SMED30027914

Overview
NameSMED30027914
Smed IDSMED30027914
Length (bp)3488
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30027914 (SMED30027914) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30027914 (SMED30027914) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30027914 (SMED30027914) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30027914 (SMED30027914) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027914

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30027914SMESG000040016.1 SMESG000040019.1 dd_Smed_v4_22578_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30027914SMESG000040016.1 SMESG000040019.1 dd_Smed_v6_22578_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30027914SMESG000040016.1 SMESG000040019.1 dd_Smed_v4_22578_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30027914SMESG000040016.1 SMESG000040019.1 dd_Smed_v4_22578_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30027914 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.001877:64400..67566 +14408
Homology
BLAST of SMED30027914 vs. Ensembl Zebrafish
Match: CR762475.1 (pep chromosome:GRCz11:4:55494751:55498830:1 gene:ENSDARG00000098243.2 transcript:ENSDART00000172605.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR762475.1)

HSP 1 Score: 55.4546 bits (132), Expect = 3.903e-7
Identity = 42/137 (30.66%), Postives = 66/137 (48.18%), Query Frame = -2
Query:  296 STGAM*FLKFFVEFYSDDVTGGLYDEWIQWRTFLKEIQSLPTKKTQMQMLKLMNELNLKTGFPNVYVALHIYLNLPV*NCSGERSFSYLKRNKNAVRSTMGQERLSSLTLMDIESEIVQSLDF*DIIGFLSIIKSRR 706
            +T A+  ++    FYS        +E  Q +T LK   +         ML ++ E + +  FP +   L +Y  LPV   + ERSFS ++  KN +RS   +ERLS L L+ IE +I   +D  ++I     +  RR
Sbjct:  773 NTEAVQAIQTLCNFYS-------VEEEQQLKTELKVFHTTFKSSGMKSMLSILKETSGQHVFPALVEMLKVYATLPVSTATVERSFSKMRLIKNQLRSLCSEERLSDLLLIAIEKDI--PVDHSEVINIFKHMAHRR 900          
BLAST of SMED30027914 vs. Ensembl Zebrafish
Match: si:ch211-240b21.2 (si:ch211-240b21.2 [Source:ZFIN;Acc:ZDB-GENE-060526-125])

HSP 1 Score: 49.2914 bits (116), Expect = 9.257e-6
Identity = 28/78 (35.90%), Postives = 44/78 (56.41%), Query Frame = -2
Query:  338 MQMLKLMNELNLKTGFPNVYVALHIYLNLPV*NCSGERSFSYLKRNKNAVRSTMGQERLSSLTLMDIESEIVQSL-DF 568
            + +L+L  E NL+  F      + I +  P+     ER FS LKR K  +R++M QERL++L ++ IE  +V  + DF
Sbjct:  135 LDLLQLFMENNLEEVFSETVTLVKILVTTPMTTAEAERCFSTLKRIKTFLRNSMTQERLNALAMLSIEKRLVTEMTDF 212          
BLAST of SMED30027914 vs. Ensembl Xenopus
Match: ENSXETT00000043220.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:7:36411169:36451375:1 gene:ENSXETG00000018966.1 transcript:ENSXETT00000043220.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 88.5817 bits (218), Expect = 1.318e-30
Identity = 61/205 (29.76%), Postives = 100/205 (48.78%), Query Frame = -1
Query:  825 KFVGLMPKEVIKITLVEVKLAKYFSFSVDSTPDISHTDQLTFTVRYAKIDGQPVQ-----------TSLHLFDTILETYRALEIDINDCRSQI---------------IRQYQQYVWTIFWCTSAYG*NQQNSFLESLYGTFN*PSGVVKFDACTKAVTFFGVFQKIYVFLSDSTYRWTLVKNAVSKTSSEKSALLQNI*VTHGS 1361
            +F+ ++   V+++ + E K AKY+S SVDSTPD+SHTDQL F + Y K DG P +            + +LF  +++T +   IDI DCR Q                 R  Q     ++   SA+  N        L GT          ++C +AV+FF + Q++Y F S S+ RW ++ + + +    K+ +++N+  T  S
Sbjct:  225 EFIDIVASSVLEVIINEAKQAKYYSISVDSTPDVSHTDQLAFIICYVKNDGIPKERFIKFIPNVGHKAENLFSAVMDTLKEYHIDILDCRGQSYDNASNMSGPYSGLQARIKQVNPLAVYIPCSAHSLN--------LVGT-------SAAESCREAVSFFCILQQLYHFFSASSTRWEMLISHLKR----KATVVKNLSTTRWS 410          

HSP 2 Score: 67.0106 bits (162), Expect = 1.318e-30
Identity = 43/111 (38.74%), Postives = 64/111 (57.66%), Query Frame = -2
Query: 1379 RLEQHEQSADNRCSLIVYTTRLSKVQTLDKIICKQADKRKHYWREVLRRVVSKIKFLTXXXXXXXXXSETFCRKDNGNLLGCLEYVAEYDSFIGGHINKCRNAGRATT*YL 1711
            RL +HE+S  ++   +    R      +D++  ++ ++   YWR VL+RVV+ +K L+SRGL  RG+ E F    NGN L  LE +AE+D F+  HI K  N G  +T YL
Sbjct:  108 RLNEHEESKFHKDCYLRMQNRAKISGRIDQLFLEKQNQEMEYWRNVLKRVVTAVKTLSSRGLPFRGTDEKFGSLTNGNYLMLLEAIAEHDPFLAEHIKKYGNTGTGSTSYL 218          

HSP 3 Score: 76.2554 bits (186), Expect = 2.334e-13
Identity = 43/124 (34.68%), Postives = 72/124 (58.06%), Query Frame = -2
Query:  296 YSDDVTGG-LYDEWIQWRTFLKEIQSLPTKKTQMQMLKLMNELNLKTGFPNVYVALHIYLNLPV*NCSGERSFSYLKRNKNAVRSTMGQERLSSLTLMDIESEIVQSLDF*DIIGFLSIIKSRR 664
            YS D+    L  E   +R  ++ I       T + + +++ + +L   +PN+  A  I+L  PV   S +RSFS LK  KN +RS+M QERLS+L+++ IE E+ + +DF D+I   + +K+R+
Sbjct:  596 YSKDLDASELCSEIESFRHQVEAILPDAKSATPLDLCQMIQDYSLADCYPNIDTAFRIFLTSPVTVASCKRSFSKLKLIKNYLRSSMEQERLSNLSILSIEHEMARKIDFDDVIDHFAAMKARK 719          
BLAST of SMED30027914 vs. TrEMBL
Match: gnl|BL_ORD_ID|20206374 (tr|K7IYW1|K7IYW1_NASVI Uncharacterized protein OS=Nasonia vitripennis OX=7425 PE=4 SV=1)

HSP 1 Score: 97.0561 bits (240), Expect = 1.126e-38
Identity = 65/168 (38.69%), Postives = 90/168 (53.57%), Query Frame = -2
Query: 1379 LNESAFYSKSENREKMERHWLLYLQSSGLVILLCV*TF------FR*TVFDS*STMNRLEQHEQSADNRCSLIVYTTRLSKVQTLDKIICKQADKRKHYWREVLRRVVSKIKFLTXXXXXXXXXSETFCRKDNGNLLGCLEYVAEYDSFIGGHINKCRNAGRATT*YL 1864
            LN+S F  K +N E +ER WL Y  S+G +       F      F    F+      R+ +HEQS  ++ +L +Y+ R  +  +L+  +  Q    K+YW +VLRR+   IKFL SRGL+ RG +E F    NGN LG LE ++EYD F+  HIN   N G   T YL
Sbjct:  150 LNKSLFQLKLQNNEIVEREWLSYSPSTGRIYCFVCRLFSSEKDQFTFYGFNDWKHPERITEHEQSKAHKQTLTIYSKRRRETGSLENALTIQQKNEKNYWIQVLRRITDTIKFLASRGLAFRGENERFGSSQNGNYLGILELLSEYDPFLKEHINTYGNKGHGVTSYL 317          

HSP 2 Score: 95.5153 bits (236), Expect = 1.126e-38
Identity = 61/168 (36.31%), Postives = 89/168 (52.98%), Query Frame = -1
Query:  906 SIYEKFVGLMPKEVIKITLVEVKLAKYFSFSVDSTPDISHTDQLTFTVRYAKIDGQPVQTSL-----------HLFDTILETYRALEIDINDCRSQIIRQYQQYVWTIFWC-TSAYG*NQQNSFLESLYGTFN*PSGVVKFDACTKAVTFFGVFQKIYVFLSDSTYRW 1373
            +I E+F+GLM ++V+   + E+K AKY+SFSVDSTPDI+H DQLTFTVRY   D  P++  L           +L + +++ ++  +IDINDCR Q                T     N+   ++     + N   GV   +     V +F + Q +Y FLS STYRW
Sbjct:  320 NICEEFIGLMGEKVLACIISELKKAKYYSFSVDSTPDITHLDQLTFTVRYV-TDQGPIERFLMFVPIEGHNAEYLTEVVVKFFKDNDIDINDCRGQSYDNASNMSGRYSGLQTRIREINKYADYIPCAGHSLN-LVGVKAAECVNAVVKYFYIVQNLYTFLSGSTYRW 485          

HSP 3 Score: 83.1889 bits (204), Expect = 2.971e-12
Identity = 58/170 (34.12%), Postives = 89/170 (52.35%), Query Frame = -2
Query:  287 SFKVDTYYVIAAYKTIDECCFYLYADDERSTGAM*FLKFFVEFYSDDVTG-GLYDEWIQWRTFLKEIQSLPTKKTQMQMLKLMNELNLKTGFPNVYVALHIYLNLPV*NCSGERSFSYLKRNKNAVRSTMGQERLSSLTLMDIESEIVQSLDF*DIIGFLSIIKSRRKDF 793
            +FK  T      Y+ I ECC  L                    Y  D++   L  E + ++ +L++ +           L+L  E  L + FPN+ ++L I+L L + NC+GERSFS LK  K+  RSTM Q RL+ L+LM IES++++S+DF ++I   +  KSR+K F
Sbjct:  662 NFKFFTALPNMTYEGIKECCEKL-----------------ARKYDQDISAENLISECLHYKHYLRDTRKNEELFIPDLYLQLKKEF-LTSTFPNIEISLRIFLTLMITNCAGERSFSRLKLIKSDHRSTMSQSRLNHLSLMSIESDLLKSIDFDELISNFAAKKSRKKVF 813          
BLAST of SMED30027914 vs. TrEMBL
Match: gnl|BL_ORD_ID|20105096 (tr|K7J1G9|K7J1G9_NASVI Uncharacterized protein OS=Nasonia vitripennis OX=7425 PE=4 SV=1)

HSP 1 Score: 96.6709 bits (239), Expect = 1.509e-38
Identity = 65/168 (38.69%), Postives = 90/168 (53.57%), Query Frame = -2
Query: 1379 LNESAFYSKSENREKMERHWLLYLQSSGLVILLCV*TF------FR*TVFDS*STMNRLEQHEQSADNRCSLIVYTTRLSKVQTLDKIICKQADKRKHYWREVLRRVVSKIKFLTXXXXXXXXXSETFCRKDNGNLLGCLEYVAEYDSFIGGHINKCRNAGRATT*YL 1864
            LN+S F  K +N E +ER WL Y  S+G +       F      F    F+      R+ +HEQS  ++ +L +Y+ R  +  +L+  +  Q    K+YW +VLRR+   IKFL SRGL+ RG +E F    NGN LG LE ++EYD F+  HIN   N G   T YL
Sbjct:  150 LNKSLFQLKLQNNEIVEREWLSYSPSTGRIYCFVCRLFSSEKDQFTFYGFNDWKHPERITEHEQSKAHKQTLTIYSKRRRETGSLENALTIQQKNEKNYWIQVLRRITDTIKFLASRGLAFRGENERFRSSQNGNYLGILELLSEYDPFLKEHINTYGNKGHGVTSYL 317          

HSP 2 Score: 95.5153 bits (236), Expect = 1.509e-38
Identity = 61/168 (36.31%), Postives = 89/168 (52.98%), Query Frame = -1
Query:  906 SIYEKFVGLMPKEVIKITLVEVKLAKYFSFSVDSTPDISHTDQLTFTVRYAKIDGQPVQTSL-----------HLFDTILETYRALEIDINDCRSQIIRQYQQYVWTIFWC-TSAYG*NQQNSFLESLYGTFN*PSGVVKFDACTKAVTFFGVFQKIYVFLSDSTYRW 1373
            +I E+F+GLM ++V+   + E+K AKY+SFSVDSTPDI+H DQLTFTVRY   D  P++  L           +L + +++ ++  +IDINDCR Q                T     N+   ++     + N   GV   +     V +F + Q +Y FLS STYRW
Sbjct:  320 NICEEFIGLMGEKVLACIISELKKAKYYSFSVDSTPDITHLDQLTFTVRYV-TDQGPIERFLMFVPIEGHNAEYLTEVVVKFFKDNDIDINDCRGQSYDNASNMSGRYSGLQTRIREINKYADYIPCAGHSLN-LVGVKAAECVNAVVKYFYIVQNLYTFLSGSTYRW 485          

HSP 3 Score: 81.6481 bits (200), Expect = 6.178e-12
Identity = 44/91 (48.35%), Postives = 64/91 (70.33%), Query Frame = -2
Query:  287 LKLMNELNLKTGFPNVYVALHIYLNLPV*NCSGERSFSYLKRNKNAVRSTMGQERLSSLTLMDIESEIVQSLDF*DIIGFLSIIKSRRKDF 559
            L+L  E  L + FPN+ ++L I+L L + NC+GERSFS LK  K+  RSTM Q RL+ L+LM IES++++S+DF ++I   +  KSR+K F
Sbjct:  527 LQLKKEF-LTSTFPNIEISLRIFLTLMITNCAGERSFSRLKLIKSDHRSTMSQSRLNHLSLMSIESDLLKSIDFDELISNFAAKKSRKKVF 616          
BLAST of SMED30027914 vs. TrEMBL
Match: gnl|BL_ORD_ID|176071909 (tr|H3AS83|H3AS83_LATCH DUF4371 domain-containing protein OS=Latimeria chalumnae OX=7897 PE=4 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 1.410e-37
Identity = 68/187 (36.36%), Postives = 100/187 (53.48%), Query Frame = -1
Query:  867 YIIPMISIYEKFVGLMPKEVIKITLVEVKLAKYFSFSVDSTPDISHTDQLTFTVRYAKIDGQPVQ-----------TSLHLFDTILETYR-ALEIDINDCRSQIIRQYQQYVWTIFWCTSAYG*NQQNSFLESLYGTFN*PSGVVKFDACTKAVTFFGVFQKIYVFLSDSTYRWTLVKNAVSKTSSE 1391
            Y+ P  +I E+F+ L+  +V +  + E+K AKYFSFS+DS  DISHTDQLTF V Y   +  P++           T LHLF+ I ET    L I++NDCR Q         ++          N++  +   +  + N  SG    +    AVTFF   QK YVF S STYRW L+ +++++ +S+
Sbjct:  138 YLSP--TICEEFIKLVSNKVKQNIVDELKSAKYFSFSIDSMLDISHTDQLTFIVLYMLNNRTPMECFLKFVPITSHTGLHLFNVITETLSDELSINLNDCRGQTFVNNMSSTYSGVQ-ARVLEVNRKAVYNPCMSHSLN-LSGCAAAELSINAVTFFAFVQKHYVFSSGSTYRWGLLPDSLNEETSD 320          

HSP 2 Score: 90.1225 bits (222), Expect = 1.410e-37
Identity = 65/152 (42.76%), Postives = 88/152 (57.89%), Query Frame = -2
Query: 1379 NREKMERHWLLYLQSSGLVI-LLCV*TFFR*TVFDS*STMNRLEQHEQSADNRCSLIVYTTRLSKVQTLDKIICKQADKRKHYWREVLRRVVSKIKFLTXXXXXXXXXSETFCRKDNGNLLGCLEYVAEYDSFIGGHINKCRNAGRATT*YL 1831
            N E +ER WL+Y QS+  V    C         FDS   + RL   EQ  ++R +  +Y       QT+DK I  + +K+     EVL+RVVS IKFLT+R L+L+G+++TF   +N N LGCLE++AEYD F+  HI    NAG  TT YL
Sbjct:    1 NGETIERPWLIYSQSTDCVFCFTCKMAALANRGFDSWDHIGRLNDQEQYNEHRQAFTIY-------QTVDKHIADEYNKK----MEVLKRVVSAIKFLTTRSLALKGTNKTFGSLNNCNFLGCLEFLAEYDPFLARHIE--WNAGHGTTLYL 139          
BLAST of SMED30027914 vs. TrEMBL
Match: gnl|BL_ORD_ID|176316683 (tr|A0A3B4C7P4|A0A3B4C7P4_PYGNA TTF-type domain-containing protein OS=Pygocentrus nattereri OX=42514 PE=4 SV=1)

HSP 1 Score: 87.4261 bits (215), Expect = 2.198e-36
Identity = 61/166 (36.75%), Postives = 92/166 (55.42%), Query Frame = -2
Query: 1379 SAFYSKS-ENREKMERHWLLYLQSSGLVILLCV*TF------FR*TVFDS*STMNRLEQHEQSADNRCSLIVYTTRLSKVQTLDKIICKQADKRKHYWREVLRRVVSKIKFLTXXXXXXXXXSETFCRKDNGNLLGCLEYVAEYDSFIGGHINKCRNAGRATT*YL 1855
            +  +S+S  N EK+ R WL Y  S+G V       F      F     D   +++R+E HE    +R +++ +  R ++V+ +D  +  Q     +YW+EVLRRVV+ IKFL+ RGL+ RG +ET     NGN LG LE +A++D F+  H+ +  N GR T  YL
Sbjct:   33 AXLFSRSLRNGEKVAREWLSYSPSTGNVFCFFCKLFSNDSSAFTHGFSDWKHSVDRVEMHEAGQPHRKAVLTWLAR-TQVRGIDAGLQDQLKDEANYWKEVLRRVVAVIKFLSERGLAFRGENETLGSVHNGNYLGILELLAKFDPFLDEHLKRFGNKGRGTPSYL 197          

HSP 2 Score: 73.559 bits (179), Expect = 2.198e-36
Identity = 39/96 (40.62%), Postives = 57/96 (59.38%), Query Frame = -1
Query: 1119 SIYEKFVGLMPKEVIKITLVEVKLAKYFSFSVDSTPDISHTDQLTFTVRYAKIDGQ---------PV--QTSLHLFDTILETYRALEIDINDCRSQ 1373
            +I E+F+ LM + V    +++++ AKYFS  VDSTPD+SH DQLTF VRY   +G+         P+   T   LFD++    + + IDI +CR Q
Sbjct:  200 TICEEFIALMGQRVQSEIIMQLQHAKYFSLIVDSTPDLSHIDQLTFVVRYVSQEGKIFERFLKFLPIFSHTGESLFDSVTGVLQDMHIDIKNCRGQ 295          

HSP 3 Score: 44.2838 bits (103), Expect = 2.198e-36
Identity = 18/36 (50.00%), Postives = 23/36 (63.89%), Query Frame = -2
Query: 1007 YDNTSNMFGQYSGVQARMVEINRTVS*NPCMVHSIN 1114
            +DN SNM G Y G++AR+ EIN      PC  HS+N
Sbjct:  297 FDNASNMAGAYKGLRARIQEINPLADWIPCAAHSLN 332          

HSP 4 Score: 85.5001 bits (210), Expect = 4.284e-13
Identity = 50/112 (44.64%), Postives = 70/112 (62.50%), Query Frame = -2
Query:  332 YSDDVTGGLYDEWIQWRTFLKEIQSLPTKKTQ-MQMLKLMNELNLKTGFPNVYVALHIYLNLPV*NCSGERSFSYLKRNKNAVRSTMGQERLSSLTLMDIESEIVQSLDF*D 664
            Y +D+     DE  Q+  F K    + T+  Q M +L  + E NL+  FPNV +AL IYL LPV N +GERSFS L   K+ +R+TM +ERL++LTLM IE +++  +DF D
Sbjct:  559 YHEDLADDFPDELGQFVHFAK----VSTENRQPMNLLSFIRERNLQHVFPNVDIALRIYLTLPVSNANGERSFSKLGIIKHKLRTTMLEERLNNLTLMSIEHDMLAQMDFED 666          
BLAST of SMED30027914 vs. TrEMBL
Match: gnl|BL_ORD_ID|173681459 (tr|A0A3Q3FXS5|A0A3Q3FXS5_KRYMA TTF-type domain-containing protein OS=Kryptolebias marmoratus OX=37003 PE=4 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 4.381e-36
Identity = 66/170 (38.82%), Postives = 92/170 (54.12%), Query Frame = -2
Query: 1379 LNESAFYSKSENREKMERHWLLYLQSSGLVILLCV*TF--------FR*TVFDS*STMNRLEQHEQSADNRCSLIVYTTRLSKVQTLDKIICKQADKRKHYWREVLRRVVSKIKFLTXXXXXXXXXSETFCRKDNGNLLGCLEYVAEYDSFIGGHINKCRNAGRATT*YL 1864
             ++S F  K  N E ++R WLLY  S+G         F        F     D      R+++HE S  +R +++ + +  +    +D  + KQ +    YW EVLRRVVS +KFL  RGL+LRG+S+TF R DNGN LG LE ++E+D F+  HI K  NAG  T  YL
Sbjct:  158 FSKSYFKRKMANGEYIQRQWLLYSPSAGAAFCFACRIFSNANTQSSFETGFSDWKHATERMKEHENSEHHRKAMLTFVSLAAASGRIDTELQKQFESECAYWTEVLRRVVSVVKFLAERGLALRGASDTFGRTDNGNYLGILELISEFDPFLKSHIEKYGNAGAGTPSYL 327          

HSP 2 Score: 83.1889 bits (204), Expect = 4.381e-36
Identity = 58/202 (28.71%), Postives = 91/202 (45.05%), Query Frame = -1
Query:  843 EKFVGLMPKEVIKITLVEVKLAKYFSFSVDSTPDISHTDQLTFTVRYAKIDGQ---------PVQ--TSLHLFDTILETYRALEIDINDCRSQI-----------------IRQYQQYVWTIFWCTSAYG*NQQNSFLESLYGTFN*PSGVVKFDACTKAVTFFGVFQKIYVFLSDSTYRWTLVKNAVSKTSSEKSALLQNI 1364
            E+F+ LM   V+   + EVK+AKYFS SVDSTPD++H DQLTF +RY   +G          P++  T   L  ++L+    + IDI +CR Q                  I++    V  + W                   T N   GV   + C +   FF   Q ++ F S ST RW +V + +   ++++   L+++
Sbjct:  333 EEFIQLMGDRVLSEIVSEVKMAKYFSISVDSTPDVAHVDQLTFVLRYVSPEGHSQERFLKFLPIESHTGEALCASVLKVLEEMGIDIANCRGQCYDNAANMSGVYKGLQARIKELNPLVEWVPWAAH----------------TLN-LVGVNSVNCCFETADFFQFVQNLFNFCSKSTARWKVVTDGLQPNANKRIETLKSL 517          
BLAST of SMED30027914 vs. Ensembl Cavefish
Match: ENSAMXT00000042715.1 (pep primary_assembly:Astyanax_mexicanus-2.0:16:11855083:11857132:-1 gene:ENSAMXG00000035113.1 transcript:ENSAMXT00000042715.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 83.1889 bits (204), Expect = 3.905e-32
Identity = 54/156 (34.62%), Postives = 78/156 (50.00%), Query Frame = -2
Query: 1379 NREKMERHWLLYLQSSGLVILLCV*TFFR*T-----VFDS*STMNRLEQHEQSADNRCSLIVYTTRLSKVQTLDKIICKQADKRKHYWREVLRRVVSKIKFLTXXXXXXXXXSETFCRKDNGNLLGCLEYVAEYDSFIGGHINKCRNAGRATT*YL 1831
            N + + R WLLY  S+G V       F          F       R+ +HE S ++R  ++    R     T+D  I KQ D  + YWREVL+RVV+ I+FL  RGL+ RG  E      NGN LG +E +A++D F+  H+ +    G+ +  YL
Sbjct:   34 NGQTVTRQWLLYSPSTGCVYCFACKLFSSKHNTFVHGFSDWKHSERIGEHEGSVEHRACMLALYNRSRGTATIDSDIVKQIDAERQYWREVLKRVVAVIQFLGERGLAFRGDDELLGSAHNGNFLGIIELLAKFDPFLAEHLQRFGGKGKGSVSYL 189          

HSP 2 Score: 76.6406 bits (187), Expect = 3.905e-32
Identity = 60/189 (31.75%), Postives = 90/189 (47.62%), Query Frame = -1
Query:  855 SIYEKFVGLMPKEVIKITLVEVKLAKYFSFSVDSTPDISHTDQLTFTVRYAKIDGQPVQTSL-------HLFDTILETYRA----LEIDINDCRSQIIRQYQQYVWTIFWCTSAYG*NQQN---SFLESLYGTFN*PSGVVKFDACTKAVTFFGVFQKIYVFLSDSTYRWTLVKNAVSK--TSSEKSAL 1373
            ++ E+F+ LM +   +  + E+K +KYFS  VDSTPD++H DQLTF  R+   DG  V+  L       H  D++ E   A    L +D+++CR Q                +     Q+N    ++     + N   GV   D+  +A  FF   Q +Y F + ST+RW  V +   K  T SE SAL
Sbjct:  192 TVCEEFIHLMGQRTKQAIVNEIKESKYFSVIVDSTPDLAHVDQLTFIFRFVNNDGHVVERFLAFEPIENHSGDSLAECVVAMVENLGLDLSNCRGQSYDNASNMSGKYNGIQAHL--KQRNPLICYVPCAAHSLN-LVGVNAVDSSPEAGRFFDFVQAMYTFCASSTHRWGKVFHMEEKCVTRSEASAL 377          

HSP 3 Score: 110.923 bits (276), Expect = 1.932e-24
Identity = 57/124 (45.97%), Postives = 84/124 (67.74%), Query Frame = -2
Query:  293 YSDDVTGGLYDEWIQWRTFLKEIQSLPTKKTQMQMLKLMNELNLKTGFPNVYVALHIYLNLPV*NCSGERSFSYLKRNKNAVRSTMGQERLSSLTLMDIESEIVQSLDF*DIIGFLSIIKSRRK 664
            Y  D+   L DE IQ+++F+ E +  P+K     MLK M  LNL++ FPNVY+AL ++L +P+ NC GERSFS L R KN +R  M Q RL+SL+L+ IES++V+ L+F +++   +  KSR+K
Sbjct:  538 YPSDLNMSLADELIQYKSFITEKEKHPSK-----MLKTMINLNLQSTFPNVYIALRLFLTVPITNCEGERSFSKLARIKNELRIRMRQNRLNSLSLLAIESDLVRQLNFDELVDDFARKKSRKK 656          
BLAST of SMED30027914 vs. Ensembl Cavefish
Match: ENSAMXT00000035531.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000029.1:6285841:6288423:1 gene:ENSAMXG00000041958.1 transcript:ENSAMXT00000035531.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 76.6406 bits (187), Expect = 4.831e-27
Identity = 49/156 (31.41%), Postives = 74/156 (47.44%), Query Frame = -2
Query: 1379 NREKMERHWLLYLQSSGLVILLCV*TFFR*T-----VFDS*STMNRLEQHEQSADNRCSLIVYTTRLSKVQTLDKIICKQADKRKHYWREVLRRVVSKIKFLTXXXXXXXXXSETFCRKDNGNLLGCLEYVAEYDSFIGGHINKCRNAGRATT*YL 1831
            N + + R WLLY  S+G V       F          F       R+ +HE S ++R  ++    R     T+D  I KQ D  + YWR+VL+RVV+ I+FL       RG  E      NGN LG +E ++++D F+  H+ +    G+ +  YL
Sbjct:  198 NGQTVTRQWLLYSPSTGCVYCFACKLFSSKHNTFVHGFSDWKHSERIGEHEGSVEHRACMLALYNRSRGTATIDSDIVKQIDAERQYWRDVLKRVVAVIQFLG-----ERGLDELLGSAHNGNFLGIIELLSKFDPFLAEHLQRFGGKGKGSVSYL 348          

HSP 2 Score: 65.855 bits (159), Expect = 4.831e-27
Identity = 50/173 (28.90%), Postives = 81/173 (46.82%), Query Frame = -1
Query:  897 SIYEKFVGLMPKEVIKITLVEVKLAKYFSFSVDSTPDISHTDQLTFTVRYAKIDGQPVQTSL-------HLFDTILETYRA----LEIDINDCRSQIIRQYQQYVWTIFWCTSAYG*NQQNS---FLESLYGTFN*PSGVVKFDACTKAVTFFGVFQKIYVFLSDSTYRWTLV 1373
            ++ E+F+ LM +   +  + ++K +KYFS  VDSTPD++H DQ TF  R+   D   V+  L       H  D++ E   A    L +D+++CR Q                +     Q+NS   ++     + N   GV   D+  +A  FF   Q ++ F + ST+RW  V
Sbjct:  351 TVCEEFIHLMGQRTKQAIVNKIKESKYFSVIVDSTPDLAHVDQPTFIFRFVNNDAHVVERFLAFEPIENHSGDSLAECVVAMVENLGLDLSNCRGQSYDNASNMSGKYNGVQAHL--KQRNSLICYVPCAAHSLN-LVGVNAVDSSPEAGRFFDFVQAMFTFCASSTHRWRKV 520          

HSP 3 Score: 111.309 bits (277), Expect = 2.528e-24
Identity = 68/180 (37.78%), Postives = 103/180 (57.22%), Query Frame = -2
Query:  293 FKVDTYYVI------------AAYKTIDECCFYLYADDERSTGAM*FLK--FFVEFYSDDVTGGLYDEWIQWRTFLKEIQSLPTKKTQMQMLKLMNELNLKTGFPNVYVALHIYLNLPV*NCSGERSFSYLKRNKNAVRSTMGQERLSSLTLMDIESEIVQSLDF*DIIGFLSIIKSRRK 790
            F+++T+ V+             AY  + E    L+  D  S   +  LK       Y  D+   L DE IQ+++F+ E +  P+K     MLK M  LNL++ FPNVY+AL ++L +P+ NC GERSFS L R KN +R  M Q RL+SL+L+ IES++V+ L+F +++   +  KSR+K
Sbjct:  685 FRIETFNVVIDKLVSCLNHRLNAYTHLTELFDVLFMPDNMSNSEL-ILKANLLAAAYPSDLNMSLADELIQYKSFITEKEKHPSK-----MLKTMINLNLQSTFPNVYIALRLFLTVPITNCEGERSFSKLARIKNELRIRMRQNRLNSLSLLAIESDLVRQLNFDELVDDFARKKSRKK 858          
BLAST of SMED30027914 vs. Ensembl Cavefish
Match: ENSAMXT00000036272.1 (pep primary_assembly:Astyanax_mexicanus-2.0:20:11935414:11938921:1 gene:ENSAMXG00000041670.1 transcript:ENSAMXT00000036272.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 68.9366 bits (167), Expect = 1.975e-19
Identity = 48/177 (27.12%), Postives = 85/177 (48.02%), Query Frame = -1
Query:  897 KFVGLMPKEVIKITLVEVKLAKYFSFSVDSTPDISHTDQLTFTVRYAKIDGQP-------------VQTSLHLFDTILETYRALEIDINDCRSQI------IRQYQQYVWTIFWCTSAYG*NQQNSFLESLYGTFN*PSGVVKFDAC---TKAVTFFGVFQKIYVFLSDSTYRWTLV 1361
            + + ++  + I+  + ++K AKY++  +D TPDISH +Q++  VR  ++  +P               T L+L + +LE  RAL I   DCR Q       ++  +Q V            N + +F+     T N    +V  DA    T A+++FG  Q+++ F S +T RW ++
Sbjct:  310 EIIEIICSQTIQTIVAKIKQAKYYAIILDCTPDISHKEQMSLVVRIVELVPEPHIREYFLGYMNVVETTGLNLSNVVLEKLRALGIPFEDCRGQAYDNGANMKGKRQGVQARL-----LQLNPRAAFVPCAAHTMN----LVISDAAKSSTDAISYFGYLQRLFCFFSAATQRWDIL 477          

HSP 2 Score: 48.1358 bits (113), Expect = 1.975e-19
Identity = 47/162 (29.01%), Postives = 79/162 (48.77%), Query Frame = -2
Query: 1391 YSKSENREKMERHWLLY-LQSSGLVILLCV*-----TFFR*TVFDS*STMN-RLEQHEQSADNRCSLIVY---TTRLSKVQTLDKIICKQADKRKHYWREVLRRVVSKIKFLTXXXXXXXXXSETFCRKDNGNLLGCLEYVAEYDSFIGGHINKCRNAGRAT 1846
            Y    N+EK++R W++Y  QS+ +    C       T    T +   S +N  L  HE S D+   ++ +     RL K   +D+      +  +  W +VL+R+ S    L +R L  RGSS++   +DNGN L  +E +A++DS   GH+ + ++    T
Sbjct:  139 YKSLPNKEKIKRSWMVYSAQSNAVFCFPCKLFGTKSTRLTKTGYSDWSNINICLRSHEGSPDHTKCMLQWRELDRRLRKNLAIDQQELSLMEAERKRWHDVLKRLFSITLSLATRNLPFRGSSQSLYVQDNGNFLKEVELLAQFDSVTEGHVARIKDDASRT 300          

HSP 3 Score: 80.8777 bits (198), Expect = 4.757e-15
Identity = 50/126 (39.68%), Postives = 75/126 (59.52%), Query Frame = -2
Query:  296 DVTGGLYDEW---IQWRTFLKEIQSLP---TKKTQMQMLKLMNELNLKTGFPNVYVALHIYLNLPV*NCSGERSFSYLKRNKNAVRSTMGQERLSSLTLMDIESEIVQSLDF*DIIGFLSIIKSRR 655
            DV   L D+    I  +  ++EI +LP    + T  ++L  +++ +L+  +PN+++AL I L LPV   S ERSFS LK  K  +RSTMGQERLS L ++ I +E+  SL   D+I   +  K+RR
Sbjct:  693 DVEKKLTDKGEADIDGQEMMQEIINLPQLSPQTTAFELLTYLHDNSLQEVYPNLWIALRIALTLPVTVASAERSFSKLKLIKTYLRSTMGQERLSGLAVISINAEVAHSLSLDDLISDFAARKARR 818          
BLAST of SMED30027914 vs. Ensembl Cavefish
Match: ENSAMXT00000037907.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02002089.1:152797:155023:-1 gene:ENSAMXG00000037599.1 transcript:ENSAMXT00000037907.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 59.3066 bits (142), Expect = 9.713e-17
Identity = 45/188 (23.94%), Postives = 80/188 (42.55%), Query Frame = -1
Query:  876 HYIIPMISIYEKFVGLMPKEVIKITLVEVKLAKYFSFSVDSTPDISHTDQLTFTVRYAKID---GQPVQ------------TSLHLFDTILETYRALEIDINDCRSQIIRQYQQYVWTIFWCTSAYG*NQQNSFLESLYGTFN*PSGVVKFDACTKAVTFFGVFQKIYVFLSDSTYRWTLVKNAVSKT 1394
            HY+    +I  + + L+ ++     + +VK AKYFS  +D TPD SH +Q++  +R    +   G  +             +   L +T+ +  + ++++I DCR Q               +   G N             + P G V F  C     FFG+ Q++Y   S S +RW++++  V  T
Sbjct:  222 HYLSK--TIQNELISLVGQKTKDAIVQKVKDAKYFSVIMDCTPDTSHNEQMSLVLRIVNCESCSGASISEHFVGFFSVQDTSGRGLCNTLTKELKNMKLNIADCRGQ---------------SYDNGSNMMGHKQGVQKSAGDKPKGTVFF--CVVCDLFFGILQRLYNLFSSSVHRWSILQRHVKLT 390          

HSP 2 Score: 48.521 bits (114), Expect = 9.713e-17
Identity = 45/156 (28.85%), Postives = 71/156 (45.51%), Query Frame = -2
Query: 1415 FYSKSENREKMERHWLLYLQSSGLVILLCV*TFFR*TVFDS*ST--------MNRLEQHEQS---ADNRCSLIVYTTRLSKVQTLDKIICKQADKRKHYWREVLRRVVSKIKFLTXXXXXXXXXSETFCRKDNGNLLGCLEYVAEYDSFIGGHINK 1849
            ++ K  N EK+  +WL+Y  SS  V   C   F R + F   S+         + L  HE+S     N  +L     RL     +D    +       +W+ VLRR+++ +  L  R  +LRG SE      NGN LG +E +A++D  +  H+ +
Sbjct:   58 YHMKMNNGEKINWNWLVYSLSSDSVFCFCCTVFERESKFALSSSGFRSWINIHSHLRDHEKSKIHCANMQNLRELAERLKTGTAIDSACQELRALEVQHWKAVLRRILAIVCNLAERNQALRGHSEKLFEPHNGNFLGQIELMAQFDPVMSEHLRR 213          

HSP 3 Score: 56.6102 bits (135), Expect = 1.552e-7
Identity = 37/84 (44.05%), Postives = 52/84 (61.90%), Query Frame = -2
Query:  287 NLKTGFPNVYVALHIYLNLPV*NCSGERSFSYLKRNKNAVRSTMGQERLSSLTLMDIESEIVQSLDF*DIIGFLSIIKSRRKDF 538
            NL   + N+ +AL + L LP+   SGERSFS LK  K+ +RSTM QERL+ L ++ IE  + +SL+  DII   +  K+R   F
Sbjct:  627 NLLELYGNLSIALLLLLTLPITVASGERSFSSLKLIKHFLRSTMSQERLTGLAMISIEQRVRRSLNMEDIINAFAETKTRMVQF 710          
BLAST of SMED30027914 vs. Ensembl Cavefish
Match: ENSAMXT00000033195.1 (pep primary_assembly:Astyanax_mexicanus-2.0:16:11277158:11279506:-1 gene:ENSAMXG00000030798.1 transcript:ENSAMXT00000033195.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 78.1814 bits (191), Expect = 3.111e-14
Identity = 44/132 (33.33%), Postives = 77/132 (58.33%), Query Frame = -2
Query:  287 KFFVEFYSDDVTGGLYDEWIQWRTFLKEIQSLPTKKTQMQMLKLMNELNLKTGFPNVYVALHIYLNLPV*NCSGERSFSYLKRNKNAVRSTMGQERLSSLTLMDIESEIVQSLDF*DIIGFLSIIKSRRKDF 682
            +   + Y  D++    +E + + T      + P   + +++L  + E+ L++ F  + +AL I+  LP+    GER+FS LK  KN +RSTMGQ+RL+SL ++ IES++ + LDF D+I   +  K+R+  F
Sbjct:  650 RALAKIYHMDLSQEFENEVLHFCTIYD--ATFPKNLSSLELLNAIWEMQLQSIFGEICIALRIFCTLPITVAGGERAFSKLKLVKNYLRSTMGQDRLNSLAILSIESQLAKQLDFTDLISDFANKKTRQWAF 779          

HSP 2 Score: 59.3066 bits (142), Expect = 2.028e-8
Identity = 50/185 (27.03%), Postives = 76/185 (41.08%), Query Frame = -1
Query:  894 HYIIPMISIYEKFVGLMPKEVIKITLVEVKLAKYFSFSVDSTPDISHTDQLTFTVRYAKIDGQP-----------------VQTSLHLFDTILETYRALEIDINDCRSQIIRQYQQYVWTIFWCTSA-YG*NQQNSFLESLYGTFN*PSGVVKFDACTKAVTFFGVFQKIYVFLSDSTYRWTLVK 1394
            HY+ P      +F+ L  K V+   L E + A Y+S   DSTPDISHT+Q    VRY   D +                   +T   + + I+E  ++  I + +CR Q           +    +     N   +F      T N   GV   ++C +  TFFG   ++Y   S S  RW ++K
Sbjct:  254 HYLSP--DTQNEFIELCGKRVLSTILKEREDAIYYSVICDSTPDISHTEQNVILVRYVHQDKEDRGVWKIVERFIEFKDFHKKTGQEISEMIIEALQSNGIPLQECRGQGYDNGANMSGKVKGVQAQILKANPLATFSPCATHTLN-LVGVHAAESCPEVATFFGSVNRLYNLFSASPERWAILK 435          
BLAST of SMED30027914 vs. Ensembl Nematostella
Match: EDO40596 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6Q7])

HSP 1 Score: 60.4622 bits (145), Expect = 1.409e-10
Identity = 49/129 (37.98%), Postives = 68/129 (52.71%), Query Frame = -2
Query:  296 VEFYSDD-VTGGLYD-EWIQWRTFLKEIQSLPTKKTQMQMLKLMNELNLKTGF-PNVYVALHIYLNLPV*NCSGERSFSYLKRNKNAVRSTMGQERLSSLTLMDIESEIVQSLDF*DIIGFLSIIKSRR 673
            V+FY+DD V+  + D E + WR    E +S+P  ++ +  LK     N    F PNV+V L I   L V +   ERSFS +KR K  +R+TM  ER SSL L+ +     +SLD   II   +    RR
Sbjct:   35 VKFYTDDLVSPDVLDVELVHWRI---EEESIP--RSAVNALK-----NCDAEFYPNVHVLLRILCTLSVTSAESERSFSTMKRLKTYLRNTMSTERESSLALISVHYN--RSLDVDAIIDTFATRHPRR 151          
BLAST of SMED30027914 vs. Ensembl Nematostella
Match: EDO40662 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6J7])

HSP 1 Score: 58.9214 bits (141), Expect = 9.263e-9
Identity = 45/129 (34.88%), Postives = 65/129 (50.39%), Query Frame = -2
Query:  296 VEFYSDDVTGG--LYDEWIQWRTFLKEIQSLPTKKTQMQMLKLMNELNLKTGF-PNVYVALHIYLNLPV*NCSGERSFSYLKRNKNAVRSTMGQERLSSLTLMDIESEIVQSLDF*DIIGFLSIIKSRR 673
            V+FY+DD+     L  E ++WR+    ++     ++ +  LK     N    F PNV+V L I   LPV +   ERSFS +KR K  +R+TM  ER  SL L+ +     +SLD   II   +    RR
Sbjct:  181 VKFYTDDLESPDVLDVELVRWRSKWTRVEEESIPRSAVDALK-----NCDAEFYPNVHVLLRILCTLPVTSAESERSFSTMKRLKTYLRNTMSTEREPSLALISVHYN--RSLDVDAIIDTFATRHPRR 302          
BLAST of SMED30027914 vs. Ensembl Nematostella
Match: EDO32247 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SVL6])

HSP 1 Score: 50.0618 bits (118), Expect = 2.969e-7
Identity = 30/79 (37.97%), Postives = 43/79 (54.43%), Query Frame = -2
Query:  296 KTGFPNVYVALHIYLNLPV*NCSGERSFSYLKRNKNAVRSTMGQERLSSLTLMDIESEIVQSLDF*DIIGFLSIIKSRR 532
            K  F N+Y  L I + LP+ + S ERS S L+  K  +RSTM ++RL+ L LM    ++   LD   II   + +  RR
Sbjct:   45 KDAFVNIYFMLKILITLPISSASCERSISSLRNLKTYLRSTMTEDRLNGLALMYTHKDM--DLDLDRIIDLFAQLHPRR 121          
BLAST of SMED30027914 vs. Ensembl Nematostella
Match: EDO32811 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SU05])

HSP 1 Score: 48.9062 bits (115), Expect = 7.216e-7
Identity = 29/79 (36.71%), Postives = 43/79 (54.43%), Query Frame = -2
Query:  296 KTGFPNVYVALHIYLNLPV*NCSGERSFSYLKRNKNAVRSTMGQERLSSLTLMDIESEIVQSLDF*DIIGFLSIIKSRR 532
            K  + N+Y  L I + LP+ + S ERS S L+  K  +RSTM ++RL+ L LM    ++   LD   II   + +  RR
Sbjct:   45 KDAYVNIYFMLKILITLPISSASCERSISSLRNLKTYLRSTMTEDRLNGLALMYTHKDM--DLDLDRIIDLFAQLHPRR 121          
BLAST of SMED30027914 vs. Ensembl Nematostella
Match: EDO35148 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMD4])

HSP 1 Score: 48.9062 bits (115), Expect = 7.646e-7
Identity = 29/79 (36.71%), Postives = 43/79 (54.43%), Query Frame = -2
Query:  296 KTGFPNVYVALHIYLNLPV*NCSGERSFSYLKRNKNAVRSTMGQERLSSLTLMDIESEIVQSLDF*DIIGFLSIIKSRR 532
            K  + N+Y  L I + LP+ + S ERS S L+  K  +RSTM ++RL+ L LM    ++   LD   II   + +  RR
Sbjct:   45 KDAYVNIYFMLKILITLPISSASCERSISSLRNLKTYLRSTMTEDRLNGLALMYTHKDM--DLDLDRIIDLFAQLHPRR 121          
BLAST of SMED30027914 vs. Ensembl Medaka
Match: ENSORLT00000028133.1 (zinc finger MYM-type protein 1-like [Source:NCBI gene;Acc:111948955])

HSP 1 Score: 68.5514 bits (166), Expect = 2.477e-18
Identity = 55/188 (29.26%), Postives = 82/188 (43.62%), Query Frame = -1
Query:  876 IYEKFVGLMPKEVIKITLVEVKLAKYFSFSVDSTPDISHTDQLTFTVRYAKIDGQPV-------------QTSLHLFDTILETYRALEIDINDCRSQIIRQYQQYVWTIFWCTSAYG*NQ--QNSFLESLYGTFN*PSG-----VVKFDACTK---AVTFFGVFQKIYVFLSDSTYRWTLVKNAVSKT 1370
            +  + + L+  +++   + ++K AKYFS  +D T DISHT+QL+  +R   +  +P               T  HL   IL     L I   DCR Q    Y           +  G N+  Q   LE        P G     +V  DA  +   A+++FGV QK+Y   S S  RW ++K+ VS T
Sbjct:  339 VQNELIDLLSSKILSAIVDDIKKAKYFSIILDCTLDISHTEQLSVIIRVVSLMEKPQIREHFMGFLEAEESTGQHLASMILNRLEELGISFEDCRGQ---SYDNGA-------NMKGKNKGVQARLLEKNPRALFLPCGAHTLNLVVCDAAKRSVDAMSYFGVLQKLYTLFSASAQRWAILKSQVSIT 516          

HSP 2 Score: 44.669 bits (104), Expect = 2.477e-18
Identity = 40/147 (27.21%), Postives = 71/147 (48.30%), Query Frame = -2
Query: 1415 EKMERHWLLYLQSSGLVILLCV*TFFR*TV-FDS*STMN------RLEQHEQSADNRCSLIVY---TTRLSKVQTLDKIICKQADKRKHYWREVLRRVVSKIKFLTXXXXXXXXXSETFCRKDNGNLLGCLEYVAEYDSFIGGHINK 1825
            EK+ R WL+Y +    +   C   F    +   +  T N       L  HE+S ++   +  +   + R+   +T+DK      ++ +  WR VL R+++ ++ L  R L+LRG +ET     NGN L  +E +A +D  +  H+N+
Sbjct:  177 EKIARTWLMYSKVKNSLFCFCCKLFSNKNINLTTSGTANWKHASTYLTAHEKSPEHLNCMKAWKELSGRIRSGKTIDKQEMALLEEERVRWRAVLTRLIAIVQSLAVRNLALRGHTETLFTSSNGNFLKEVELMARFDPIMKDHLNR 323          

HSP 3 Score: 70.8626 bits (172), Expect = 6.665e-12
Identity = 40/114 (35.09%), Postives = 68/114 (59.65%), Query Frame = -2
Query:  287 RTFLKEIQSLP----TKKTQMQMLKLMNELNLKTGFPNVYVALHIYLNLPV*NCSGERSFSYLKRNKNAVRSTMGQERLSSLTLMDIESEIVQSLDF*DIIGFLSIIKSRRKDF 616
            R  ++EI++LP    T  + ++++  M++ +L   +PN + AL I L LPV     ERSFS LK  K+ +RSTM QERL++L ++ I   + + + + D+I   +  K+R+  F
Sbjct:  738 RELVQEIKNLPNLPSTTPSLLELISFMSDKDLSEIYPNFWTALRIALTLPVTVAQAERSFSKLKLIKSYLRSTMSQERLTNLAVVSINHSVGEQISYDDVIDEFASRKARKVRF 851          
BLAST of SMED30027914 vs. Ensembl Medaka
Match: ENSORLT00000042294.1 (zinc finger MYM-type protein 1-like [Source:NCBI gene;Acc:110016639])

HSP 1 Score: 68.5514 bits (166), Expect = 2.477e-18
Identity = 55/188 (29.26%), Postives = 82/188 (43.62%), Query Frame = -1
Query:  876 IYEKFVGLMPKEVIKITLVEVKLAKYFSFSVDSTPDISHTDQLTFTVRYAKIDGQPV-------------QTSLHLFDTILETYRALEIDINDCRSQIIRQYQQYVWTIFWCTSAYG*NQ--QNSFLESLYGTFN*PSG-----VVKFDACTK---AVTFFGVFQKIYVFLSDSTYRWTLVKNAVSKT 1370
            +  + + L+  +++   + ++K AKYFS  +D T DISHT+QL+  +R   +  +P               T  HL   IL     L I   DCR Q    Y           +  G N+  Q   LE        P G     +V  DA  +   A+++FGV QK+Y   S S  RW ++K+ VS T
Sbjct:  339 VQNELIDLLSSKILSAIVDDIKKAKYFSIILDCTLDISHTEQLSVIIRVVSLMEKPQIREHFMGFLEAEESTGQHLASMILNRLEELGISFEDCRGQ---SYDNGA-------NMKGKNKGVQARLLEKNPRALFLPCGAHTLNLVVCDAAKRSVDAMSYFGVLQKLYTLFSASAQRWAILKSQVSIT 516          

HSP 2 Score: 44.669 bits (104), Expect = 2.477e-18
Identity = 40/147 (27.21%), Postives = 71/147 (48.30%), Query Frame = -2
Query: 1415 EKMERHWLLYLQSSGLVILLCV*TFFR*TV-FDS*STMN------RLEQHEQSADNRCSLIVY---TTRLSKVQTLDKIICKQADKRKHYWREVLRRVVSKIKFLTXXXXXXXXXSETFCRKDNGNLLGCLEYVAEYDSFIGGHINK 1825
            EK+ R WL+Y +    +   C   F    +   +  T N       L  HE+S ++   +  +   + R+   +T+DK      ++ +  WR VL R+++ ++ L  R L+LRG +ET     NGN L  +E +A +D  +  H+N+
Sbjct:  177 EKIARTWLMYSKVKNSLFCFCCKLFSNKNINLTTSGTANWKHASTYLTAHEKSPEHLNCMKAWKELSGRIRSGKTIDKQEMALLEEERVRWRAVLTRLIAIVQSLAVRNLALRGHTETLFTSSNGNFLKEVELMARFDPIMKDHLNR 323          

HSP 3 Score: 70.8626 bits (172), Expect = 6.665e-12
Identity = 40/114 (35.09%), Postives = 68/114 (59.65%), Query Frame = -2
Query:  287 RTFLKEIQSLP----TKKTQMQMLKLMNELNLKTGFPNVYVALHIYLNLPV*NCSGERSFSYLKRNKNAVRSTMGQERLSSLTLMDIESEIVQSLDF*DIIGFLSIIKSRRKDF 616
            R  ++EI++LP    T  + ++++  M++ +L   +PN + AL I L LPV     ERSFS LK  K+ +RSTM QERL++L ++ I   + + + + D+I   +  K+R+  F
Sbjct:  738 RELVQEIKNLPNLPSTTPSLLELISFMSDKDLSEIYPNFWTALRIALTLPVTVAQAERSFSKLKLIKSYLRSTMSQERLTNLAVVSINHSVGEQISYDDVIDEFASRKARKVRF 851          
BLAST of SMED30027914 vs. Ensembl Medaka
Match: ENSORLT00000045044.1 (zinc finger MYM-type protein 1-like [Source:NCBI gene;Acc:111948193])

HSP 1 Score: 68.5514 bits (166), Expect = 2.477e-18
Identity = 55/188 (29.26%), Postives = 82/188 (43.62%), Query Frame = -1
Query:  876 IYEKFVGLMPKEVIKITLVEVKLAKYFSFSVDSTPDISHTDQLTFTVRYAKIDGQPV-------------QTSLHLFDTILETYRALEIDINDCRSQIIRQYQQYVWTIFWCTSAYG*NQ--QNSFLESLYGTFN*PSG-----VVKFDACTK---AVTFFGVFQKIYVFLSDSTYRWTLVKNAVSKT 1370
            +  + + L+  +++   + ++K AKYFS  +D T DISHT+QL+  +R   +  +P               T  HL   IL     L I   DCR Q    Y           +  G N+  Q   LE        P G     +V  DA  +   A+++FGV QK+Y   S S  RW ++K+ VS T
Sbjct:  339 VQNELIDLLSSKILSAIVDDIKKAKYFSIILDCTLDISHTEQLSVIIRVVSLMEKPQIREHFMGFLEAEESTGQHLASMILNRLEELGISFEDCRGQ---SYDNGA-------NMKGKNKGVQARLLEKNPRALFLPCGAHTLNLVVCDAAKRSVDAMSYFGVLQKLYTLFSASAQRWAILKSQVSIT 516          

HSP 2 Score: 44.669 bits (104), Expect = 2.477e-18
Identity = 40/147 (27.21%), Postives = 71/147 (48.30%), Query Frame = -2
Query: 1415 EKMERHWLLYLQSSGLVILLCV*TFFR*TV-FDS*STMN------RLEQHEQSADNRCSLIVY---TTRLSKVQTLDKIICKQADKRKHYWREVLRRVVSKIKFLTXXXXXXXXXSETFCRKDNGNLLGCLEYVAEYDSFIGGHINK 1825
            EK+ R WL+Y +    +   C   F    +   +  T N       L  HE+S ++   +  +   + R+   +T+DK      ++ +  WR VL R+++ ++ L  R L+LRG +ET     NGN L  +E +A +D  +  H+N+
Sbjct:  177 EKIARTWLMYSKVKNSLFCFCCKLFSNKNINLTTSGTANWKHASTYLTAHEKSPEHLNCMKAWKELSGRIRSGKTIDKQEMALLEEERVRWRAVLTRLIAIVQSLAVRNLALRGHTETLFTSSNGNFLKEVELMARFDPIMKDHLNR 323          

HSP 3 Score: 70.8626 bits (172), Expect = 6.665e-12
Identity = 40/114 (35.09%), Postives = 68/114 (59.65%), Query Frame = -2
Query:  287 RTFLKEIQSLP----TKKTQMQMLKLMNELNLKTGFPNVYVALHIYLNLPV*NCSGERSFSYLKRNKNAVRSTMGQERLSSLTLMDIESEIVQSLDF*DIIGFLSIIKSRRKDF 616
            R  ++EI++LP    T  + ++++  M++ +L   +PN + AL I L LPV     ERSFS LK  K+ +RSTM QERL++L ++ I   + + + + D+I   +  K+R+  F
Sbjct:  738 RELVQEIKNLPNLPSTTPSLLELISFMSDKDLSEIYPNFWTALRIALTLPVTVAQAERSFSKLKLIKSYLRSTMSQERLTNLAVVSINHSVGEQISYDDVIDEFASRKARKVRF 851          
BLAST of SMED30027914 vs. Planmine SMEST
Match: SMESG000049344.1 (SMESG000049344.1)

HSP 1 Score: 179.104 bits (453), Expect = 2.931e-52
Identity = 94/120 (78.33%), Postives = 99/120 (82.50%), Query Frame = -2
Query:  326 LKFFVEFYSDDVTGGLYDEWIQWRTFLKEIQSLPTKKTQMQMLKLMNELNLKTGFPNVYVALHIYLNLPV*NCSGERSFSYLKRNKNAVRSTMGQERLSSLTLMDIESEIVQSLDF*DII 685
            LK FVEFYSDD       +WIQWRTFLKEI+SL TKKT MQ+LKLMNELNLKTGF  VYVAL IYL LPV NCS ERSF +LKRNKNAVRSTMGQERL SLTLMD+ESEI QSL F DII
Sbjct:    4 LKLFVEFYSDD-------DWIQWRTFLKEIRSLSTKKTPMQILKLMNELNLKTGFSYVYVALFIYLTLPVSNCSNERSFRHLKRNKNAVRSTMGQERLISLTLMDVESEIGQSLGFQDII 116          
BLAST of SMED30027914 vs. Planmine SMEST
Match: SMESG000040018.1 (SMESG000040018.1)

HSP 1 Score: 171.785 bits (434), Expect = 2.746e-48
Identity = 87/119 (73.11%), Postives = 93/119 (78.15%), Query Frame = -2
Query:  476 KSFKVDTYYVI------------AAYKTIDECCFYLYADDERSTGAM*FLKFFVEFYSDDVTGGLYDEWIQWRTFLKEIQSLPTKKTQMQMLKLMNELNLKTGFPNVYVALHIYLNLPV 796
            + FKV TY+VI            A YK IDE  ++LYADDERST AM  LK F+EFYS DVTG   D+WIQWRTFLKEIQSLPTKKTQMQMLKLMNELNLKTGFPNVYVALHIYLNLPV
Sbjct:   94 EKFKVHTYFVIIDSFVINLSRRIAVYKAIDERRYFLYADDERSTAAMESLKLFMEFYSYDVTGSFCDQWIQWRTFLKEIQSLPTKKTQMQMLKLMNELNLKTGFPNVYVALHIYLNLPV 212          
BLAST of SMED30027914 vs. Planmine SMEST
Match: SMESG000040019.1 (SMESG000040019.1)

HSP 1 Score: 168.703 bits (426), Expect = 1.583e-47
Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = -1
Query:    3 MSIFNSSRFGYSDCSFVSLLTISEHDDLLYEENIAKSQVSFAQFINNVTHFGDDINIRVYIQQEFNILGLDDFYIKLEERSG 248
            MSIFNSSRFGYSDCSFVSLLTISEHDDLLYEENIAKSQVSFAQFINNVTHFGDDINIRVYIQQEFNILGLDDFYIKLEERSG
Sbjct:    1 MSIFNSSRFGYSDCSFVSLLTISEHDDLLYEENIAKSQVSFAQFINNVTHFGDDINIRVYIQQEFNILGLDDFYIKLEERSG 82          
BLAST of SMED30027914 vs. Planmine SMEST
Match: SMESG000033201.1 (SMESG000033201.1)

HSP 1 Score: 142.124 bits (357), Expect = 3.202e-38
Identity = 94/184 (51.09%), Postives = 107/184 (58.15%), Query Frame = -1
Query:  852 MPKEVIKITLVEVKLAKYFSFSVDSTPDISHTDQLTFTVRYAKIDGQPVQ----------TSLHLFDTILETYRALEIDINDCRSQ-------IIRQYQQYVWTIFWCTSAYG*NQQNSFLESLYGTFN*PSGVVKFDACTKAVTFFGVFQKIYVFLSDSTYRWTLVKNAVSKT--SSEKSALL 1346
            M K+VI I + EVKLAKYFSFS+ S  DISHTDQLTFTV Y KIDGQ V+          TSLH FDTILET+RALEIDINDCR Q       + +QY      I             SFL  +  + N  SGVV  DACT+AVT F V QKIYVF         L KNA+S+    +E  ALL
Sbjct:    1 MAKQVINIIVDEVKLAKYFSFSIYSNSDISHTDQLTFTVHYVKIDGQSVERFLKFQISSHTSLHQFDTILETFRALEIDINDCRGQTYDNASNMSKQYSGVQARIIEIN--------RSFL-CMEHSLN-LSGVVAVDACTEAVTCFEVVQKIYVFCLIQHIDGLLSKNAISQNIIRTENLALL 174          
BLAST of SMED30027914 vs. Planmine SMEST
Match: SMESG000035231.1 (SMESG000035231.1)

HSP 1 Score: 68.1662 bits (165), Expect = 4.964e-20
Identity = 38/55 (69.09%), Postives = 40/55 (72.73%), Query Frame = -1
Query:  846 SGVVKFDACTKAVTFFGVFQKIYVFLSDSTYRWTLVKNAVSKT--SSEKSALLQN 1004
            SGVV  D CT+AV  FGV QKIYVFL DST RWTLVKNA SK    +EKSAL  N
Sbjct:   39 SGVVAVDVCTEAVRVFGVVQKIYVFLFDSTNRWTLVKNAASKNIIGTEKSALHPN 93          

HSP 2 Score: 50.447 bits (119), Expect = 4.964e-20
Identity = 26/42 (61.90%), Postives = 31/42 (73.81%), Query Frame = -2
Query: 1007 TAEVR*YDNTSNMFGQYSGVQARMVEINRTVS*NPCMVHSIN 1132
            TAEV      SNM G+YSG+QAR++EINRTVS  PC  HS+N
Sbjct:    2 TAEV------SNMSGKYSGLQARIIEINRTVSFIPCNAHSLN 37          
The following BLAST results are available for this feature:
BLAST of SMED30027914 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30027914 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30027914 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30027914 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CR762475.13.903e-730.66pep chromosome:GRCz11:4:55494751:55498830:1 gene:E... [more]
si:ch211-240b21.29.257e-635.90si:ch211-240b21.2 [Source:ZFIN;Acc:ZDB-GENE-060526... [more]
back to top
BLAST of SMED30027914 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSXETT00000043220.11.318e-3029.76pep primary_assembly:Xenopus_tropicalis_v9.1:7:364... [more]
back to top
BLAST of SMED30027914 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30027914 vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30027914 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|202063741.126e-3838.69tr|K7IYW1|K7IYW1_NASVI Uncharacterized protein OS=... [more]
gnl|BL_ORD_ID|201050961.509e-3838.69tr|K7J1G9|K7J1G9_NASVI Uncharacterized protein OS=... [more]
gnl|BL_ORD_ID|1760719091.410e-3736.36tr|H3AS83|H3AS83_LATCH DUF4371 domain-containing p... [more]
gnl|BL_ORD_ID|1763166832.198e-3636.75tr|A0A3B4C7P4|A0A3B4C7P4_PYGNA TTF-type domain-con... [more]
gnl|BL_ORD_ID|1736814594.381e-3638.82tr|A0A3Q3FXS5|A0A3Q3FXS5_KRYMA TTF-type domain-con... [more]
back to top
BLAST of SMED30027914 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000042715.13.905e-3234.62pep primary_assembly:Astyanax_mexicanus-2.0:16:118... [more]
ENSAMXT00000035531.14.831e-2731.41pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000036272.11.975e-1927.12pep primary_assembly:Astyanax_mexicanus-2.0:20:119... [more]
ENSAMXT00000037907.19.713e-1723.94pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000033195.13.111e-1433.33pep primary_assembly:Astyanax_mexicanus-2.0:16:112... [more]
back to top
BLAST of SMED30027914 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30027914 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30027914 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO405961.409e-1037.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO406629.263e-934.88Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO322472.969e-737.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO328117.216e-736.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO351487.646e-736.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30027914 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSORLT00000028133.12.477e-1829.26zinc finger MYM-type protein 1-like [Source:NCBI g... [more]
ENSORLT00000042294.12.477e-1829.26zinc finger MYM-type protein 1-like [Source:NCBI g... [more]
ENSORLT00000045044.12.477e-1829.26zinc finger MYM-type protein 1-like [Source:NCBI g... [more]
back to top
BLAST of SMED30027914 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000049344.12.931e-5278.33SMESG000049344.1[more]
SMESG000040018.12.746e-4873.11SMESG000040018.1[more]
SMESG000040019.11.583e-47100.00SMESG000040019.1[more]
SMESG000033201.13.202e-3851.09SMESG000033201.1[more]
SMESG000035231.14.964e-2069.09SMESG000035231.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027914 ID=SMED30027914|Name=SMED30027914|organism=Schmidtea mediterranea sexual|type=transcript|length=3488bp
TCACCTGACCGTTCTTCAAGTTTTATATAAAAGTCATCCAAACCTAAAAT
GTTGAATTCTTGTTGTATGTAGACTCTTATATTTATATCATCACCGAAAT
GTGTCACATTATTAATAAATTGTGCAAAAGATACTTGAGATTTTGCAATA
TTTTCTTCGTACAGTAAATCGTCATGCTCGGATATTGTTAGCAAACTGAC
AAAACTACAGTCTGAATACCCGAATCTTGAAGAGTTGAATATGCTCATTG
AATTGGTGGAGATTTGATATGCGTTGTAGGATGTCGAAAATCTTTCCTGC
GCGACTTAATTATTGAAAGAAAACCGATAATATCCTAAAAGTCAAGGCTT
TGAACGATTTCAGATTCAATATCCATTAGTGTTAAGCTGCTTAGTCTTTC
CTGACCCATAGTTGATCTAACAGCATTTTTATTACGTTTGAGATAACTGA
AGGATCGTTCACCGCTGCAGTTTCAAACAGGCAAATTAAGATAAATGTGC
AGAGCAACATACACATTTGGAAACCCAGTCTTCAGATTCAATTCATTCAT
CAATTTCAACATTTGCATCTGTGTTTTCTTTGTCGGCAATGATTGGATTT
CTTTTAGAAATGTTCGCCACTGAATCCACTCATCATAGAGGCCGCCGGTG
ACATCATCAGAGTAAAATTCCACAAAGAATTTTAAAAATTACATTGCTCC
AGTGCTGCGTTCATCATCGGCATACAAGTAAAAACAACACTCGTCAATTG
TTTTATATGCTGCAATAACATAATAGGTATCGACTTTAAAACTTTTCATA
GACGGTTAAAACAACGATGAGCTGACTACCGTGTGTCACTCAAATATTTT
GAAGAAGCGCTGACTTTTCCGATGAAGTTTTGCTGACAGCATTTTTCACA
AGAGTCCATCTATATGTTGAATCAGACAAAAAAACATAAATTTTCTGAAA
AACACCAAAAAACGTAACTGCCTTAGTGCACGCATCAAATTTAACAACTC
CAGAAGGTTAATTGAATGTACCATACAAGGATTCTAGGAAACTGTTCTGT
TGATTTCAACCATACGCGCTTGTACACCAGAATATTGTCCAAACATATTG
CTGGTATTGTCGTATTATCTGACTTCTGCAGTCGTTTATGTCGATCTCCA
GGGCGCGATAAGTTTCAAGAATTGTATCGAATAGGTGAAGACTGGTCTGA
ACAGGTTGGCCATCAATTTTGGCGTAACGAACAGTGAAAGTCAATTGATC
AGTGTGAGATATATCAGGTGTAGAATCAACACTAAAAGAAAAATATTTTG
CCAGTTTTACTTCAACCAATGTAATTTTAATGACTTCTTTGGGCATAAGA
CCTACAAATTTTTCATAAATGCTGATCATAGGTATTATGTAGTGGCACGT
CCAGCATTTCTGCATTTGTTAATATGCCCACCAATAAATGAATCGTATTC
CGCTACATACTCCAAGCAGCCTAAAAGGTTTCCATTATCTTTCCTGCAAA
AAGTTTCTGAAGATCCTCTAAGTGATAATCCACGAGATGTAAGAAACTTT
ATTTTTGAAACAACTCTCCTTAAAACCTCTCTCCAATAGTGCTTCCGCTT
ATCAGCTTGCTTGCAAATTATTTTGTCCAAAGTTTGAACTTTAGATAAAC
GAGTGGTATAAACGATAAGTGAACATCTGTTATCAGCTGATTGTTCATGT
TGTTCAAGTCTATTCATGGTGCTTCAGCTGTCAAATACTGTTTATCGAAA
AAATGTTTACACGCAAAGCAAAATAACCAACCCAGATGATTGCAAATATA
AAAGCCAATGCCTTTCCATTTTTTCTCTATTTTCAGATTTTGAGTAAAAT
GCTGATTCATTAAGATTTTGTTACTATTGACTTATTTCCTGAACGAATTA
GCATATATGCAATCTCGATTTGCAACAGTTTTAGGCCCAATGTGCATCCA
ATAATTCATCATCTCACTACTTACATCACATAAACCTGGATCGGCTTCTG
GAATTGTGTCCCCATGTCTAGCAGTGTCCAACAATGGCAACATAATTTCG
GTTGAGTTTGATTCAGTCTGTACGAGTAATTCGTCCGAAGAACTACAATC
TTCATTAACAATATTTTCTTGCGGTGATTAGTTTACGGCTACTAGAAGAT
CTGCAAATAAGCTTGCTGCGAATTTTATTCATAAAGATTCACTGCATGGC
TCAGATTTATTAATTAAACAATCAATCGCTCCACGTTGCAACTCTCCTGC
TTTTTGAATTGACTTAATCTATACTACTGCACGATGTTATGTACCATGTC
AAACTGCTATGATTTGCAGATGTCGATTCGATGCGGAATCAAACGCGTGC
ATGCTTGTCGACTCGAGAAGTTTTCGTTTCGGATTGTTCATTTTTGCGCA
GTAAGCAGCTTTACGAGAGGATGACTTTCGGTACTGAGACTGTGTGACTA
TGGGTGTCCATTTTTTTATTAAAGCTGTACATGATACAGGACCATAACTC
ACCAGAATAATTCAAAACAGTAGAAATATGAGCATGTAAATGACTCTACA
GGGTCGAACCGGTCTCCAGTGAATATATTAATGCTCATAAATAAATCATA
ATGATCGACCCTGTAGAAATGCAAATAAGTACCAATATTTGTTTTTTATT
TTGTCAATTGATGAACTTCAAAGTAGCCCCCTATATTGGTAGGCCCGTTT
CAATTGAACCATGTGCAACATGATTAGTCTATGGTTAGTCTATCCCCACC
CCTATGACAAACTGATATAAGTTGATTATTTAACATAAAGTGTTAAATGT
TTTAGTGTTAGTGTTTTTATTTATAAGATCATAAGTTGAGATTCGAGGAA
CCTCAACAAACACATTTATTAAAAATATATATTAGCAGTAATTGATCAAA
ATAGTAAATATGTATCTTTACGCACATTAAACGGTTGTGGTACACATAAT
TTCAATTTGTTCATAAGTTTTTAATAATTAGTTCAATATTTGACAAAATT
AAGAGTATGACGCATCAAAATCACAATTGACTTCATGCTACGGAGAACAA
GTCATCAGCTGTATGAGTCATACTTTCCGTCAACCAATCAGAACTAAATG
TGCTGGATACCTAATACCTACCAAACTAACTCTGGAGCACCTTTTTTAAA
CACAAGTATTTTTGGTAATAAAGTGAATTATTCTGCGATTCTGATCAGAC
AAGAATCAAATTTCCTAGTTCAAAGTTACTTAGCTAATTTTTTAACCATC
ACTTTTTAAAAAGAGAAAGCAAAATTCCAGCAGAGATAAAGCGAATTTTA
GATACTGTATTTGGCAAATTTTCGAGTTATGTGATATTTATTGGACAAAT
AATTTAGTTTATAAATTCTTTTATGTTCAATGTTTTCAATTTTTATTCAA
ATAAAAAAACATTTCAAAATTTTAAAAGACTAATTTTAATGGTATTTGTT
TGAAAAAAAACCCAACCTCAAATTTTTTATCAACAATT
back to top

protein sequence of SMED30027914-orf-1

>SMED30027914-orf-1 ID=SMED30027914-orf-1|Name=SMED30027914-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=111bp
MNRLEQHEQSADNRCSLIVYTTRLSKVQTLDKIICKQADKRKHYWREVLR
RVVSKIKFLTSRGLSLRGSSETFCRKDNGNLLGCLEYVAEYDSFIGGHIN
KCRNAGRATT*
back to top

protein sequence of SMED30027914-orf-2

>SMED30027914-orf-2 ID=SMED30027914-orf-2|Name=SMED30027914-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=120bp
MQKCWTCHYIIPMISIYEKFVGLMPKEVIKITLVEVKLAKYFSFSVDSTP
DISHTDQLTFTVRYAKIDGQPVQTSLHLFDTILETYRALEIDINDCRSQI
IRQYQQYVWTIFWCTSAYG*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000096ventral epidermis
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR025398DUF4371
IPR010472FH3_dom
IPR016024ARM-type_fold
Vocabulary: biological process
TermDefinition
GO:0016043cellular component organization
Vocabulary: molecular function
TermDefinition
GO:0003779actin binding
GO:0005488binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePANTHERPTHR45749FAMILY NOT NAMEDcoord: 18..99
NoneNo IPR availablePANTHERPTHR45749:SF3coord: 18..99