;Acc:XB-GENE-955353])

HSP 1 Score: 110.538 bits (275), Expect = 4.321e-27
Identity = 72/225 (32.00%), Postives = 106/225 (47.11%), Query Frame = -3
Query: 1024 LCKQGCGFYGNAQNMDMCSKCYQNFLKSSNQEEAPRSQSSNQSPYASQISINELYQSRAKL--VESTVNQCKEKNRKRLAQSDIESLHKVPKTCKNKDSEQYGVEADSIADMFTSQDAALHQPTAVADIINKLGPDDPDASPENSMRDNGSGGTTQIMKKPR--RCEFCRRKVGLTGFDCRCGGHYCAVHRYSDKHSCTFDYQAHGQEQIKHQNPMICGSKIKKI 1686
            LC  GCGFYGN +   MCS CY+  L+        R  S   SP  +    N      A +  VE+++N C+        +S    L  +P T      +Q    + S  D   S      +P           P    + P  S+ +  +      + KP+  RC  CR+K+GLTGFDCRCG  +C +HRYSDKH+C +DY+A    +I+ +NP++   KI++I
Sbjct:   13 LCNTGCGFYGNPRTNGMCSVCYKEHLQ--------RQNSGRISPMGAASGSNSPSAESATVQRVETSLN-CEGAAGGLSDKSRNTPLAALPVT------QQMTEMSISREDHVASPKTETSEPVVTQ-------PSPSLSQPSTSLNEEKA----PELPKPKKNRCFMCRKKIGLTGFDCRCGNLFCGLHRYSDKHNCPYDYKAEAAAKIRKENPVVVAEKIQRI 211          
BLAST of SMED30027918 vs. Ensembl Xenopus
Match: zfand6 (zinc finger AN1-type containing 6 [Source:NCBI gene;Acc:394631])

HSP 1 Score: 103.219 bits (256), Expect = 1.423e-24
Identity = 67/221 (30.32%), Postives = 97/221 (43.89%), Query Frame = -3
Query: 1024 LCKQGCGFYGNAQNMDMCSKCYQNFLKSSNQEEAPRSQSSNQSPYASQISINELYQSRAKLVESTVNQCKEKNRKRLAQSDIESLHKVPKTCKNKDSEQYGVEADSIADMFTSQDAALHQPTAVADIINKLGPDDPDASPENSMRDNGSGGTTQIMKKPRRCEFCRRKVGLTGFDCRCGGHYCAVHRYSDKHSCTFDYQAHGQEQIKHQNPMICGSKIKKI 1686
            LC  GCGFYGN +   +CS CY+  L+  N          +        +      S+A  V   V                     VP+T           +A S+  + T   ++  +         K  P     S +NS  +         +KK  RC  CR+K+GLTGF+CRCG  +C  HRYSD HSC++DY+A   E+I+ +NP++ G KI+KI
Sbjct:   15 LCSTGCGFYGNPRTNGLCSVCYKEHLQRQNSGGRNSPPVVSVGSGVEVSTPQNAESSQAGGVADPV---------------------VPQT----------TQASSLPLLETGSSSSQAENAESRTTDTKEIPAATSDSAQNSSEEQERSPEKAKLKK-NRCFMCRKKIGLTGFECRCGNVFCGTHRYSDVHSCSYDYKADAAEKIRKENPVVVGEKIQKI 203          
BLAST of SMED30027918 vs. Ensembl Xenopus
Match: ZFAND4 (zinc finger, AN1-type domain 4 [Source:NCBI gene;Acc:100144290])

HSP 1 Score: 72.0182 bits (175), Expect = 1.461e-12
Identity = 28/66 (42.42%), Postives = 43/66 (65.15%), Query Frame = -3
Query: 1024 KKPRRCEFCRRKVGL-TGFDCRCGGHYCAVHRYSDKHSCTFDYQAHGQEQIKHQNPMICGSKIKKI 1218
            K  + C  C +K GL T F+CRCG ++CA HRY++ H CT+DY+  G+  ++  NP+I   ++ KI
Sbjct:  636 KTTKNCFVCGKKTGLATSFECRCGNNFCAAHRYAETHDCTYDYKTVGRRLLQEANPVISAPRLPKI 701          
BLAST of SMED30027918 vs. Ensembl Mouse
Match: Zfand6 (zinc finger, AN1-type domain 6 [Source:MGI Symbol;Acc:MGI:1929510])

HSP 1 Score: 118.242 bits (295), Expect = 7.024e-30
Identity = 79/228 (34.65%), Postives = 116/228 (50.88%), Query Frame = -3
Query: 1024 LCKQGCGFYGNAQNMDMCSKCYQNFLKSSNQEEAPRSQSSNQSPYASQISINELYQSRAKLVESTVNQCKEKNRKRLAQSDIES----LHKVPKTCKNKDSEQYG---VEADSIADMFTSQDAALHQPTAVADIINKLGPDDPDASPENSMRDNGSGGTTQIMKKPRRCEFCRRKVGLTGFDCRCGGHYCAVHRYSDKHSCTFDYQAHGQEQIKHQNPMICGSKIKKI 1686
            LC  GCGFYGN +   MCS CY+  L+  N      S +   SP A+ +S          L ES   QC + +    AQS ++S    +   P + ++  SE      V++ S+ D   S+   L  P A   +  +  P    +       +  S    +  +K  RC  CR+KVGLTGF+CRCG  YC VHRYSD H+C+++Y+A   E+I+ +NP++ G KI+KI
Sbjct:   13 LCSTGCGFYGNPRTNGMCSVCYKEHLQRQN------SSNGRISPPAASVS---------SLSESLPVQCADGSVPD-AQSALDSTSSSMQPGPVSNQSLLSESVAPSQVDSTSV-DKAVSETEDLQGPRAEGLVPLECDPPSSVSDTTQQPSEEQSKSLEKPKQKKNRCFMCRKKVGLTGFECRCGNVYCGVHRYSDVHNCSYNYKADAAEKIRKENPVVVGEKIQKI 223          
BLAST of SMED30027918 vs. Ensembl Mouse
Match: Zfand6 (zinc finger, AN1-type domain 6 [Source:MGI Symbol;Acc:MGI:1929510])

HSP 1 Score: 118.242 bits (295), Expect = 7.024e-30
Identity = 79/228 (34.65%), Postives = 116/228 (50.88%), Query Frame = -3
Query: 1024 LCKQGCGFYGNAQNMDMCSKCYQNFLKSSNQEEAPRSQSSNQSPYASQISINELYQSRAKLVESTVNQCKEKNRKRLAQSDIES----LHKVPKTCKNKDSEQYG---VEADSIADMFTSQDAALHQPTAVADIINKLGPDDPDASPENSMRDNGSGGTTQIMKKPRRCEFCRRKVGLTGFDCRCGGHYCAVHRYSDKHSCTFDYQAHGQEQIKHQNPMICGSKIKKI 1686
            LC  GCGFYGN +   MCS CY+  L+  N      S +   SP A+ +S          L ES   QC + +    AQS ++S    +   P + ++  SE      V++ S+ D   S+   L  P A   +  +  P    +       +  S    +  +K  RC  CR+KVGLTGF+CRCG  YC VHRYSD H+C+++Y+A   E+I+ +NP++ G KI+KI
Sbjct:   13 LCSTGCGFYGNPRTNGMCSVCYKEHLQRQN------SSNGRISPPAASVS---------SLSESLPVQCADGSVPD-AQSALDSTSSSMQPGPVSNQSLLSESVAPSQVDSTSV-DKAVSETEDLQGPRAEGLVPLECDPPSSVSDTTQQPSEEQSKSLEKPKQKKNRCFMCRKKVGLTGFECRCGNVYCGVHRYSDVHNCSYNYKADAAEKIRKENPVVVGEKIQKI 223          
BLAST of SMED30027918 vs. Ensembl Mouse
Match: Zfand6 (zinc finger, AN1-type domain 6 [Source:MGI Symbol;Acc:MGI:1929510])

HSP 1 Score: 118.242 bits (295), Expect = 7.024e-30
Identity = 79/228 (34.65%), Postives = 116/228 (50.88%), Query Frame = -3
Query: 1024 LCKQGCGFYGNAQNMDMCSKCYQNFLKSSNQEEAPRSQSSNQSPYASQISINELYQSRAKLVESTVNQCKEKNRKRLAQSDIES----LHKVPKTCKNKDSEQYG---VEADSIADMFTSQDAALHQPTAVADIINKLGPDDPDASPENSMRDNGSGGTTQIMKKPRRCEFCRRKVGLTGFDCRCGGHYCAVHRYSDKHSCTFDYQAHGQEQIKHQNPMICGSKIKKI 1686
            LC  GCGFYGN +   MCS CY+  L+  N      S +   SP A+ +S          L ES   QC + +    AQS ++S    +   P + ++  SE      V++ S+ D   S+   L  P A   +  +  P    +       +  S    +  +K  RC  CR+KVGLTGF+CRCG  YC VHRYSD H+C+++Y+A   E+I+ +NP++ G KI+KI
Sbjct:   13 LCSTGCGFYGNPRTNGMCSVCYKEHLQRQN------SSNGRISPPAASVS---------SLSESLPVQCADGSVPD-AQSALDSTSSSMQPGPVSNQSLLSESVAPSQVDSTSV-DKAVSETEDLQGPRAEGLVPLECDPPSSVSDTTQQPSEEQSKSLEKPKQKKNRCFMCRKKVGLTGFECRCGNVYCGVHRYSDVHNCSYNYKADAAEKIRKENPVVVGEKIQKI 223          
BLAST of SMED30027918 vs. Ensembl Mouse
Match: Zfand6 (zinc finger, AN1-type domain 6 [Source:MGI Symbol;Acc:MGI:1929510])

HSP 1 Score: 110.923 bits (276), Expect = 2.704e-27
Identity = 75/222 (33.78%), Postives = 111/222 (50.00%), Query Frame = -3
Query: 1042 LCKQGCGFYGNAQNMDMCSKCYQNFLKSSNQEEAPRSQSSNQSPYASQISINELYQSRAKLVESTVNQCKEKNRKRLAQSDIES----LHKVPKTCKNKDSEQYG---VEADSIADMFTSQDAALHQPTAVADIINKLGPDDPDASPENSMRDNGSGGTTQIMKKPRRCEFCRRKVGLTGFDCRCGGHYCAVHRYSDKHSCTFDYQAHGQEQIKHQNPMICG 1686
            LC  GCGFYGN +   MCS CY+  L+  N      S +   SP A+ +S          L ES   QC + +    AQS ++S    +   P + ++  SE      V++ S+ D   S+   L  P A   +  +  P    +       +  S    +  +K  RC  CR+KVGLTGF+CRCG  YC VHRYSD H+C+++Y+A   E+I+ +NP++ G
Sbjct:   13 LCSTGCGFYGNPRTNGMCSVCYKEHLQRQN------SSNGRISPPAASVS---------SLSESLPVQCADGSVPD-AQSALDSTSSSMQPGPVSNQSLLSESVAPSQVDSTSV-DKAVSETEDLQGPRAEGLVPLECDPPSSVSDTTQQPSEEQSKSLEKPKQKKNRCFMCRKKVGLTGFECRCGNVYCGVHRYSDVHNCSYNYKADAAEKIRKENPVVVG 217          
BLAST of SMED30027918 vs. Ensembl Mouse
Match: Zfand5 (zinc finger, AN1-type domain 5 [Source:MGI Symbol;Acc:MGI:1278334])

HSP 1 Score: 106.301 bits (264), Expect = 9.768e-26
Identity = 71/229 (31.00%), Postives = 108/229 (47.16%), Query Frame = -3
Query: 1024 LCKQGCGFYGNAQNMDMCSKCYQNFLKSSNQEEAPRSQSSNQ-SPYASQISINELYQSRAKL--VESTVNQCKEKNRKRLAQSDIESLHKVPKTCKNKDSEQYGVEADSIADMFTSQDAALHQPTAVADIINKLGPDDP---DASPENSMRDNGSGGTTQIMKKPR--RCEFCRRKVGLTGFDCRCGGHYCAVHRYSDKHSCTFDYQAHGQEQIKHQNPMICGSKIKKI 1686
            LC  GCGFYGN +   MCS CY+  L+        R Q+S + SP  +    N      A +   ++ +N C+        +S    +  +P T      +Q    + S  D  T+    + +P       +   P      + +PE              + KP+  RC  CR+KVGLTGFDCRCG  +C +HRYSDKH+C +DY+A    +I+ +NP++   KI++I
Sbjct:   13 LCSTGCGFYGNPRTNGMCSVCYKEHLQ--------RQQNSGRMSPMGTASGSNSPTSDSASVQRADAGLNNCEGAAGSTSEKSRNVPVAALPVT------QQMTEMSISREDKITTPKTEVSEPVVTQPSPSVSQPSSSQSEEKAPE--------------LPKPKKNRCFMCRKKVGLTGFDCRCGNLFCGLHRYSDKHNCPYDYKAEAAAKIRKENPVVVAEKIQRI 213          
BLAST of SMED30027918 vs. UniProt/SwissProt
Match: sp|Q5R7S6|ZFAN6_PONAB (AN1-type zinc finger protein 6 OS=Pongo abelii OX=9601 GN=ZFAND6 PE=2 SV=1)

HSP 1 Score: 118.242 bits (295), Expect = 4.181e-29
Identity = 77/229 (33.62%), Postives = 117/229 (51.09%), Query Frame = -3
Query: 1024 LCKQGCGFYGNAQNMDMCSKCYQNFLKSSNQEEAPRSQSSNQSPYASQISINELYQSRAKLVESTVNQCKEKNRKRLAQSDIESLHKVPKTCKNKDSEQYGVEADSIADM-FTSQDAALHQPTAVADIINKLGPDDPDASPENSMRDNG---SGGTTQIMKKPR----RCEFCRRKVGLTGFDCRCGGHYCAVHRYSDKHSCTFDYQAHGQEQIKHQNPMICGSKIKKI 1686
            LC  GCGFYGN +   MCS CY+  L+  N      S +   SP A+ +S          L ES   QC + +              VP+     DS    ++   +++    S+  A  Q  + +  ++K  P+  D   + S+ D     S   ++ ++KP+    RC  CR+KVGLTGF+CRCG  YC VHRYSD H+C+++Y+A   E+I+ +NP++ G KI+KI
Sbjct:   13 LCSTGCGFYGNPRTNGMCSVCYKEHLQRQN------SSNGRISPPATSVS---------SLSESLPVQCTDGS--------------VPEAQSTLDSTSSSMQPSPVSNQSLLSESVASSQLDSTS--VDKAVPETEDL--QASVSDTAQQPSEEQSKSLEKPKQKKNRCFMCRKKVGLTGFECRCGNVYCGVHRYSDVHNCSYNYKADAAEKIRKENPVVVGEKIQKI 208          
BLAST of SMED30027918 vs. UniProt/SwissProt
Match: sp|Q6FIF0|ZFAN6_HUMAN (AN1-type zinc finger protein 6 OS=Homo sapiens OX=9606 GN=ZFAND6 PE=1 SV=2)

HSP 1 Score: 117.857 bits (294), Expect = 4.613e-29
Identity = 77/229 (33.62%), Postives = 117/229 (51.09%), Query Frame = -3
Query: 1024 LCKQGCGFYGNAQNMDMCSKCYQNFLKSSNQEEAPRSQSSNQSPYASQISINELYQSRAKLVESTVNQCKEKNRKRLAQSDIESLHKVPKTCKNKDSEQYGVEADSIADM-FTSQDAALHQPTAVADIINKLGPDDPDASPENSMRDNG---SGGTTQIMKKPR----RCEFCRRKVGLTGFDCRCGGHYCAVHRYSDKHSCTFDYQAHGQEQIKHQNPMICGSKIKKI 1686
            LC  GCGFYGN +   MCS CY+  L+  N      S +   SP A+ +S          L ES   QC + +              VP+     DS    ++   +++    S+  A  Q  + +  ++K  P+  D   + S+ D     S   ++ ++KP+    RC  CR+KVGLTGF+CRCG  YC VHRYSD H+C+++Y+A   E+I+ +NP++ G KI+KI
Sbjct:   13 LCSTGCGFYGNPRTNGMCSVCYKEHLQRQN------SSNGRISPPATSVS---------SLSESLPVQCTDGS--------------VPEAQSALDSTSSSMQPSPVSNQSLLSESVASSQLDSTS--VDKAVPETEDV--QASVSDTAQQPSEEQSKSLEKPKQKKNRCFMCRKKVGLTGFECRCGNVYCGVHRYSDVHNCSYNYKADAAEKIRKENPVVVGEKIQKI 208          
BLAST of SMED30027918 vs. UniProt/SwissProt
Match: sp|Q6DGF4|ZFAN6_RAT (AN1-type zinc finger protein 6 OS=Rattus norvegicus OX=10116 GN=Zfand6 PE=1 SV=1)

HSP 1 Score: 118.242 bits (295), Expect = 4.913e-29
Identity = 79/228 (34.65%), Postives = 116/228 (50.88%), Query Frame = -3
Query: 1024 LCKQGCGFYGNAQNMDMCSKCYQNFLKSSNQEEAPRSQSSNQSPYASQISINELYQSRAKLVESTVNQCKEKNRKRLAQSDIES----LHKVPKTCKNKDSEQYG---VEADSIADMFTSQDAALHQPTAVADIINKLGPDDPDASPENSMRDNGSGGTTQIMKKPRRCEFCRRKVGLTGFDCRCGGHYCAVHRYSDKHSCTFDYQAHGQEQIKHQNPMICGSKIKKI 1686
            LC  GCGFYGN +   MCS CY+  L+  N      S +   SP A+ +S          L ES   QC + +    AQS ++S    +   P + ++  SE      V++ S+ D   S+   L  P A   +  +  P    +       +  S    +  +K  RC  CR+KVGLTGF+CRCG  YC VHRYSD H+C+++Y+A   E+I+ +NP++ G KI+KI
Sbjct:   13 LCSTGCGFYGNPRTNGMCSVCYKEHLQRQN------SSNGRISPPAASVS---------SLSESLPVQCADGSVPD-AQSALDSTSSSMQPGPVSNQSLLSESVAPSQVDSTSV-DKAVSETEDLQGPRAEGLVPLECDPPSSVSDTTQQPSEEQSKSLEKPKQKKNRCFMCRKKVGLTGFECRCGNVYCGVHRYSDVHNCSYNYKADAAEKIRKENPVVVGEKIQKI 223          
BLAST of SMED30027918 vs. UniProt/SwissProt
Match: sp|Q9DCH6|ZFAN6_MOUSE (AN1-type zinc finger protein 6 OS=Mus musculus OX=10090 GN=Zfand6 PE=1 SV=1)

HSP 1 Score: 118.242 bits (295), Expect = 4.913e-29
Identity = 79/228 (34.65%), Postives = 116/228 (50.88%), Query Frame = -3
Query: 1024 LCKQGCGFYGNAQNMDMCSKCYQNFLKSSNQEEAPRSQSSNQSPYASQISINELYQSRAKLVESTVNQCKEKNRKRLAQSDIES----LHKVPKTCKNKDSEQYG---VEADSIADMFTSQDAALHQPTAVADIINKLGPDDPDASPENSMRDNGSGGTTQIMKKPRRCEFCRRKVGLTGFDCRCGGHYCAVHRYSDKHSCTFDYQAHGQEQIKHQNPMICGSKIKKI 1686
            LC  GCGFYGN +   MCS CY+  L+  N      S +   SP A+ +S          L ES   QC + +    AQS ++S    +   P + ++  SE      V++ S+ D   S+   L  P A   +  +  P    +       +  S    +  +K  RC  CR+KVGLTGF+CRCG  YC VHRYSD H+C+++Y+A   E+I+ +NP++ G KI+KI
Sbjct:   13 LCSTGCGFYGNPRTNGMCSVCYKEHLQRQN------SSNGRISPPAASVS---------SLSESLPVQCADGSVPD-AQSALDSTSSSMQPGPVSNQSLLSESVAPSQVDSTSV-DKAVSETEDLQGPRAEGLVPLECDPPSSVSDTTQQPSEEQSKSLEKPKQKKNRCFMCRKKVGLTGFECRCGNVYCGVHRYSDVHNCSYNYKADAAEKIRKENPVVVGEKIQKI 223          
BLAST of SMED30027918 vs. UniProt/SwissProt
Match: sp|Q3SZY7|ZFAN6_BOVIN (AN1-type zinc finger protein 6 OS=Bos taurus OX=9913 GN=ZFAND6 PE=2 SV=1)

HSP 1 Score: 116.701 bits (291), Expect = 1.162e-28
Identity = 76/227 (33.48%), Postives = 113/227 (49.78%), Query Frame = -3
Query: 1024 LCKQGCGFYGNAQNMDMCSKCYQNFLKSSNQEEAPRSQSSNQSPYASQISINELYQSRAKLVESTVNQCKEKNRKRLAQSDIESLHKVPKTCKNKDSEQYGVEADSIADM-FTSQDAALHQPTAVADIINKLGPDDPDASPENS-MRDNGSGGTTQIMKKPR----RCEFCRRKVGLTGFDCRCGGHYCAVHRYSDKHSCTFDYQAHGQEQIKHQNPMICGSKIKKI 1686
            LC  GCGFYGN +   MCS CY+  L+  N      S +   SP A  ++          L ES   QC + +              VP+     DS    V+   +++    S+  A  Q  + +  ++K  P+  D     S      S   ++ ++KP+    RC  CR+KVGLTGF+CRCG  YC VHRYSD H+C+++Y+A   E+I+ +NP++ G KI+KI
Sbjct:   13 LCSTGCGFYGNPRTNGMCSVCYKEHLQRQN------SSNGRISPPAPSVT---------SLSESLPVQCTDGS--------------VPEAQSALDSTASSVQPSPVSNQSLLSESVASSQVDSTS--VDKAIPETEDLQASVSETAQQASEEQSKSLEKPKQKKNRCFMCRKKVGLTGFECRCGNVYCGVHRYSDVHNCSYNYKADAAEKIRKENPVVVGEKIQKI 208          
BLAST of SMED30027918 vs. TrEMBL
Match: A2BFW0 (Zinc finger, AN1-type domain 5a OS=Danio rerio OX=7955 GN=zfand5a PE=4 SV=1)

HSP 1 Score: 129.028 bits (323), Expect = 1.822e-30
Identity = 75/224 (33.48%), Postives = 117/224 (52.23%), Query Frame = -3
Query: 1024 LCKQGCGFYGNAQNMDMCSKCYQNFL-KSSNQEEAPRSQSSNQSPYASQISINELYQSRAKLVESTVNQCKEKNRKRLAQSDIESLHKVPKTCKNKDSEQYGVEADSIADMFTSQDAALHQPTAVADIINKLGPDDPDASPENSMRDNGSGGTTQIMKKPR--RCEFCRRKVGLTGFDCRCGGHYCAVHRYSDKHSCTFDYQAHGQEQIKHQNPMICGSKIKKI 1686
            LC  GCGFYGN +   MCS CY+  L +  + + +P S  +  SP A   +I  L  S  K  E+      E  R+ +  S +    K+ +   +++ +    +A+++  + T       QPT+    I     +D   SP++S              KP+  RC  CR++VGLTGFDCRCG  +C +HRYSDKH+CT+DY+A    +I+ +NP++   KI++I
Sbjct:   13 LCTTGCGFYGNPRTNGMCSVCYKEHLNRQQSSDRSPMSPLAAGSPSAEASAIQRLEASINK-AETLPAPSTETMRESIPSSSLPVTQKMTEMSISREEKALSPKAETVEPVIT-------QPTSSYSPIPVAQANDDAKSPDSS--------------KPKKNRCFTCRKRVGLTGFDCRCGNLFCGIHRYSDKHNCTYDYKAEAAAKIRKENPVVVADKIQRI 214          
BLAST of SMED30027918 vs. TrEMBL
Match: Q6PBK7 (Zinc finger, AN1-type domain 5a OS=Danio rerio OX=7955 GN=zfand5a PE=2 SV=1)

HSP 1 Score: 128.642 bits (322), Expect = 2.488e-30
Identity = 74/230 (32.17%), Postives = 119/230 (51.74%), Query Frame = -3
Query: 1024 LCKQGCGFYGNAQNMDMCSKCYQNFLKSSNQEEAPRSQSSNQSPYASQISINELYQSRAKLVESTVNQCK-------EKNRKRLAQSDIESLHKVPKTCKNKDSEQYGVEADSIADMFTSQDAALHQPTAVADIINKLGPDDPDASPENSMRDNGSGGTTQIMKKPR--RCEFCRRKVGLTGFDCRCGGHYCAVHRYSDKHSCTFDYQAHGQEQIKHQNPMICGSKIKKI 1686
            LC  GCGFYGN +   MCS CY+  L         R QSS++SP +          S  + +E+++N+ +       E  R+ +  S +    K+ +   +++ +    +A+++  + T       QPT+    I     +D   SP++S              KP+  RC  CR++VGLTGFDCRCG  +C +HRYSDKH+CT+DY+A    +I+ +NP++   KI++I
Sbjct:   13 LCTTGCGFYGNPRTNGMCSVCYKEHLN--------RQQSSDRSPMSPLAGSPSAEASAIQRLEASINKAETLPAPSTETMRESIPSSSLPVTQKMTEMSISREEKALSPKAETVEPVIT-------QPTSSYSPIPVAQANDDAKSPDSS--------------KPKKNRCFTCRKRVGLTGFDCRCGNLFCGIHRYSDKHNCTYDYKAEAAAKIRKENPVVVADKIQRI 213          
BLAST of SMED30027918 vs. TrEMBL
Match: H9GI68 (Zinc finger AN1-type containing 6 OS=Anolis carolinensis OX=28377 GN=ZFAND6 PE=4 SV=1)

HSP 1 Score: 128.257 bits (321), Expect = 3.338e-30
Identity = 80/228 (35.09%), Postives = 112/228 (49.12%), Query Frame = -3
Query: 1024 LCKQGCGFYGNAQNMDMCSKCYQNFLKSSNQEEAPRSQSSNQSPYASQISINELYQSRAKLVESTVNQCKEKNRKRLAQSDIESLHKVPKTCKNKDSEQYGVEADSIADMFTSQDAALHQPTAVADIINKLGPDDPDASPENSMRDNGSGGTTQ---IMKKPR----RCEFCRRKVGLTGFDCRCGGHYCAVHRYSDKHSCTFDYQAHGQEQIKHQNPMICGSKIKKI 1686
            LC  GCGFYGN +   MCS CY+  L+        R   SN     S  S+N        L ES   QC E            ++   P T ++           SI     ++  A  +  + A I++K GP+  D   + S  DN    + +    + KP+    RC  CR+KVGLTGF+CRCG  YC VHRYSD HSC+++Y+A   E+I+ +NP++ G KI+KI
Sbjct:   13 LCSTGCGFYGNPRTNGMCSVCYKEHLQ--------RQNGSNGRISPSATSVN-------SLAESLPVQCTES-----------TIQDAPPTLESTPVPPMQPSPVSIPSTLLAESVATCEVESTA-IVDKTGPEREDV--QASASDNAEPSSEEQDKSLDKPKQKKTRCFMCRKKVGLTGFECRCGNVYCGVHRYSDVHSCSYNYKADAAEKIRKENPVVVGEKIQKI 211          
BLAST of SMED30027918 vs. TrEMBL
Match: A0A3N0XHI1 (AN1-type zinc finger protein 5 OS=Anabarilius grahami OX=495550 GN=DPX16_23062 PE=4 SV=1)

HSP 1 Score: 127.487 bits (319), Expect = 6.791e-30
Identity = 73/228 (32.02%), Postives = 119/228 (52.19%), Query Frame = -3
Query: 1024 LCKQGCGFYGNAQNMDMCSKCYQNFLKSSNQEEAPRSQSSNQSPYASQISINELYQSRAKLVESTVNQCK-------EKNRKRLAQSDIESLHKVPKTCKNKDSEQYGVEADSIADMFTSQDAALHQPTAVADIINKLGPDDPDASPENSMRDNGSGGTTQIMKKPRRCEFCRRKVGLTGFDCRCGGHYCAVHRYSDKHSCTFDYQAHGQEQIKHQNPMICGSKIKKI 1686
            LC  GCGFYGN +   MCS CY+  L         R QSS++SP +          S  + +E+++N+ +       +  R  +  + +    ++ +   +++      +A+++  + T Q  + + P AVA     LG D+   SP++            I  K  RC  CR++VGLTGFDCRCG  +C +HRYSDKH+CT+DY+A    +I+ +NP++   KI++I
Sbjct:   13 LCTTGCGFYGNPRTNGMCSVCYKEHLN--------RQQSSDRSPMSPLAGSPSAEASAIQRLEASINKAEPSPAPSADTMRDSIPSTSLPVTQQMTEMSISREERALSPKAEAVEPVIT-QPTSSYSPIAVA-----LGSDE-GKSPDS------------IKPKKNRCFTCRKRVGLTGFDCRCGNLFCGIHRYSDKHNCTYDYKAEAAAKIRKENPVVVADKIQRI 213          
BLAST of SMED30027918 vs. TrEMBL
Match: W5N503 (Zinc finger AN1-type containing 6 OS=Lepisosteus oculatus OX=7918 GN=ZFAND6 PE=4 SV=1)

HSP 1 Score: 125.946 bits (315), Expect = 4.189e-29
Identity = 83/231 (35.93%), Postives = 111/231 (48.05%), Query Frame = -3
Query: 1027 LCKQGCGFYGNAQNMDMCSKCYQNFLKSSNQEEAPRSQSSNQSPYASQISINELYQSRAKLVESTVNQCKEKN-----------RKRLAQSDIESLHKVPKTCKNKDSEQYGVEADSIADMFTSQDAALHQPTAVADIINKLGPDDPDASPENSMRDNGSGGTTQIMKKPRRCEFCRRKVGLTGFDCRCGGHYCAVHRYSDKHSCTFDYQAHGQEQIKHQNPMICGSKIKK 1686
            LC  GCGFYGN +   MCS CY++F++  N      S      P  S +S          L ES   QC E N              L QS I +   +       +SE    E DS  D    +   LH   +V+D  ++   +  D SPE            +  +K  RC  CR+KVGLTGFDCRCG  +C +HRYSD H+CTFDY+A   E+I+ +NP++ G KI+K
Sbjct:   35 LCATGCGFYGNPRTNGMCSVCYKDFVQRQN------SNGRVSPPAPSGVS---------SLGESLPVQCSEGNPADVTATLTQTATPLEQSSIVTRQTLLSQASLTNSE----EDDSTGDKTGLKTEELH--ASVSDDSDQASSEGLDRSPE------------KPKQKKNRCFICRKKVGLTGFDCRCGNLFCGIHRYSDIHNCTFDYKADAAEKIRKENPVVVGEKIQK 232          
BLAST of SMED30027918 vs. Ensembl Cavefish
Match: zfand5a (AN1-type zinc finger protein 5-like [Source:NCBI gene;Acc:103021477])

HSP 1 Score: 121.709 bits (304), Expect = 2.954e-31
Identity = 72/230 (31.30%), Postives = 116/230 (50.43%), Query Frame = -3
Query: 1024 LCKQGCGFYGNAQNMDMCSKCYQNFLKSSNQEEAPRSQSSNQSPYASQISINELYQSRAKLVESTVNQCK-------EKNRKRLAQSDIESLHKVPKTCKNKDSEQYGVEADSIADMFTSQDAALHQPTAVADIINKLGPDDPDASPENSMRDNGSGGTTQIMKKPR--RCEFCRRKVGLTGFDCRCGGHYCAVHRYSDKHSCTFDYQAHGQEQIKHQNPMICGSKIKKI 1686
            LC  GCGFYGN +   MCS CY+  L         R QSS++SP +          S  + +E+++N+ +       E  R+ +  + +    ++ +   +++        D+ A+   +Q  + + P A A   ++     PDAS                  KP+  RC  CR++VGLTGFDCRCG  +C +HRYSDKH+CT+DY+A    +I+ +NP++   KI++I
Sbjct:   13 LCTTGCGFYGNPRTNGMCSVCYKEHLS--------RQQSSDRSPVSPLAGSPSSEASAIQRLEASLNKTEPSPPANTESTREMMPVASLPVTQQMTEMSISREERSPSPTPDT-AEPVVTQPTSSYSPVAGAPASDEG--KSPDAS------------------KPKKNRCFTCRKRVGLTGFDCRCGNLFCGIHRYSDKHNCTYDYKAEAAAKIRKENPVVVADKIQRI 213          
BLAST of SMED30027918 vs. Ensembl Cavefish
Match: zfand5b (zinc finger AN1-type containing 5 [Source:NCBI gene;Acc:103041382])

HSP 1 Score: 112.849 bits (281), Expect = 3.082e-28
Identity = 72/223 (32.29%), Postives = 106/223 (47.53%), Query Frame = -3
Query: 1024 LCKQGCGFYGNAQNMDMCSKCYQNFLKSSNQEEAPRSQSSNQSPYASQISINELYQSRAKLVESTVNQCKEKNRKRLAQSDIESLHKVPKTCKNKDSEQYGVEADSIADMFTSQDAALHQPTAVADIINKLGPDDPDASPENSMRDNGSGGTTQIMKKPR--RCEFCRRKVGLTGFDCRCGGHYCAVHRYSDKHSCTFDYQAHGQEQIKHQNPMICGSKIKKI 1686
            LC  GCGFYGN +   MCS CY+  L   N          N    +S  S      S  +++E+++N     N    A+S   +   +P T +         E ++ +      +  + QPTA     N    ++  A PE                KP+  RC  CR+KVGLTGFDCRCG  +C +HRYSDKH+C +DY+A    +I+ +NP++   KI++I
Sbjct:   13 LCTTGCGFYGNPRTNGMCSVCYKEHLTRQNN-----GGPLNSMGSSSVTSSPTSEASAIQIIEASLN-----NSASEAESPSGAAAALPVT-QQMIEMSISCEVEAASPKVEVPEPVVTQPTASVSSANTADSEEAKA-PE--------------APKPKKNRCFMCRKKVGLTGFDCRCGNLFCGIHRYSDKHNCPYDYKAEAAAKIRKENPVVVADKIQRI 209          
BLAST of SMED30027918 vs. Ensembl Cavefish
Match: zgc:77486 (AN1-type zinc finger protein 5-like [Source:NCBI gene;Acc:103042439])

HSP 1 Score: 107.842 bits (268), Expect = 2.183e-26
Identity = 74/224 (33.04%), Postives = 103/224 (45.98%), Query Frame = -3
Query: 1024 LCKQGCGFYGNAQNMDMCSKCYQNFLKSSNQEEAPRSQSSNQSPYASQISINELYQSRAKLVESTVNQCKEKNRKRLAQSDIESLHKVPKTCKNKDSEQYGVEADSIADMFTSQD-AALHQPTAVADIINKLGPDDPDASPENSMRDNGSGG--TTQIMKKPRRCEFCRRKVGLTGFDCRCGGHYCAVHRYSDKHSCTFDYQAHGQEQIKHQNPMICGSKIKKI 1686
            LC  GCGFYGN +   MCS CY+  L+   Q+   RS     SP   + + +      A  V  TV    E   + +  S+  +    P     +           +  M  SQD AA     A  +  ++       + P        S G  T    KK  RC  CR+KVGLTGFDCRCG  +CA+HRYSDKH C +DY+     +I+ +NP++   KI+K+
Sbjct:   13 LCTMGCGFYGNPRTNGMCSVCYKEHLQ--RQQGGGRS-----SPPGEKAATSPAGSPGAPTV--TVETTPEPTSEAVTPSEERTSSGSPSPVTQQ-----------MTAMSISQDTAATDSDRADGEEEDEDEGSSKSSGPVVEAAQASSDGDQTPDKNKKKNRCFICRKKVGLTGFDCRCGNLFCAIHRYSDKHDCPYDYRGAAAARIRKENPIVVAEKIQKL 216          
BLAST of SMED30027918 vs. Ensembl Cavefish
Match: zfand6 (zinc finger AN1-type containing 6 [Source:NCBI gene;Acc:103027141])

HSP 1 Score: 98.9821 bits (245), Expect = 3.672e-23
Identity = 59/222 (26.58%), Postives = 114/222 (51.35%), Query Frame = -3
Query: 1024 CKQGCGFYGNAQNMDMCSKCYQNFLKSSNQEEAPRSQSSNQSPYASQIS-INELYQSRAKLVESTVNQCKEKNRKRLAQSDIESLHKVPKTCKNKDSEQYGVEADSIADMFTSQDAALHQPTAVADIINKLGPDDPDASPENSMRDNGSGGTTQIMK-KPRRCEFCRRKVGLTGFDCRCGGHYCAVHRYSDKHSCTFDYQAHGQEQIKHQNPMICGSKIKKI 1683
            C  GCGFYGN +N  MCS CY++ L+  N      S S    P +++ S + E   +++  V  T +   + N    +QS + +  +  +   + +++      +      +++ A++ +   +++++   G      +  + +    S    +  K K +RC  C +K+ LT ++CRCG ++C VHR +  H+C +DY+A   E+I+ +NP++ G KI+KI
Sbjct:   14 CTAGCGFYGNPRNNGMCSICYKDSLQRQN------SSSRVSDPVSTRFSTLGESLSTQSNTV--TASSALQLN----SQSIVTATERAQEELTSGEAQDELKTEEVAGPSNSAEVASVQESVTMSEMLGSFGSSAEVLASGSCVSVQSSAPVVENSKPKKKRCFICNKKLALTDYNCRCGNYFCGVHRCTIDHNCPYDYKAEAAEKIRKENPVVAGEKIQKI 223          
BLAST of SMED30027918 vs. Ensembl Cavefish
Match: zfand6 (zinc finger AN1-type containing 6 [Source:NCBI gene;Acc:103027141])

HSP 1 Score: 98.9821 bits (245), Expect = 3.984e-23
Identity = 59/222 (26.58%), Postives = 114/222 (51.35%), Query Frame = -3
Query: 1024 CKQGCGFYGNAQNMDMCSKCYQNFLKSSNQEEAPRSQSSNQSPYASQIS-INELYQSRAKLVESTVNQCKEKNRKRLAQSDIESLHKVPKTCKNKDSEQYGVEADSIADMFTSQDAALHQPTAVADIINKLGPDDPDASPENSMRDNGSGGTTQIMK-KPRRCEFCRRKVGLTGFDCRCGGHYCAVHRYSDKHSCTFDYQAHGQEQIKHQNPMICGSKIKKI 1683
            C  GCGFYGN +N  MCS CY++ L+  N      S S    P +++ S + E   +++  V  T +   + N    +QS + +  +  +   + +++      +      +++ A++ +   +++++   G      +  + +    S    +  K K +RC  C +K+ LT ++CRCG ++C VHR +  H+C +DY+A   E+I+ +NP++ G KI+KI
Sbjct:   21 CTAGCGFYGNPRNNGMCSICYKDSLQRQN------SSSRVSDPVSTRFSTLGESLSTQSNTV--TASSALQLN----SQSIVTATERAQEELTSGEAQDELKTEEVAGPSNSAEVASVQESVTMSEMLGSFGSSAEVLASGSCVSVQSSAPVVENSKPKKKRCFICNKKLALTDYNCRCGNYFCGVHRCTIDHNCPYDYKAEAAEKIRKENPVVAGEKIQKI 230          
BLAST of SMED30027918 vs. Ensembl Sea Lamprey
Match: ZFAND5 (zinc finger AN1-type containing 5 [Source:HGNC Symbol;Acc:HGNC:13008])

HSP 1 Score: 107.457 bits (267), Expect = 8.762e-27
Identity = 70/230 (30.43%), Postives = 111/230 (48.26%), Query Frame = -3
Query: 1024 LCKQGCGFYGNAQNMDMCSKCYQNFLKSSNQEE--APRSQSSNQSPYASQISINELYQSRAKLVESTVNQCKEKNRKRLAQSDIESLHKVPKTCKNKDSEQYGVEADSIADMFTSQDAALHQP-----TAVADIINKLGPDDPDASPENSMRDNGSGGTTQIMKKPR--RCEFCRRKVGLTGFDCRCGGHYCAVHRYSDKHSCTFDYQAHGQEQIKHQNPMICGSKIKKI 1686
            +C  GCGFYGN +   MCS CY+  L+  N     +P   SS     A  ++ +++ ++ + L + T++     +    +     +  +    C    S     +    A+   +Q A    P      A +   ++LG    + + E    D          +KP+  RC  CR+KVGLTGF CRCG  YC +HRYSDKH C +DY++   E+I+ +NP++ G KI+KI
Sbjct:   13 MCAMGCGFYGNPRTSGMCSLCYKEHLQRQNSSGHLSPAGMSSG---LADSVA-SQMVEAASSLPKDTLSSASSPSSVTASSMSAPAARQPSPDCLQMTSMNISEKEACTAEEDGAQAAVNGSPPFSVAAATSLSSSELGKPSGEETEEKETNDK---------QKPKKSRCFSCRKKVGLTGFQCRCGNMYCGLHRYSDKHECPYDYRSEAAEKIRKENPVVVGQKIQKI 229          
BLAST of SMED30027918 vs. Ensembl Sea Lamprey
Match: zfand4 (zinc finger, AN1-type domain 4 [Source:ZFIN;Acc:ZDB-GENE-090312-102])

HSP 1 Score: 73.9442 bits (180), Expect = 4.441e-14
Identity = 29/63 (46.03%), Postives = 44/63 (69.84%), Query Frame = -3
Query: 1024 RRCEFCRRKVGL-TGFDCRCGGHYCAVHRYSDKHSCTFDYQAHGQEQIKHQNPMICGSKIKKI 1209
            +RC FC RK GL T ++CRCG ++C +HRY++ H+CTFDY++ G+  +   +P I   K+ KI
Sbjct:  607 KRCFFCGRKTGLATSYECRCGNNFCGMHRYAEAHACTFDYKSIGRRLLLDSHPAISAPKLPKI 669          
BLAST of SMED30027918 vs. Ensembl Sea Lamprey
Match: zfand3 (zinc finger, AN1-type domain 3 [Source:ZFIN;Acc:ZDB-GENE-050706-134])

HSP 1 Score: 46.9802 bits (110), Expect = 8.501e-7
Identity = 26/89 (29.21%), Postives = 45/89 (50.56%), Query Frame = -3
Query: 1072 PTAVADIIN-KLGPDDPDASPENSMRDNGSGGTTQIMKKPRRCEFCRRKVGLTGFD---CRCGGHYCAVHRYSDKHSCTFDYQAHGQEQ 1326
            P   AD ++ + G D P         ++         K  RRC  CR ++ L   +   CRCG  +C++HR  ++H+CT+D+  HG+++
Sbjct:    5 PALAADCVDGESGSDSPAKKTCGDKDEDEEEKGRAKQKNKRRCFTCRARLELVQQELGLCRCGFVFCSLHRLPEQHACTYDHMGHGRQE 93          
BLAST of SMED30027918 vs. Ensembl Nematostella
Match: EDO45023 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RU48])

HSP 1 Score: 103.99 bits (258), Expect = 7.828e-26
Identity = 69/223 (30.94%), Postives = 101/223 (45.29%), Query Frame = -3
Query: 1024 LCKQGCGFYGNAQNMDMCSKCYQNFL--KSSNQEEAPRSQSSNQSPYASQISINELYQSRAKLVESTVNQCKEKNRKRLAQSDIESLHKVPKTCKNKDSEQYGVEADSIADMFTSQDAALHQPTAVADIINKLGPDDPDASPENSMRDNGSGGTTQIMKKPRRCEFCRRKVGLTGFDCRCGGHYCAVHRYSDKHSCTFDYQAHGQEQIKHQNPMICGSKIKKI 1686
            LC+ GCGFYGN+    MCSKC+++ L  K S+       Q+S Q   +S ++   L  + A +  +T            ++  IE                                    QP ++            +A   +  +D G       +K+ R C  CR+KVGLTGF+CRCG  YC +HRYSDKH CTFDY+A G+ +I   NP++   KI+K+
Sbjct:   13 LCRNGCGFYGNSATDGMCSKCWKDVLRRKQSSPTANTGIQASIQGSCSSMMTDGSLATAAAPVPMATAVATASSTTSLSSEESIED----------------------------------RQPISMV-----------EAGSSDIGKDKGK------IKRNR-CFMCRKKVGLTGFECRCGNVYCGLHRYSDKHDCTFDYKAEGKAKILKDNPVVLAEKIQKL 183          
BLAST of SMED30027918 vs. Ensembl Nematostella
Match: EDO38424 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCZ8])

HSP 1 Score: 71.633 bits (174), Expect = 1.155e-15
Identity = 32/66 (48.48%), Postives = 45/66 (68.18%), Query Frame = -3
Query: 1024 KKPRRCEFCRRKVGL-TGFDCRCGGHYCAVHRYSDKHSCTFDYQAHGQEQIKHQNPMICGSKIKKI 1218
            KK  RC  C +K GL T + CRCG  +CA HRY++ HSCT+DY++ G++ I+  NP+I   K+ KI
Sbjct:   17 KKKTRCFSCGKKTGLATTYQCRCGNSFCATHRYAEVHSCTYDYKSEGRKIIEQNNPVIAAPKLPKI 82          
BLAST of SMED30027918 vs. Ensembl Medaka
Match: zfand5a (zinc finger AN1-type containing 5 [Source:NCBI gene;Acc:101155116])

HSP 1 Score: 118.242 bits (295), Expect = 4.269e-30
Identity = 73/224 (32.59%), Postives = 110/224 (49.11%), Query Frame = -3
Query: 1024 LCKQGCGFYGNAQNMDMCSKCYQNFL---KSSNQEEAPRSQSSNQSPYASQISINELYQSRAKLVESTVNQCKEKNRKRLAQSDIESLHKVPKTCKNKDSEQYGVEADSIADMFTSQDAALHQPTAVADIINKLGPDDPDASPENSMRDNGSGGTTQIMKKPRRCEFCRRKVGLTGFDCRCGGHYCAVHRYSDKHSCTFDYQAHGQEQIKHQNPMICGSKIKKI 1686
            LC  GCGFYGN +   MCS CY+  L   +SS++        S  SP +   +I  L  S AK+  S  +     +  R  Q  +    +                   + +M  S++    +P ++  +IN+     P     +S+ +  S G     KK  RC  CR++VGLTGFDCRCG  +C +HRYSDKH+C +DY+A    +I+ +NPM+   KI++I
Sbjct:   13 LCATGCGFYGNPRTNGMCSVCYKEHLTRQQSSDRMSPLSPMGSAPSPTSEVSAIQRLEASLAKVDASPAS---SPDMSRTIQGSLPVTQQ-------------------MTEMSISRE---DKPESLEPVINQPAASSPTPLASSSVEE--SQGDAPKPKK-NRCFMCRKRVGLTGFDCRCGNLFCGIHRYSDKHNCPYDYKAEAAAKIRKENPMVVADKIQRI 208          
BLAST of SMED30027918 vs. Ensembl Medaka
Match: zfand5b (AN1-type zinc finger protein 5 [Source:NCBI gene;Acc:101161739])

HSP 1 Score: 111.694 bits (278), Expect = 7.981e-28
Identity = 72/226 (31.86%), Postives = 107/226 (47.35%), Query Frame = -3
Query: 1024 LCKQGCGFYGNAQNMDMCSKCYQNFLKSSNQE---EAPRSQSSNQSPYASQISINELYQSRAKLVESTVNQCKEKNRKRLAQSDIESLHKVPKTCKNKDSEQYGVEADSIADMFTSQDAALHQPTAVADIINKLGPDDPDASPENSMRDNGSGGTTQIMKKPR--RCEFCRRKVGLTGFDCRCGGHYCAVHRYSDKHSCTFDYQAHGQEQIKHQNPMICGSKIKKI 1686
            LC  GCGFYGN +   MCS C++  L   N          + S Q    S+ S      S   L   + +       +++ +  + S             E++   A + A +F S    + QP+      +  G ++ D +PE+              +KPR  RC  CR+KVGLTGFDCRCG  +C +HRYSDKHSC +DY+A    +I+ +NPM+   KI++I
Sbjct:   13 LCATGCGFYGNPRTNGMCSVCHKEHLSRQNNGGVGSLTAVEQSGQGRLGSETSCFRGLFSEFHLYLLSGSSPAVAVTQQMTEMSLSS------------EEKWSFPAVTTALLFLS--PVVSQPSVSVCSPSTAGSEE-DKTPES--------------QKPRKNRCFMCRKKVGLTGFDCRCGNVFCGIHRYSDKHSCPYDYRAEAAAKIRKENPMVVADKIQRI 209          
BLAST of SMED30027918 vs. Ensembl Medaka
Match: zgc:77486 (AN1-type zinc finger protein 5 [Source:NCBI gene;Acc:101174824])

HSP 1 Score: 104.375 bits (259), Expect = 2.249e-25
Identity = 70/223 (31.39%), Postives = 100/223 (44.84%), Query Frame = -3
Query: 1024 LCKQGCGFYGNAQNMDMCSKCYQNFLKSSNQEEAPRSQSSNQSPYASQISINELYQSRAKLVESTVNQCKEKNRKRLAQSDIESLHKVPKTCKNKDSEQYGVEADSIADMFTSQDAALHQPTAVADIINKLGPDDPDASPENSMRDNGSGG--TTQIMKKPRRCEFCRRKVGLTGFDCRCGGHYCAVHRYSDKHSCTFDYQAHGQEQIKHQNPMICGSKIKKI 1686
            LC  GCGFYGN +   MCS CY+  L+   Q+   RS    +  ++  I       S   L+ S+ +   ++                                  +  M  SQ++   +    AD       DD D S  +      S G  T    KK  RC  CR+KVGLTGFDCRCG  +CA+HRYSDKH C +DY++    +I+ +NP++   KI+K+
Sbjct:   13 LCTMGCGFYGNPRTNGMCSVCYKEHLQ--RQQGGGRSSPPAEKGWS--IKPTTFTSSSLVLIPSSPSPVTQQ----------------------------------MTTMSISQESGAVE----ADQAETEEGDDEDTSNTSEAAQASSDGEQTPDKNKKKNRCFSCRKKVGLTGFDCRCGNLFCAIHRYSDKHDCPYDYRSAAAARIRKENPIVVAEKIQKL 193          
BLAST of SMED30027918 vs. Ensembl Medaka
Match: zfand5b (AN1-type zinc finger protein 5 [Source:NCBI gene;Acc:101161739])

HSP 1 Score: 95.5153 bits (236), Expect = 6.511e-22
Identity = 39/67 (58.21%), Postives = 51/67 (76.12%), Query Frame = -3
Query: 1024 KKPR--RCEFCRRKVGLTGFDCRCGGHYCAVHRYSDKHSCTFDYQAHGQEQIKHQNPMICGSKIKKI 1218
            +KPR  RC  CR+KVGLTGFDCRCG  +C +HRYSDKHSC +DY+A    +I+ +NPM+   KI++I
Sbjct:  163 QKPRKNRCFMCRKKVGLTGFDCRCGNVFCGIHRYSDKHSCPYDYRAEAAAKIRKENPMVVADKIQRI 229          
BLAST of SMED30027918 vs. Ensembl Medaka
Match: zfand5b (AN1-type zinc finger protein 5 [Source:NCBI gene;Acc:101161739])

HSP 1 Score: 95.5153 bits (236), Expect = 6.511e-22
Identity = 39/67 (58.21%), Postives = 51/67 (76.12%), Query Frame = -3
Query: 1024 KKPR--RCEFCRRKVGLTGFDCRCGGHYCAVHRYSDKHSCTFDYQAHGQEQIKHQNPMICGSKIKKI 1218
            +KPR  RC  CR+KVGLTGFDCRCG  +C +HRYSDKHSC +DY+A    +I+ +NPM+   KI++I
Sbjct:  163 QKPRKNRCFMCRKKVGLTGFDCRCGNVFCGIHRYSDKHSCPYDYRAEAAAKIRKENPMVVADKIQRI 229          
BLAST of SMED30027918 vs. Planmine SMEST
Match: SMESG000017254.1 (SMESG000017254.1)

HSP 1 Score: 462.611 bits (1189), Expect = 3.920e-162
Identity = 220/221 (99.55%), Postives = 221/221 (100.00%), Query Frame = -3
Query: 1024 LCKQGCGFYGNAQNMDMCSKCYQNFLKSSNQEEAPRSQSSNQSPYASQISINELYQSRAKLVESTVNQCKEKNRKRLAQSDIESLHKVPKTCKNKDSEQYGVEADSIADMFTSQDAALHQPTAVADIINKLGPDDPDASPENSMRDNGSGGTTQIMKKPRRCEFCRRKVGLTGFDCRCGGHYCAVHRYSDKHSCTFDYQAHGQEQIKHQNPMICGSKIKKI 1686
            LCKQGCGFYGNAQNMDMCSKCYQNFLKSSNQEEAPRSQSSNQSPYASQISINELYQSRAKLVESTVNQCKEKNRKRLAQSDIESLHKVPKTCKNKDSEQYGVEADSIADMFTSQDAALHQPTAVADII+KLGPDDPDASPENSMRDNGSGGTTQIMKKPRRCEFCRRKVGLTGFDCRCGGHYCAVHRYSDKHSCTFDYQAHGQEQIKHQNPMICGSKIKKI
Sbjct:   12 LCKQGCGFYGNAQNMDMCSKCYQNFLKSSNQEEAPRSQSSNQSPYASQISINELYQSRAKLVESTVNQCKEKNRKRLAQSDIESLHKVPKTCKNKDSEQYGVEADSIADMFTSQDAALHQPTAVADIIDKLGPDDPDASPENSMRDNGSGGTTQIMKKPRRCEFCRRKVGLTGFDCRCGGHYCAVHRYSDKHSCTFDYQAHGQEQIKHQNPMICGSKIKKI 232          
BLAST of SMED30027918 vs. Planmine SMEST
Match: SMESG000017254.1 (SMESG000017254.1)

HSP 1 Score: 461.84 bits (1187), Expect = 5.515e-162
Identity = 220/221 (99.55%), Postives = 221/221 (100.00%), Query Frame = -3
Query: 1024 LCKQGCGFYGNAQNMDMCSKCYQNFLKSSNQEEAPRSQSSNQSPYASQISINELYQSRAKLVESTVNQCKEKNRKRLAQSDIESLHKVPKTCKNKDSEQYGVEADSIADMFTSQDAALHQPTAVADIINKLGPDDPDASPENSMRDNGSGGTTQIMKKPRRCEFCRRKVGLTGFDCRCGGHYCAVHRYSDKHSCTFDYQAHGQEQIKHQNPMICGSKIKKI 1686
            LCKQGCGFYGNAQNMDMCSKCYQNFLKSSNQEEAPRSQSSNQSPYASQISINELYQSRAKLVESTVNQCKEKNRKRLAQSDIESLHKVPKTCKNKDSEQYGVEADSIADMFTSQDAALHQPTAVADII+KLGPDDPDASPENSMRDNGSGGTTQIMKKPRRCEFCRRKVGLTGFDCRCGGHYCAVHRYSDKHSCTFDYQAHGQEQIKHQNPMICGSKIKKI
Sbjct:   10 LCKQGCGFYGNAQNMDMCSKCYQNFLKSSNQEEAPRSQSSNQSPYASQISINELYQSRAKLVESTVNQCKEKNRKRLAQSDIESLHKVPKTCKNKDSEQYGVEADSIADMFTSQDAALHQPTAVADIIDKLGPDDPDASPENSMRDNGSGGTTQIMKKPRRCEFCRRKVGLTGFDCRCGGHYCAVHRYSDKHSCTFDYQAHGQEQIKHQNPMICGSKIKKI 230          
BLAST of SMED30027918 vs. Planmine SMEST
Match: SMESG000067619.1 (SMESG000067619.1)

HSP 1 Score: 96.2857 bits (238), Expect = 8.226e-23
Identity = 67/221 (30.32%), Postives = 101/221 (45.70%), Query Frame = -3
Query: 1024 LCKQGCGFYGNAQNMDMCSKCYQNFLKSSNQEEAPRSQSSNQSPYASQISINELYQSRAKLVESTVNQCKEKNRKRLAQSDIESLHKVPKTCKNKDSEQYGVEADSIADMFTSQDAALHQPTAVADIINKLGPDDPDASPENSMRDNGSGGTTQIMKKPRRCEFCRRKVGLTGFDCRCGGHYCAVHRYSDKHSCTFDYQAHGQEQIKHQNPMICGSKIKKI 1686
            LCK GCG++G++    +CS+CY+   +   Q E   + +S   P  ++    ++ +S                   L   D+E+   +  T  +  +        SI    T++          +DI N         S  NS+       T+    K  RC+ CR+KVGLTGF CRCGG +C+ HRYSD HSCTFDY+   +  I+  NP I  +K+ KI
Sbjct:   13 LCKTGCGYFGSSNFDGLCSQCYK---EKEKQFENNHTLNSTTFPAYNEKPFGDVQES-------------------LIHEDLETESVISSTKASLATSSSTSSFSSIVTGDTNK----------SDISN---------SETNSV-------TSASSVKKNRCQLCRKKVGLTGFACRCGGLFCSAHRYSDSHSCTFDYKVEAENAIRKANPRIVSNKVAKI 185          
BLAST of SMED30027918 vs. Planmine SMEST
Match: SMESG000015840.1 (SMESG000015840.1)

HSP 1 Score: 77.0258 bits (188), Expect = 6.930e-17
Identity = 31/61 (50.82%), Postives = 45/61 (73.77%), Query Frame = -3
Query: 1024 RCEFCRRKVGLTGFDCRCGGHYCAVHRYSDKHSCTFDYQAHGQEQIKHQNPMICGSKIKKI 1206
            RC  CR+K+G+ GFDC+C G++C  HRY + H C+FDY+A G+E++   NP++ GSKI  I
Sbjct:   53 RCLKCRKKIGIYGFDCKCEGYFCTQHRYPETHECSFDYKAEGKEKLTASNPLVKGSKIDFI 113          
BLAST of SMED30027918 vs. Planmine SMEST
Match: SMESG000055576.1 (SMESG000055576.1)

HSP 1 Score: 76.2554 bits (186), Expect = 4.841e-16
Identity = 31/65 (47.69%), Postives = 44/65 (67.69%), Query Frame = -3
Query: 1024 KKPRRCEFCRRKVGLTGFDCRCGGHYCAVHRYSDKHSCTFDYQAHGQEQIKHQNPMICGSKIKKI 1218
            KK  RC  C +KV L GF+CRCG  +C  HRYS+ H+C +DY+   QE+I+  NP++   K++KI
Sbjct:  103 KKLNRCFQCHKKVNLMGFNCRCGNVFCTAHRYSEAHNCQYDYREEAQEEIRKANPVVVAKKVEKI 167          
The following BLAST results are available for this feature:
BLAST of SMED30027918 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ZFAND69.605e-3033.62zinc finger AN1-type containing 6 [Source:HGNC Sym... [more]
ZFAND69.605e-3033.62zinc finger AN1-type containing 6 [Source:HGNC Sym... [more]
ZFAND69.605e-3033.62zinc finger AN1-type containing 6 [Source:HGNC Sym... [more]
ZFAND69.605e-3033.62zinc finger AN1-type containing 6 [Source:HGNC Sym... [more]
ZFAND69.605e-3033.62zinc finger AN1-type containing 6 [Source:HGNC Sym... [more]
back to top
BLAST of SMED30027918 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
F22D6.22.414e-2229.55pep chromosome:WBcel235:I:7079868:7081520:-1 gene:... [more]
back to top
BLAST of SMED30027918 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG450503.527e-3235.87gene:FBgn0266410 transcript:FBtr0344364[more]
CG450503.527e-3235.87gene:FBgn0266410 transcript:FBtr0344368[more]
CG450503.527e-3235.87gene:FBgn0266410 transcript:FBtr0344366[more]
CG450503.527e-3235.87gene:FBgn0266410 transcript:FBtr0344363[more]
CG450503.527e-3235.87gene:FBgn0266410 transcript:FBtr0344367[more]
back to top
BLAST of SMED30027918 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zfand5a8.145e-3433.48zinc finger, AN1-type domain 5a [Source:ZFIN;Acc:Z... [more]
zfand5a1.112e-3332.17zinc finger, AN1-type domain 5a [Source:ZFIN;Acc:Z... [more]
zfand5a1.112e-3332.17zinc finger, AN1-type domain 5a [Source:ZFIN;Acc:Z... [more]
zfand61.850e-2934.80zinc finger, AN1-type domain 6 [Source:ZFIN;Acc:ZD... [more]
zfand69.716e-2934.80zinc finger, AN1-type domain 6 [Source:ZFIN;Acc:ZD... [more]
back to top
BLAST of SMED30027918 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
hmg20a4.321e-2732.00high mobility group 20A [Source:Xenbase;Acc:XB-GEN... [more]
zfand61.423e-2430.32zinc finger AN1-type containing 6 [Source:NCBI gen... [more]
ZFAND41.461e-1242.42zinc finger, AN1-type domain 4 [Source:NCBI gene;A... [more]
back to top
BLAST of SMED30027918 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Zfand67.024e-3034.65zinc finger, AN1-type domain 6 [Source:MGI Symbol;... [more]
Zfand67.024e-3034.65zinc finger, AN1-type domain 6 [Source:MGI Symbol;... [more]
Zfand67.024e-3034.65zinc finger, AN1-type domain 6 [Source:MGI Symbol;... [more]
Zfand62.704e-2733.78zinc finger, AN1-type domain 6 [Source:MGI Symbol;... [more]
Zfand59.768e-2631.00zinc finger, AN1-type domain 5 [Source:MGI Symbol;... [more]
back to top
BLAST of SMED30027918 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5R7S6|ZFAN6_PONAB4.181e-2933.62AN1-type zinc finger protein 6 OS=Pongo abelii OX=... [more]
sp|Q6FIF0|ZFAN6_HUMAN4.613e-2933.62AN1-type zinc finger protein 6 OS=Homo sapiens OX=... [more]
sp|Q6DGF4|ZFAN6_RAT4.913e-2934.65AN1-type zinc finger protein 6 OS=Rattus norvegicu... [more]
sp|Q9DCH6|ZFAN6_MOUSE4.913e-2934.65AN1-type zinc finger protein 6 OS=Mus musculus OX=... [more]
sp|Q3SZY7|ZFAN6_BOVIN1.162e-2833.48AN1-type zinc finger protein 6 OS=Bos taurus OX=99... [more]
back to top
BLAST of SMED30027918 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A2BFW01.822e-3033.48Zinc finger, AN1-type domain 5a OS=Danio rerio OX=... [more]
Q6PBK72.488e-3032.17Zinc finger, AN1-type domain 5a OS=Danio rerio OX=... [more]
H9GI683.338e-3035.09Zinc finger AN1-type containing 6 OS=Anolis caroli... [more]
A0A3N0XHI16.791e-3032.02AN1-type zinc finger protein 5 OS=Anabarilius grah... [more]
W5N5034.189e-2935.93Zinc finger AN1-type containing 6 OS=Lepisosteus o... [more]
back to top
BLAST of SMED30027918 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zfand5a2.954e-3131.30AN1-type zinc finger protein 5-like [Source:NCBI g... [more]
zfand5b3.082e-2832.29zinc finger AN1-type containing 5 [Source:NCBI gen... [more]
zgc:774862.183e-2633.04AN1-type zinc finger protein 5-like [Source:NCBI g... [more]
zfand63.672e-2326.58zinc finger AN1-type containing 6 [Source:NCBI gen... [more]
zfand63.984e-2326.58zinc finger AN1-type containing 6 [Source:NCBI gen... [more]
back to top
BLAST of SMED30027918 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ZFAND58.762e-2730.43zinc finger AN1-type containing 5 [Source:HGNC Sym... [more]
zfand44.441e-1446.03zinc finger, AN1-type domain 4 [Source:ZFIN;Acc:ZD... [more]
zfand38.501e-729.21zinc finger, AN1-type domain 3 [Source:ZFIN;Acc:ZD... [more]
back to top
BLAST of SMED30027918 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30027918 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO450237.828e-2630.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO384241.155e-1548.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30027918 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zfand5a4.269e-3032.59zinc finger AN1-type containing 5 [Source:NCBI gen... [more]
zfand5b7.981e-2831.86AN1-type zinc finger protein 5 [Source:NCBI gene;A... [more]
zgc:774862.249e-2531.39AN1-type zinc finger protein 5 [Source:NCBI gene;A... [more]
zfand5b6.511e-2258.21AN1-type zinc finger protein 5 [Source:NCBI gene;A... [more]
zfand5b6.511e-2258.21AN1-type zinc finger protein 5 [Source:NCBI gene;A... [more]
back to top
BLAST of SMED30027918 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000017254.13.920e-16299.55SMESG000017254.1[more]
SMESG000017254.15.515e-16299.55SMESG000017254.1[more]
SMESG000067619.18.226e-2330.32SMESG000067619.1[more]
SMESG000015840.16.930e-1750.82SMESG000015840.1[more]
SMESG000055576.14.841e-1647.69SMESG000055576.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027918 ID=SMED30027918|Name=SMED30027918|organism=Schmidtea mediterranea sexual|type=transcript|length=1784bp
ATCACAATAACATTATTATCGTTACTTATTGCATTAATAATCAAAACAAT
TTCATTTTCCATTGCACTCGAATCATTTAATAATCACATTTCAGATCCGA
AACTACCAAAAAATAATAATAGTAATGAGAGTAAGCCACCACGAGGTTGT
TAATGGCTGAAACAATACATTTACAATGGCGTGAAATTCGGCACACTAGA
AGGATTCTGTGGCAATTAACAACAACAACCAATCAATCGATAAATCACTC
ACTCCTCCAGTCCAGCACTTGATTAATCAATAGATTATTATTTGTAATTA
TTTTCATTAAAATTATTATTTATTGCCGTCGACAACAATAGTAGCAACAC
ACGTACACACACACAGTCAATCATGCAAATGAATAAATGCAGCTAAATTC
ATCACCAACATCATCATCACTGTGTGATCATCATCGCCGCACTATTAACA
ATCAGCATTAATCATCATCAAAATCCACCAATCAATAACTGCTACCGATG
CGCGCCACGGACAAATGGCCCAAACGTACAATTGCATTATTTGAGCGCGT
GTGTGTATATCAGTTGAGGAATCGCTAGAAGGTGATCGACAAGTGTTAAA
TAATCACAATTTTGCCGGTTTGCTGTGCCACACACACACACTGACTAGCA
ACCTAATCTGACGCGCGTGTGGGTGTGTCACATAACCATATTTGGGGAAA
TCTCGGAGCTCAGTCACAAAATAAAGGTTACTAAAGAAAGATAATTGAAA
CAATGTGTAAAAATAAAGTAAATAAACAAAAATGATAATAAAACAAGTGC
GGCTGTGACGACGGCATTGCTGGTCAAATATAACTACAACACAACAGATG
GGGCCTGCGGCAGGCAGCGGCGGCGGCACATGAGCACCGATCATAATGTG
GGCCGCAGCATTATAACAATATAATAATAATAGGAATAAGAATATATAAT
GAAATTGGGAGGAGGAGCAGGAGGAGCACTTGGAGGAGGAATCGAATAAT
TATAAATGAAGGAATCGCTGCTAGATCTTTTTGATTTTCGAGCCACATAT
CATTGGATTCTGATGCTTGATTTGCTCCTGCCCGTGTGCCTGGTAATCGA
ATGTGCATGAATGCTTGTCCGAGTATCTGTGAACTGCGCAATAATGGCCT
CCGCATCGACAGTCGAATCCCGTAAGTCCAACCTTACGGCGACAAAACTC
GCAGCGCCGCGGTTTCTTCATGATTTGGGTTGTTCCACCGCTACCGTTGT
CACGCATGGAATTTTCAGGTGAAGCATCTGGATCATCTGGACCCAATTTA
TTGATGATGTCTGCCACAGCAGTCGGTTGATGCAGGGCCGCATCTTGTGA
GGTGAACATGTCGGCGATCGAATCAGCTTCGACACCATATTGCTCTGAAT
CTTTATTTTTACACGTCTTAGGCACTTTGTGTAGAGATTCGATGTCTGAT
TGAGCTAGGCGTTTGCGATTTTTTTCTTTACATTGATTAACGGTTGATTC
CACTAATTTTGCACGACTTTGATATAATTCATTAATACTGATTTGTGAAG
CGTATGGAGATTGATTTGATGACTGAGAACGAGGTGCTTCTTCTTGGTTG
GAAGATTTGAGGAAATTTTGATAACATTTTGAACACATATCCATATTTTG
AGCATTACCATAAAATCCGCATCCTTGTTTGCACAAATTCTGCTGGTTGG
AATTGTTATTCATTGACATGATGGTAAGTAAACTTAAATATTAGAAAGAA
ATCAAATATTGATCATTTTGTTATTAGATTGGCA
back to top

protein sequence of SMED30027918-orf-1

>SMED30027918-orf-1 ID=SMED30027918-orf-1|Name=SMED30027918-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=233bp
MSMNNNSNQQNLCKQGCGFYGNAQNMDMCSKCYQNFLKSSNQEEAPRSQS
SNQSPYASQISINELYQSRAKLVESTVNQCKEKNRKRLAQSDIESLHKVP
KTCKNKDSEQYGVEADSIADMFTSQDAALHQPTAVADIINKLGPDDPDAS
PENSMRDNGSGGTTQIMKKPRRCEFCRRKVGLTGFDCRCGGHYCAVHRYS
DKHSCTFDYQAHGQEQIKHQNPMICGSKIKKI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0002089reproductive organ
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR035896AN1-like_Znf
IPR002653Znf_A20
IPR000058Znf_AN1
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0008270zinc ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000058Zinc finger, AN1-typeSMARTSM00154AN1_Zf_4coord: 173..210
e-value: 1.4E-15
score: 67.7
IPR000058Zinc finger, AN1-typePFAMPF01428zf-AN1coord: 173..210
e-value: 2.6E-9
score: 37.1
IPR000058Zinc finger, AN1-typePROSITEPS51039ZF_AN1coord: 170..213
score: 12.062
IPR002653Zinc finger, A20-typeSMARTSM00259A20_3coord: 10..34
e-value: 1.1E-6
score: 38.2
IPR002653Zinc finger, A20-typePFAMPF01754zf-A20coord: 12..34
e-value: 2.4E-10
score: 40.1
IPR002653Zinc finger, A20-typePROSITEPS51036ZF_A20coord: 7..41
score: 9.448
IPR035896AN1-like Zinc fingerGENE3DG3DSA:4.10.1110.10coord: 149..228
e-value: 1.3E-23
score: 84.6
IPR035896AN1-like Zinc fingerSUPERFAMILYSSF118310AN1-like Zinc fingercoord: 163..226
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 145..165
NoneNo IPR availablePANTHERPTHR10634:SF5RE70963Pcoord: 5..232
NoneNo IPR availablePANTHERPTHR10634AN1-TYPE ZINC FINGER PROTEINcoord: 5..232
NoneNo IPR availableSUPERFAMILYSSF57716Glucocorticoid receptor-like (DNA-binding domain)coord: 12..57