Mov10 like RISC complex RNA helicase 1

Overview
NameMov10 like RISC complex RNA helicase 1
Smed IDSMED30027909
Length (bp)3497
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Mov10 like RISC complex RNA helicase 1 (SMED30027909) t-SNE clustered cells

Violin plots show distribution of expression levels for Mov10 like RISC complex RNA helicase 1 (SMED30027909) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Mov10 like RISC complex RNA helicase 1 (SMED30027909) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Mov10 like RISC complex RNA helicase 1 (SMED30027909) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of Mov10 like RISC complex RNA helicase 1 vs. Ensembl Human
Match: MOV10L1 (Mov10 like RISC complex RNA helicase 1 [Source:HGNC Symbol;Acc:HGNC:7201])

HSP 1 Score: 486.108 bits (1250), Expect = 3.313e-151
Identity = 302/712 (42.42%), Postives = 419/712 (58.85%), Query Frame = 1
Query: 1450 PHKLKLYPIPEQLEQRVVNKEDIMGLYAVLKEKLGPGNYSKKMDLLVHLEEVNAKEEMKELVLENVRLMRRRDTFGIEVPGLSEGRPSLMXXXXXXXXXXXX--XXXTFSGSIEDILCEVIFVKFHATLESSYRNEECTVSFSHSRLPFRRMHLGIELACGTLGDGILFPGKIDMKSSQCV-RLSRAGLNELSGVNLMKEN------------ELRLV----------------------------QLKFYNESLNELQRVAVVRILHGYSRPLPYVLFGPPGTGKTVTLVEAILQVYKNVASSRILVCAPSNSAADLLCLRLDESGVLETGEMVRMNAYRRSILSELSDKEPIPARVLPYCKSVDDLAEVAMYRIIICTCTSSGALYRLGLKTGHITHVFVDEAGQASEPEIMISLGFTNRCNGQIILAGDPMQLGPVIRSPYAQQ--LQESYLHRLLLTCDLYKKQKEICAGSTTHFNPLIVTQLLQNYRAHPALLKLPSDMFYEGTLIPCV---VKNRFINWKWLPNPEVPLVFQGVRGKELRNPRNPSTYNPSEAVMVVRWIGRLLQDTDNIGKLKDKNISVITPYRAQVDCIRKLISSCLDNVNLAKLKVASVEEFQGQENEVVIISTVRSSLDESGNNGVHESFAILNMVGSRLGFLSNKRRFNVSITRACSLLIVIGDPGLLKYDECWSSLMKYAKTNNAFIGSE 3441
            P  L  YPIP++L + V  K DI+    +L E L   NY +K   L+ LEE+ A+ E+KE  +  + L R  D   +EVPGL+EGRPSL  GDK+ +K +     ++ +   + +I  E + +K +   E +Y  E   V F+++R   RR H  +E     LG  +LFP +I ++S Q     + A   + SG +  K+N            E R V                            +++F+N  LNE Q++AV RIL G  RPLPY+LFGPPGTGKTVT++EA+LQV+  +  SRILVCAPSNSAADL+CLRL ES VL+   MVR+NA  R        +E +   V PYC+  +D+ + + +RIII TC+SSG  Y++G++ GH THVFVDEAGQASEPE +I LG  +  +GQI+LAGDPMQLGPVI+S  A    L  S+L R L++   Y++ +        H NPL+VT+L++NYR+H ALL LPS +FY   L  C    V    + W+ LP    PL+F GVRG E R  ++PS +NP+EAV V+R+   L     +  ++   +I VITPYR QV+ IR L    L NV+L  +KV SVEEFQGQE  V+IISTVRS+ D   ++               LGFLSN +RFNV+ITR  +LLIV+G+P +L  D C+ +L++Y+ TN  ++G +
Sbjct:  492 PSFLPQYPIPDRLRKCVEQKIDILTFQPLLAELLNMSNYKEKFSTLLWLEEIYAEMELKEYNMSGIILRRNGDLLVLEVPGLAEGRPSLYAGDKLILKTQEYNGHAIEYISYVTEIHEEDVTLKINPEFEQAYNFEPMDVEFTYNRTTSRRCHFALEHVI-HLGVKVLFPEEIILQSPQVTGNWNHAQDTKSSGQSTSKKNRKTMTDQAEHGTEERRVGDKDLPVLAPFTAEMSDWVDEIQTPKARKMEFFNPVLNENQKLAVKRILSGDCRPLPYILFGPPGTGKTVTIIEAVLQVHFALPDSRILVCAPSNSAADLVCLRLHESKVLQPATMVRVNATCRF-------EEIVIDAVKPYCRDGEDIWKASRFRIIITTCSSSGLFYQIGVRVGHFTHVFVDEAGQASEPECLIPLGLMSDISGQIVLAGDPMQLGPVIKSRLAMAYGLNVSFLER-LMSRPAYQRDENAFGACGAH-NPLLVTKLVKNYRSHEALLMLPSRLFYHRELEVCADPTVVTSLLGWEKLPKKGFPLIFHGVRGSEAREGKSPSWFNPAEAVQVLRYCCLLAHSISS--QVSASDIGVITPYRKQVEKIRIL----LRNVDLMDIKVGSVEEFQGQEYLVIIISTVRSNEDRFEDDRYF------------LGFLSNSKRFNVAITRPKALLIVLGNPHVLVRDPCFGALLEYSITNGVYMGCD 1175          
BLAST of Mov10 like RISC complex RNA helicase 1 vs. Ensembl Human
Match: MOV10L1 (Mov10 like RISC complex RNA helicase 1 [Source:HGNC Symbol;Acc:HGNC:7201])

HSP 1 Score: 486.108 bits (1250), Expect = 3.313e-151
Identity = 302/712 (42.42%), Postives = 419/712 (58.85%), Query Frame = 1
Query: 1450 PHKLKLYPIPEQLEQRVVNKEDIMGLYAVLKEKLGPGNYSKKMDLLVHLEEVNAKEEMKELVLENVRLMRRRDTFGIEVPGLSEGRPSLMXXXXXXXXXXXX--XXXTFSGSIEDILCEVIFVKFHATLESSYRNEECTVSFSHSRLPFRRMHLGIELACGTLGDGILFPGKIDMKSSQCV-RLSRAGLNELSGVNLMKEN------------ELRLV----------------------------QLKFYNESLNELQRVAVVRILHGYSRPLPYVLFGPPGTGKTVTLVEAILQVYKNVASSRILVCAPSNSAADLLCLRLDESGVLETGEMVRMNAYRRSILSELSDKEPIPARVLPYCKSVDDLAEVAMYRIIICTCTSSGALYRLGLKTGHITHVFVDEAGQASEPEIMISLGFTNRCNGQIILAGDPMQLGPVIRSPYAQQ--LQESYLHRLLLTCDLYKKQKEICAGSTTHFNPLIVTQLLQNYRAHPALLKLPSDMFYEGTLIPCV---VKNRFINWKWLPNPEVPLVFQGVRGKELRNPRNPSTYNPSEAVMVVRWIGRLLQDTDNIGKLKDKNISVITPYRAQVDCIRKLISSCLDNVNLAKLKVASVEEFQGQENEVVIISTVRSSLDESGNNGVHESFAILNMVGSRLGFLSNKRRFNVSITRACSLLIVIGDPGLLKYDECWSSLMKYAKTNNAFIGSE 3441
            P  L  YPIP++L + V  K DI+    +L E L   NY +K   L+ LEE+ A+ E+KE  +  + L R  D   +EVPGL+EGRPSL  GDK+ +K +     ++ +   + +I  E + +K +   E +Y  E   V F+++R   RR H  +E     LG  +LFP +I ++S Q     + A   + SG +  K+N            E R V                            +++F+N  LNE Q++AV RIL G  RPLPY+LFGPPGTGKTVT++EA+LQV+  +  SRILVCAPSNSAADL+CLRL ES VL+   MVR+NA  R        +E +   V PYC+  +D+ + + +RIII TC+SSG  Y++G++ GH THVFVDEAGQASEPE +I LG  +  +GQI+LAGDPMQLGPVI+S  A    L  S+L R L++   Y++ +        H NPL+VT+L++NYR+H ALL LPS +FY   L  C    V    + W+ LP    PL+F GVRG E R  ++PS +NP+EAV V+R+   L     +  ++   +I VITPYR QV+ IR L    L NV+L  +KV SVEEFQGQE  V+IISTVRS+ D   ++               LGFLSN +RFNV+ITR  +LLIV+G+P +L  D C+ +L++Y+ TN  ++G +
Sbjct:  492 PSFLPQYPIPDRLRKCVEQKIDILTFQPLLAELLNMSNYKEKFSTLLWLEEIYAEMELKEYNMSGIILRRNGDLLVLEVPGLAEGRPSLYAGDKLILKTQEYNGHAIEYISYVTEIHEEDVTLKINPEFEQAYNFEPMDVEFTYNRTTSRRCHFALEHVI-HLGVKVLFPEEIILQSPQVTGNWNHAQDTKSSGQSTSKKNRKTMTDQAEHGTEERRVGDKDLPVLAPFTAEMSDWVDEIQTPKARKMEFFNPVLNENQKLAVKRILSGDCRPLPYILFGPPGTGKTVTIIEAVLQVHFALPDSRILVCAPSNSAADLVCLRLHESKVLQPATMVRVNATCRF-------EEIVIDAVKPYCRDGEDIWKASRFRIIITTCSSSGLFYQIGVRVGHFTHVFVDEAGQASEPECLIPLGLMSDISGQIVLAGDPMQLGPVIKSRLAMAYGLNVSFLER-LMSRPAYQRDENAFGACGAH-NPLLVTKLVKNYRSHEALLMLPSRLFYHRELEVCADPTVVTSLLGWEKLPKKGFPLIFHGVRGSEAREGKSPSWFNPAEAVQVLRYCCLLAHSISS--QVSASDIGVITPYRKQVEKIRIL----LRNVDLMDIKVGSVEEFQGQEYLVIIISTVRSNEDRFEDDRYF------------LGFLSNSKRFNVAITRPKALLIVLGNPHVLVRDPCFGALLEYSITNGVYMGCD 1175          
BLAST of Mov10 like RISC complex RNA helicase 1 vs. Ensembl Human
Match: MOV10L1 (Mov10 like RISC complex RNA helicase 1 [Source:HGNC Symbol;Acc:HGNC:7201])

HSP 1 Score: 468.003 bits (1203), Expect = 9.413e-145
Identity = 295/689 (42.82%), Postives = 403/689 (58.49%), Query Frame = 1
Query: 1450 PHKLKLYPIPEQLEQRVVNKEDIMGLYAVLKEKLGPGNYSKKMDLLVHLEEVNAKEEMKELVLENVRLMRRRDTFGIEVPGLSEGRPSLMXXXXXXXXXXXXXXXT--FSGSIEDILCEVIFVKFHATLESSYRNEECTVSFSHSRLPFRRMHLGIELACGTLGDGILFPGKIDMKSSQCV-RLSRAGLNELSGVNLMKEN------------ELRLV----------------------------QLKFYNESLNELQRVAVVRILHGYSRPLPYVLFGPPGTGKTVTLVEAILQVYKNVASSRILVCAPSNSAADLLCLRLDESGVLETGEMVRMNAYRRSILSELSDKEPIPARVLPYCKSVDDLAEVAMYRIIICTCTSSGALYRLGLKTGHITHVFVDEAGQASEPEIMISLGFTNRCNGQIILAGDPMQLGPVIRSPYAQQ--LQESYLHRLLLTCDLYKKQKEICAGSTTHFNPLIVTQLLQNYRAHPALLKLPSDMFYEGTLIPCV---VKNRFINWKWLPNPEVPLVFQGVRGKELRNPRNPSTYNPSEAVMVVRWIGRLLQDTDNIGKLKDKNISVITPYRAQVDCIRKLISSCLDNVNLAKLKVASVEEFQGQENEVVIISTVRSSLDESGNNGVHESFAILNMVGSRLGFLSNKRRFNVSITRACSLLIVIGDPGLL 3372
            P  L  YPIP++L + V  K DI+    +L E L   NY +K   L+ LEE+ A+ E+KE  +  + L R  D   +EVPGL+EGRPSL  GDK+ +K +  +     +   + +I  E + +K +   E +Y  E   V F+++R   RR H  +E     LG  +LFP +I ++S Q     + A   + SG +  K+N            E R V                            +++F+N  LNE Q++AV RIL G  RPLPY+LFGPPGTGKTVT++EA+LQV+  +  SRILVCAPSNSAADL+CLRL ES VL+   MVR+NA  R        +E +   V PYC+  +D+ + + +RIII TC+SSG  Y++G++ GH THVFVDEAGQASEPE +I LG  +  +GQI+LAGDPMQLGPVI+S  A    L  S+L R L++   Y++ +        H NPL+VT+L++NYR+H ALL LPS +FY   L  C    V    + W+ LP    PL+F GVRG E R  ++PS +NP+EAV V+R+   L     +  ++   +I VITPYR QV+ IR L    L NV+L  +KV SVEEFQGQE  V+IISTVRS+ D   ++               LGFLSN +RFNV+ITR  +LLIV+G+P +L
Sbjct:  472 PSFLPQYPIPDRLRKCVEQKIDILTFQPLLAELLNMSNYKEKFSTLLWLEEIYAEMELKEYNMSGIILRRNGDLLVLEVPGLAEGRPSLYAGDKLILKTQEYNGHAIEYISYVTEIHEEDVTLKINPEFEQAYNFEPMDVEFTYNRTTSRRCHFALEHVI-HLGVKVLFPEEIILQSPQVTGNWNHAQDTKSSGQSTSKKNRKTMTDQAEHGTEERRVGDKDLPVLAPFTAEMSDWVDEIQTPKARKMEFFNPVLNENQKLAVKRILSGDCRPLPYILFGPPGTGKTVTIIEAVLQVHFALPDSRILVCAPSNSAADLVCLRLHESKVLQPATMVRVNATCRF-------EEIVIDAVKPYCRDGEDIWKASRFRIIITTCSSSGLFYQIGVRVGHFTHVFVDEAGQASEPECLIPLGLMSDISGQIVLAGDPMQLGPVIKSRLAMAYGLNVSFLER-LMSRPAYQRDENAFGACGAH-NPLLVTKLVKNYRSHEALLMLPSRLFYHRELEVCADPTVVTSLLGWEKLPKKGFPLIFHGVRGSEAREGKSPSWFNPAEAVQVLRYCCLLAHSISS--QVSASDIGVITPYRKQVEKIRIL----LRNVDLMDIKVGSVEEFQGQEYLVIIISTVRSNEDRFEDDRYF------------LGFLSNSKRFNVAITRPKALLIVLGNPHVL 1132          
BLAST of Mov10 like RISC complex RNA helicase 1 vs. Ensembl Human
Match: MOV10L1 (Mov10 like RISC complex RNA helicase 1 [Source:HGNC Symbol;Acc:HGNC:7201])

HSP 1 Score: 434.106 bits (1115), Expect = 3.235e-132
Identity = 276/650 (42.46%), Postives = 379/650 (58.31%), Query Frame = 1
Query: 1450 PHKLKLYPIPEQLEQRVVNKEDIMGLYAVLKEKLGPGNYSKKMDLLVHLEEVNAKEEMKELVLENVRLMRRRDTFGIEVPGLSEGRPSLMXXXXXXXXXXXX--XXXTFSGSIEDILCEVIFVKFHATLESSYRNEECTVSFSHSRLPFRRMHLGIELACGTLGDGILFPGKIDMKSSQCV-RLSRAGLNELSGVNLMKEN------------ELRLV----------------------------QLKFYNESLNELQRVAVVRILHGYSRPLPYVLFGPPGTGKTVTLVEAILQVYKNVASSRILVCAPSNSAADLLCLRLDESGVLETGEMVRMNAYRRSILSELSDKEPIPARVLPYCKSVDDLAEVAMYRIIICTCTSSGALYRLGLKTGHITHVFVDEAGQASEPEIMISLGFTNRCNGQIILAGDPMQLGPVIRSPYAQQ--LQESYLHRLLLTCDLYKKQKEICAGSTTHFNPLIVTQLLQNYRAHPALLKLPSDMFYEGTLIPCV---VKNRFINWKWLPNPEVPLVFQGVRGKELRNPRNPSTYNPSEAVMVVRWIGRLLQDTDNIGKLKDKNISVITPYRAQVDCIRKLISSCLDNVNLAKLKVASVEEFQGQENEVVIIST---VRSSLDESGNNGVH 3246
            P  L  YPIP++L + V  K DI+    +L E L   NY +K   L+ LEE+ A+ E+KE  +  + L R  D   +EVPGL+EGRPSL  GDK+ +K +     ++ +   + +I  E + +K +   E +Y  E   V F+++R   RR H  +E     LG  +LFP +I ++S Q     + A   + SG +  K+N            E R V                            +++F+N  LNE Q++AV RIL G  RPLPY+LFGPPGTGKTVT++EA+LQV+  +  SRILVCAPSNSAADL+CLRL ES VL+   MVR+NA  R        +E +   V PYC+  +D+ + + +RIII TC+SSG  Y++G++ GH THVFVDEAGQASEPE +I LG  +  +GQI+LAGDPMQLGPVI+S  A    L  S+L R L++   Y++ +        H NPL+VT+L++NYR+H ALL LPS +FY   L  C    V    + W+ LP    PL+F GVRG E R  ++PS +NP+EAV V+R+   L     +  ++   +I VITPYR QV+ IR L    L NV+L  +KV SVEEFQGQE  V+IIST     + L+ S  NGV+
Sbjct:  492 PSFLPQYPIPDRLRKCVEQKIDILTFQPLLAELLNMSNYKEKFSTLLWLEEIYAEMELKEYNMSGIILRRNGDLLVLEVPGLAEGRPSLYAGDKLILKTQEYNGHAIEYISYVTEIHEEDVTLKINPEFEQAYNFEPMDVEFTYNRTTSRRCHFALEHVI-HLGVKVLFPEEIILQSPQVTGNWNHAQDTKSSGQSTSKKNRKTMTDQAEHGTEERRVGDKDLPVLAPFTAEMSDWVDEIQTPKARKMEFFNPVLNENQKLAVKRILSGDCRPLPYILFGPPGTGKTVTIIEAVLQVHFALPDSRILVCAPSNSAADLVCLRLHESKVLQPATMVRVNATCRF-------EEIVIDAVKPYCRDGEDIWKASRFRIIITTCSSSGLFYQIGVRVGHFTHVFVDEAGQASEPECLIPLGLMSDISGQIVLAGDPMQLGPVIKSRLAMAYGLNVSFLER-LMSRPAYQRDENAFGACGAH-NPLLVTKLVKNYRSHEALLMLPSRLFYHRELEVCADPTVVTSLLGWEKLPKKGFPLIFHGVRGSEAREGKSPSWFNPAEAVQVLRYCCLLAHSISS--QVSASDIGVITPYRKQVEKIRIL----LRNVDLMDIKVGSVEEFQGQEYLVIIISTDPCFGALLEYSITNGVY 1125          

HSP 2 Score: 51.9878 bits (123), Expect = 8.879e-6
Identity = 75/324 (23.15%), Postives = 129/324 (39.81%), Query Frame = 1
Query:  181 VQKDIKRESVKGLVTYLDGNKNGRIDGYVNFDSSSVIIFQCEEKNLSIGSEVFMDIIRNSKTSPWFASKIEVLSCHNKGNIEDWDDDNNLDVIKNNNKIEQLPQKQVGMITYACNDNLTFNNEIKFHQRDCGPNSFRPSKGDWVVVQYDHSVDYYS--IIGLSPLRYLDFEGV-ISSFDGNIGYVDREIFFNKSITK---GVRLSRGVYVYGTAIESVQNRRCN-FRALTIFC---KMSSNVNKGLQMRLKTMNKIENGIKTPHNLGLRLNPKAVEFGEQNINETRSKEVTITNENDFPMTLTGIALLS-ETNNQFVIENCGKE 1119
             + D K ++V+G+VT    +  G ID  + F S +V         L++G EV   +  N  ++   A ++E +S       + W+DD+      + +  +  P+  +G +T         +    F         F P KGDWV  +Y      +S     + PLRY   + V ISS  G  G ++  IFF     K   G    RG  V    +ES Q+  C  +RAL +     + ++ V++        + K +  I+           +   FG      +++  + I N+ D P  L    L   + + QF  +   K+
Sbjct:   31 AEGDTKLKTVRGVVTRYCSDY-GMIDDMIYFSSDAVT----SRVLLNVGQEVIAVVEENKVSNGLKAIRVEAVS-------DKWEDDSR----NHGSPSDCGPRVLIGCVTSLVEGAGCISQTTYFSLESVC-EGFEPCKGDWVEAEYRIRPGTWSSEATSVKPLRYKRVDKVCISSLCGRNGVLEESIFFTLDSLKLPDGYTPRRGDVVNAVVVESSQS--CYVWRALCMTLVKRRDAAPVHEATHFYGTILLKNKGDIEV---------TQVTHFGTLKEGRSKTMVIWIENKGDIPQNLVSCKLAGWDKSKQFRFQMLDKD 326          
BLAST of Mov10 like RISC complex RNA helicase 1 vs. Ensembl Human
Match: MOV10 (Mov10 RISC complex RNA helicase [Source:HGNC Symbol;Acc:HGNC:7200])

HSP 1 Score: 350.132 bits (897), Expect = 2.289e-103
Identity = 247/699 (35.34%), Postives = 364/699 (52.07%), Query Frame = 1
Query: 1450 PHKLKLYPIPEQLEQRVVNKEDIMGLYAVLKEKLGPGNYSKKMDLLVHLEEVNAKEEMKELVLENVRLM-----RRRDTFGIEVPGLSEGRPSLMX----XXXXXXXXXXXXXXTFSGSIEDILCEVIFVKFHATLESSYRNE-ECTVSFSHSRLPFRRMHLGIELACGTLGDGILFPGKIDMKSSQCVRLSRAGLNELSGVNLMKENELRLVQLKFYNESL--NELQRVAVVRILHGYSRPLPYVLFGPPGTGKTVTLVEAILQVYKNVASSRILVCAPSNSAADLLCLRLDESGVLETGEMVRMNAYRRSILSELSDKEPIPARVLPYCKSVDDLAEVAM--------YRIIICTCTSSGALYRLGLKTGHITHVFVDEAGQASEPEIMISLGF------TNRCNGQIILAGDPMQLGPVIRSPYAQQ--LQESYLHRLLLTCDLYKKQKEICAGSTTHFNPLIVTQLLQNYRAHPALLKLPSDMFYEGTLIPC---VVKNRFINWKWLPNPEVPLVFQGVRGKELRNPRNPSTYNPSEAVMVVRWIGRLLQDTDNIGK--LKDKNISVITPYRAQVD----CIRKLISSCLDNVNLAKLKVASVEEFQGQENEVVIISTVRSSLDESGNNGVHESFAILNMVGSRLGFLSNKRRFNVSITRACSLLIVIGDPGLLKYDECWSSLMKYAKTNNAFIG 3435
            P   +L P+  Q        ++I  + A L+  L   NY  K+ LL+HLEE+  + +++   LE+V +      +      +EVPG++E RPS++        ++ +   +D +T+ G +  +  + + + F  +L S + +     V+F+ +R P R  H  +EL    L   +LFP                       V L+  +    V+LK Y+ SL  N  Q  A+  I+ G +RP PY++FGPPGTGKTVTLVEAI QV K++  + IL CAPSNS ADLLC RL           V + +    +L+   D   +P  + P C       E           YR++I T  ++G L        H TH+F+DEAG   EPE ++++        T    GQ++LAGDP QLGPV+RSP  Q+  L  S L RLL    LYKK  +        ++P  +T+LL+NYR+HP +L +P+ ++YEG L  C   V + RF  W  LP    P++F GV GK+ R   +PS +NP EA  V  ++  LL  +   GK  L  +++ VI+PYR QV+    CI KL        ++  LKV SVEEFQGQE  V++ISTVRSS          +SF  L++    LGFL N +RFNV++TRA +LLI++G+P LL +D  W   +++ K N  + G
Sbjct:  242 PRLRQLLPMLLQGTSIFTAPKEIAEIKAQLETALKWRNYEVKLRLLLHLEELQMEHDIRHYDLESVPMTWDPVDQNPRLLTLEVPGVTESRPSVLRGDHLFALLSSETHQEDPITYKGFVHKVELDRVKLSFSMSLLSRFVDGLTFKVNFTFNRQPLRVQHRALELTGRWLLWPMLFPVAP------------------RDVPLLPSD----VKLKLYDRSLESNPEQLQAMRHIVTGTTRPAPYIIFGPPGTGKTVTLVEAIKQVVKHLPKAHILACAPSNSGADLLCQRL----------RVHLPSSIYRLLAPSRDIRMVPEDIKPCCNWDAKKGEYVFPAKKKLQEYRVLITTLITAGRLVSAQFPIDHFTHIFIDEAGHCMEPESLVAIAGLMEVKETGDPGGQLVLAGDPRQLGPVLRSPLTQKHGLGYSLLERLLTYNSLYKKGPD-------GYDPQFITKLLRNYRSHPTILDIPNQLYYEGELQACADVVDRERFCRWAGLPRQGFPIIFHGVMGKDEREGNSPSFFNPEEAATVTSYLKLLLAPSSKKGKARLSPRSVGVISPYRKQVEKIRYCITKLDRELRGLDDIKDLKVGSVEEFQGQERSVILISTVRSS----------QSFVQLDL-DFNLGFLKNPKRFNVAVTRAKALLIIVGNPLLLGHDPDWKVFLEFCKENGGYTG 890          
BLAST of Mov10 like RISC complex RNA helicase 1 vs. Ensembl Celegans
Match: smg-2 (Regulator of nonsense transcripts 1 [Source:UniProtKB/Swiss-Prot;Acc:O76512])

HSP 1 Score: 157.532 bits (397), Expect = 9.758e-39
Identity = 138/486 (28.40%), Postives = 226/486 (46.50%), Query Frame = 1
Query: 2083 LNELQRVAVVRILHGYSRPLPYVLFGPPGTGKTVTLVEAILQVYKNVASSRILVCAPSNSAADLLCLRLDESGVLETGEMVRMNAYRRSILSELSDKEPIPARVLPYCKSV----------------------DDLAEVAMYRI-----------IICTCTSSGALYRLGLKTGHITHVFVDEAGQASEPEIMISLGFTNRCNGQIILAGDPMQLGPVI--RSPYAQQLQESYLHRLLLTCDLYKKQKEICAGSTTHFNPLIVTQLLQNYRAHPALLKLPSDMFYEGTLIPCVVKNRF----INWKWLPNPEVPLVFQGVRGKELRNPRNPSTYNPSEAVMVVRWIGRLLQDTDNIGKLKDKNISVITPYRAQVDCIRKLISS--CLDNVNLAKLKVASVEEFQGQENEVVIISTVRSSLDESGNNGVHESFAILNMVGSRLGFLSNKRRFNVSITRACSLLIVIGDPGLLKYDECWSSLMKYAKT 3417
            LN  Q  AV ++L   +RPL  ++ GPPGTGKTV     +  + +    + +LVC+PSN A D L  ++ ++G+    ++VR+ A  R        +  +P   L +   V                      DDL  + + R+           I CTC+S+       ++T     V +DE+ QA+EPEI++S+    R   Q++L GD  QLGPV+  +      L +S   RL+L                    P    +L   YR HP L + PS++FY+G+L   V +N      ++W W P P  P  F    G E  +    S  N +EA  V + + +L++       ++   I VITPY  Q   I   + +   L++     +++ASV+ FQG+E + +I++ VRS+                +++G  +GFLS+ RR NV+ITRA   L+++G+  +L   + W  L+ + K+
Sbjct:  446 LNSSQMQAVKQVL---TRPLS-LIQGPPGTGKTVVSATIVYHLVQKTEGN-VLVCSPSNIAVDHLAEKIHKTGL----KVVRLCARSRE-----HSETTVPYLTLQHQLKVMGGAELQKLIQLKDEAGELEFKDDLRYMQLKRVKEHELLAAADVICCTCSSAADARLSKIRT---RTVLIDESTQATEPEILVSIMRGVR---QLVLVGDHCQLGPVVICKKAAIAGLSQSLFERLVLLG----------------IRPF---RLQVQYRMHPVLSEFPSNVFYDGSLQNGVTENDRHMTGVDWHW-PKPNKPAFFWHCSGSEELSASGTSFLNRTEAANVEKLVSKLIK-----AGVQPHQIGVITPYEGQRSFIVNYMHTQGTLNSKLYENVEIASVDAFQGREKDYIIVTCVRSN----------------DILG--IGFLSDPRRLNVAITRAKYGLVLVGNAKVLARHDLWHELINHYKS 868          
BLAST of Mov10 like RISC complex RNA helicase 1 vs. Ensembl Celegans
Match: smg-2 (Regulator of nonsense transcripts 1 [Source:UniProtKB/Swiss-Prot;Acc:O76512])

HSP 1 Score: 157.532 bits (397), Expect = 9.758e-39
Identity = 138/486 (28.40%), Postives = 226/486 (46.50%), Query Frame = 1
Query: 2083 LNELQRVAVVRILHGYSRPLPYVLFGPPGTGKTVTLVEAILQVYKNVASSRILVCAPSNSAADLLCLRLDESGVLETGEMVRMNAYRRSILSELSDKEPIPARVLPYCKSV----------------------DDLAEVAMYRI-----------IICTCTSSGALYRLGLKTGHITHVFVDEAGQASEPEIMISLGFTNRCNGQIILAGDPMQLGPVI--RSPYAQQLQESYLHRLLLTCDLYKKQKEICAGSTTHFNPLIVTQLLQNYRAHPALLKLPSDMFYEGTLIPCVVKNRF----INWKWLPNPEVPLVFQGVRGKELRNPRNPSTYNPSEAVMVVRWIGRLLQDTDNIGKLKDKNISVITPYRAQVDCIRKLISS--CLDNVNLAKLKVASVEEFQGQENEVVIISTVRSSLDESGNNGVHESFAILNMVGSRLGFLSNKRRFNVSITRACSLLIVIGDPGLLKYDECWSSLMKYAKT 3417
            LN  Q  AV ++L   +RPL  ++ GPPGTGKTV     +  + +    + +LVC+PSN A D L  ++ ++G+    ++VR+ A  R        +  +P   L +   V                      DDL  + + R+           I CTC+S+       ++T     V +DE+ QA+EPEI++S+    R   Q++L GD  QLGPV+  +      L +S   RL+L                    P    +L   YR HP L + PS++FY+G+L   V +N      ++W W P P  P  F    G E  +    S  N +EA  V + + +L++       ++   I VITPY  Q   I   + +   L++     +++ASV+ FQG+E + +I++ VRS+                +++G  +GFLS+ RR NV+ITRA   L+++G+  +L   + W  L+ + K+
Sbjct:  446 LNSSQMQAVKQVL---TRPLS-LIQGPPGTGKTVVSATIVYHLVQKTEGN-VLVCSPSNIAVDHLAEKIHKTGL----KVVRLCARSRE-----HSETTVPYLTLQHQLKVMGGAELQKLIQLKDEAGELEFKDDLRYMQLKRVKEHELLAAADVICCTCSSAADARLSKIRT---RTVLIDESTQATEPEILVSIMRGVR---QLVLVGDHCQLGPVVICKKAAIAGLSQSLFERLVLLG----------------IRPF---RLQVQYRMHPVLSEFPSNVFYDGSLQNGVTENDRHMTGVDWHW-PKPNKPAFFWHCSGSEELSASGTSFLNRTEAANVEKLVSKLIK-----AGVQPHQIGVITPYEGQRSFIVNYMHTQGTLNSKLYENVEIASVDAFQGREKDYIIVTCVRSN----------------DILG--IGFLSDPRRLNVAITRAKYGLVLVGNAKVLARHDLWHELINHYKS 868          
BLAST of Mov10 like RISC complex RNA helicase 1 vs. Ensembl Celegans
Match: smg-2 (Regulator of nonsense transcripts 1 [Source:UniProtKB/Swiss-Prot;Acc:O76512])

HSP 1 Score: 157.532 bits (397), Expect = 9.758e-39
Identity = 138/486 (28.40%), Postives = 226/486 (46.50%), Query Frame = 1
Query: 2083 LNELQRVAVVRILHGYSRPLPYVLFGPPGTGKTVTLVEAILQVYKNVASSRILVCAPSNSAADLLCLRLDESGVLETGEMVRMNAYRRSILSELSDKEPIPARVLPYCKSV----------------------DDLAEVAMYRI-----------IICTCTSSGALYRLGLKTGHITHVFVDEAGQASEPEIMISLGFTNRCNGQIILAGDPMQLGPVI--RSPYAQQLQESYLHRLLLTCDLYKKQKEICAGSTTHFNPLIVTQLLQNYRAHPALLKLPSDMFYEGTLIPCVVKNRF----INWKWLPNPEVPLVFQGVRGKELRNPRNPSTYNPSEAVMVVRWIGRLLQDTDNIGKLKDKNISVITPYRAQVDCIRKLISS--CLDNVNLAKLKVASVEEFQGQENEVVIISTVRSSLDESGNNGVHESFAILNMVGSRLGFLSNKRRFNVSITRACSLLIVIGDPGLLKYDECWSSLMKYAKT 3417
            LN  Q  AV ++L   +RPL  ++ GPPGTGKTV     +  + +    + +LVC+PSN A D L  ++ ++G+    ++VR+ A  R        +  +P   L +   V                      DDL  + + R+           I CTC+S+       ++T     V +DE+ QA+EPEI++S+    R   Q++L GD  QLGPV+  +      L +S   RL+L                    P    +L   YR HP L + PS++FY+G+L   V +N      ++W W P P  P  F    G E  +    S  N +EA  V + + +L++       ++   I VITPY  Q   I   + +   L++     +++ASV+ FQG+E + +I++ VRS+                +++G  +GFLS+ RR NV+ITRA   L+++G+  +L   + W  L+ + K+
Sbjct:  446 LNSSQMQAVKQVL---TRPLS-LIQGPPGTGKTVVSATIVYHLVQKTEGN-VLVCSPSNIAVDHLAEKIHKTGL----KVVRLCARSRE-----HSETTVPYLTLQHQLKVMGGAELQKLIQLKDEAGELEFKDDLRYMQLKRVKEHELLAAADVICCTCSSAADARLSKIRT---RTVLIDESTQATEPEILVSIMRGVR---QLVLVGDHCQLGPVVICKKAAIAGLSQSLFERLVLLG----------------IRPF---RLQVQYRMHPVLSEFPSNVFYDGSLQNGVTENDRHMTGVDWHW-PKPNKPAFFWHCSGSEELSASGTSFLNRTEAANVEKLVSKLIK-----AGVQPHQIGVITPYEGQRSFIVNYMHTQGTLNSKLYENVEIASVDAFQGREKDYIIVTCVRSN----------------DILG--IGFLSDPRRLNVAITRAKYGLVLVGNAKVLARHDLWHELINHYKS 868          
BLAST of Mov10 like RISC complex RNA helicase 1 vs. Ensembl Celegans
Match: Y106G6D.5 (pep chromosome:WBcel235:I:10119209:10121815:-1 gene:WBGene00014965.1 transcript:Y106G6D.5b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y106G6D.5)

HSP 1 Score: 98.9821 bits (245), Expect = 6.398e-21
Identity = 120/490 (24.49%), Postives = 209/490 (42.65%), Query Frame = 1
Query: 2077 ESLNELQRVAVVRILHGYSRPLPYVLFGPPGTGKTVTLVEAILQVYKNVASSRILVCAPSN---------------------SAADLLCLRLDESGVLETGEMVRMNAYRRSILSELSDKEPIPARV-LPYCKSVDDLAEVAMY-RIIICTCTSSGALYRLGLKTGHITHVFVDEAGQASEPEIMISLGFTNRCNGQIILAGDPMQLGPVIRSPYAQQLQESYLHRLLLTCDLYKKQKEICAGSTTHFNPLIVTQLLQNYRAHPALLKLPSDMFYEGTLI--------------PCVVKNRFINWKWLPNPEVPLVFQGVRGKELRNPRNPSTYNPSEAVMVVRWIGRLLQDTDNIGKLKDKNISVITPYRAQVDCIRKLISSCLDNVNLAKLKVASVEEFQGQENEVVIISTVRSSLDESGNNGVHESFAILNMVGSRLGFLSNKRRFNVSITRACSLLIVIGDPGLLKYDECWSSLMKYAKTNNAFIG 3435
            E+LN  Q VA V       R L   + GPPGTGKT  + E + Q+ K     ++LVCAP++                      A   LCL  +     +  +        +  LS +S  +P+  ++   Y    + +     Y ++ + +   + ++ +L     +   + VDEA Q +EP   + +  T  C  ++IL GD  QL  V+ S  A +              L +K  E    S+ + N L+  Q    YR +  ++   +++FYE  L               P + ++  +N     NP + +  + V+ +      + S  N  E  +V  ++ RL+ D   +G +  K I+VI+PY AQ++ +R+ I   +D        V +V+ FQG E +VVI   VR + DE                  ++GFL+  RR NV++TRA    ++IG+  ++K ++    L K+ ++     G
Sbjct:  129 ETLNPSQ-VAAVSAAMNTQRNL-LCIQGPPGTGKTRVIAEIVHQLMK--KKKKVLVCAPTHVAVRNAMDATTGRMIEEMPEEKAEQQLCLLANTKDEFQNHKSASKLEEIKKQLSTMSTSDPLYKKMSYEYYLIRNSIFRSIFYPKLAVFSTLGTSSIQKLPEYHWNADVMIVDEAAQCTEPATWVPVLTTPSCK-KLILVGDQKQLPAVVLSDKAMKGN--------FKLSLMEKLAE--EFSSNNINILLNEQ----YRMNKKIMNWSNEVFYENQLTAHSTVSDITLRDICPNLPEDHVLN-----NPIMMINMENVKDRSHEEFESHSFTNTDELNLVTEYVNRLVVD---LG-INPKAIAVISPYYAQIEKLRRSIPFRVD--------VNTVDAFQGHERQVVIFCLVRDN-DEG-----------------QIGFLNETRRLNVAVTRARRQFVLIGNGRMMKGNKHLLKLYKHLQSEKVIFG 564          
BLAST of Mov10 like RISC complex RNA helicase 1 vs. Ensembl Celegans
Match: Y106G6D.5 (pep chromosome:WBcel235:I:10119209:10122171:-1 gene:WBGene00014965.1 transcript:Y106G6D.5a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y106G6D.5)

HSP 1 Score: 98.9821 bits (245), Expect = 8.434e-21
Identity = 119/490 (24.29%), Postives = 208/490 (42.45%), Query Frame = 1
Query: 2077 ESLNELQRVAVVRILHGYSRPLPYVLFGPPGTGKTVTLVEAILQVYKNVASSRILVCAPSN---------------------SAADLLCLRLDESGVLETGEMVRMNAYRRSILSELSDKEPIPARV-LPYCKSVDDLAEVAMY-RIIICTCTSSGALYRLGLKTGHITHVFVDEAGQASEPEIMISLGFTNRCNGQIILAGDPMQLGPVIRSPYAQQLQESYLHRLLLTCDLYKKQKEICAGSTTHFNPLIVTQLLQNYRAHPALLKLPSDMFYEGTLI--------------PCVVKNRFINWKWLPNPEVPLVFQGVRGKELRNPRNPSTYNPSEAVMVVRWIGRLLQDTDNIGKLKDKNISVITPYRAQVDCIRKLISSCLDNVNLAKLKVASVEEFQGQENEVVIISTVRSSLDESGNNGVHESFAILNMVGSRLGFLSNKRRFNVSITRACSLLIVIGDPGLLKYDECWSSLMKYAKTNNAFIG 3435
            E+LN  Q VA V       R L   + GPPGTGKT  + E + Q+       ++LVCAP++                      A   LCL  +     +  +        +  LS +S  +P+  ++   Y    + +     Y ++ + +   + ++ +L     +   + VDEA Q +EP   + +  T  C  ++IL GD  QL  V+ S  A +              L +K  E    S+ + N L+  Q    YR +  ++   +++FYE  L               P + ++  +N     NP + +  + V+ +      + S  N  E  +V  ++ RL+ D   +G +  K I+VI+PY AQ++ +R+ I   +D        V +V+ FQG E +VVI   VR + DE                  ++GFL+  RR NV++TRA    ++IG+  ++K ++    L K+ ++     G
Sbjct:  220 ETLNPSQ-VAAVSAAMNTQRNL-LCIQGPPGTGKTRVIAEIVHQLM--KKKKKVLVCAPTHVAVRNAMDATTGRMIEEMPEEKAEQQLCLLANTKDEFQNHKSASKLEEIKKQLSTMSTSDPLYKKMSYEYYLIRNSIFRSIFYPKLAVFSTLGTSSIQKLPEYHWNADVMIVDEAAQCTEPATWVPVLTTPSCK-KLILVGDQKQLPAVVLSDKAMKGN--------FKLSLMEKLAE--EFSSNNINILLNEQ----YRMNKKIMNWSNEVFYENQLTAHSTVSDITLRDICPNLPEDHVLN-----NPIMMINMENVKDRSHEEFESHSFTNTDELNLVTEYVNRLVVD---LG-INPKAIAVISPYYAQIEKLRRSIPFRVD--------VNTVDAFQGHERQVVIFCLVRDN-DEG-----------------QIGFLNETRRLNVAVTRARRQFVLIGNGRMMKGNKHLLKLYKHLQSEKVIFG 655          
BLAST of Mov10 like RISC complex RNA helicase 1 vs. Ensembl Fly
Match: armi (gene:FBgn0041164 transcript:FBtr0309840)

HSP 1 Score: 354.755 bits (909), Expect = 8.746e-104
Identity = 227/714 (31.79%), Postives = 365/714 (51.12%), Query Frame = 1
Query: 1456 KLKLYPIPEQLEQRVVNKED-------IMGLYAVLKEKLGPGNYSKKMDLLVHLEEVNAKEEMKELVLENVRLMRRRDTFGIEVPGLSEGRPSLMXXXXXXXXX-----XXXXXXTFSGSIEDILCEVIFVKFHATLESSYRNEECTVSFSHSRLPFRRMHLGIELACGTLGDGILFPGKIDMKSSQCVRLSRAGLNELSGVNLMKENELRLV--QLKFYNESLNELQRVAVVRILHGYSRPLPYVLFGPPGTGKTVTLVEAILQVYKNVASSRILVCAPSNSAADLLCLRLDESGVLETGEMVRMNAYRRSILSELSDKEPIPARVLPYCKSVD----------------------DLAEVAMYRIIICTCTSSGALYRLGLKTGHITHVFVDEAGQASEPEIMISLGFTNRCNGQIILAGDPMQLGPVIRSPYAQQL--QESYLHRLLLTCDLYKKQKEICAGSTTHFNPLIVTQLLQNYRAHPALLKLPSDMFYEGTLIPCV-------------VKNRFINWKWLPNPEVPLVFQGVRGKELRNPRNPSTYNPSEAVMVVRWIGRLLQDTDNIGKLKDKNISVITPYRAQVDCIRKLISSCLDNVNLAKLKVASVEEFQGQENEVVIISTVRSSLDESGNNGVHESFAILNMVGS-RLGFLSNKRRFNVSITRACSLLIVIGDPGLLKYDECWSSLMKYAKTNNAFIGSE 3441
            +L  + +P++L Q  +  E        I   Y+ L E L    Y  +  LL+HLEE+      +    +    +R  +   +++  L+E RPSL++GD + V           + ++ G I  +L + I +KFH++ +  Y  E+  + F  SR  FR+ H  I    G +G+  LFP K+  + +  + +             MK++++ L   +L++YN+SLN +Q+ AV  IL G +  +PYVLFGPPG+GKT+TL+E +LQ+ +N+  +RILV  PSNS+ADL+  RL +S  L  G+ +R+ +Y +       +K+ IP  ++ YC + D                          +  +RI I TCT+ G   +LG   GH THV  DEAGQ +EPE M+ +    +   Q++L+GDP QL  ++ S  A ++    S+L RLL      K  +     S   +NPL++T+LL NYRA P+++ + S +FY+  LIP +             ++  F + K +P       F G+ G+  +N  +PS +NP E   V      L +       +    I +ITPY+ QV    K++ S     ++   K+ SVEEFQGQE ++++ISTVRSS +            IL M     LGF+   +R NV+++RA +++I+ G+P LL  DECW  L+ +   NNA+ G +
Sbjct:  453 RLGCFEVPKELRQICLTSERRQEMIKAIEQHYSFLTEPLSIKTYMHRFRLLLHLEEIECFVNFRNYDRDRAHFLRDGEFLTLQIENLAERRPSLVIGDTLRVINPWSDPDSQTTKSYEGIIHKVLFDRILLKFHSSFQEKYNGEDYRLEFYFSRYSFRKQHHAISKIVGVMGEDFLFPSKVTKRENPQLDV------------YMKDDDMYLYDSKLEWYNQSLNSIQKRAVFNILRGEAENIPYVLFGPPGSGKTMTLIETLLQLVRNLPGARILVGTPSNSSADLVTKRLIDSKALLQGDFIRLVSYNQ------VEKDLIPPEIMSYCATSDVGAVGSCEDKMMVTESGLKLRCQAKFIGTHRITISTCTTLGNFLQLGFPAGHFTHVLFDEAGQCTEPETMVPIVMLTKKRSQVVLSGDPRQLQSIVTSRIASKMGFSISFLERLLERSPYRKDLQRFPESSG--YNPLVLTKLLYNYRALPSIMSIYSRLFYDDELIPVLSEKDSRESRLLSKLRCVFESEKDIPQAHGTF-FYGIIGENRQNNDSPSWFNPQEVREVFLMTIALYR-----ANVTADQIGIITPYQKQV----KMLRSMFIGTDVVMPKIGSVEEFQGQERDIILISTVRSSEE------------ILRMDARFSLGFVRCSKRLNVAVSRARAMMIIFGNPHLLAVDECWRQLILFCVKNNAYFGCD 1124          
BLAST of Mov10 like RISC complex RNA helicase 1 vs. Ensembl Fly
Match: armi (gene:FBgn0041164 transcript:FBtr0100641)

HSP 1 Score: 354.755 bits (909), Expect = 1.420e-103
Identity = 227/714 (31.79%), Postives = 365/714 (51.12%), Query Frame = 1
Query: 1456 KLKLYPIPEQLEQRVVNKED-------IMGLYAVLKEKLGPGNYSKKMDLLVHLEEVNAKEEMKELVLENVRLMRRRDTFGIEVPGLSEGRPSLMXXXXXXXXX-----XXXXXXTFSGSIEDILCEVIFVKFHATLESSYRNEECTVSFSHSRLPFRRMHLGIELACGTLGDGILFPGKIDMKSSQCVRLSRAGLNELSGVNLMKENELRLV--QLKFYNESLNELQRVAVVRILHGYSRPLPYVLFGPPGTGKTVTLVEAILQVYKNVASSRILVCAPSNSAADLLCLRLDESGVLETGEMVRMNAYRRSILSELSDKEPIPARVLPYCKSVD----------------------DLAEVAMYRIIICTCTSSGALYRLGLKTGHITHVFVDEAGQASEPEIMISLGFTNRCNGQIILAGDPMQLGPVIRSPYAQQL--QESYLHRLLLTCDLYKKQKEICAGSTTHFNPLIVTQLLQNYRAHPALLKLPSDMFYEGTLIPCV-------------VKNRFINWKWLPNPEVPLVFQGVRGKELRNPRNPSTYNPSEAVMVVRWIGRLLQDTDNIGKLKDKNISVITPYRAQVDCIRKLISSCLDNVNLAKLKVASVEEFQGQENEVVIISTVRSSLDESGNNGVHESFAILNMVGS-RLGFLSNKRRFNVSITRACSLLIVIGDPGLLKYDECWSSLMKYAKTNNAFIGSE 3441
            +L  + +P++L Q  +  E        I   Y+ L E L    Y  +  LL+HLEE+      +    +    +R  +   +++  L+E RPSL++GD + V           + ++ G I  +L + I +KFH++ +  Y  E+  + F  SR  FR+ H  I    G +G+  LFP K+  + +  + +             MK++++ L   +L++YN+SLN +Q+ AV  IL G +  +PYVLFGPPG+GKT+TL+E +LQ+ +N+  +RILV  PSNS+ADL+  RL +S  L  G+ +R+ +Y +       +K+ IP  ++ YC + D                          +  +RI I TCT+ G   +LG   GH THV  DEAGQ +EPE M+ +    +   Q++L+GDP QL  ++ S  A ++    S+L RLL      K  +     S   +NPL++T+LL NYRA P+++ + S +FY+  LIP +             ++  F + K +P       F G+ G+  +N  +PS +NP E   V      L +       +    I +ITPY+ QV    K++ S     ++   K+ SVEEFQGQE ++++ISTVRSS +            IL M     LGF+   +R NV+++RA +++I+ G+P LL  DECW  L+ +   NNA+ G +
Sbjct:  487 RLGCFEVPKELRQICLTSERRQEMIKAIEQHYSFLTEPLSIKTYMHRFRLLLHLEEIECFVNFRNYDRDRAHFLRDGEFLTLQIENLAERRPSLVIGDTLRVINPWSDPDSQTTKSYEGIIHKVLFDRILLKFHSSFQEKYNGEDYRLEFYFSRYSFRKQHHAISKIVGVMGEDFLFPSKVTKRENPQLDV------------YMKDDDMYLYDSKLEWYNQSLNSIQKRAVFNILRGEAENIPYVLFGPPGSGKTMTLIETLLQLVRNLPGARILVGTPSNSSADLVTKRLIDSKALLQGDFIRLVSYNQ------VEKDLIPPEIMSYCATSDVGAVGSCEDKMMVTESGLKLRCQAKFIGTHRITISTCTTLGNFLQLGFPAGHFTHVLFDEAGQCTEPETMVPIVMLTKKRSQVVLSGDPRQLQSIVTSRIASKMGFSISFLERLLERSPYRKDLQRFPESSG--YNPLVLTKLLYNYRALPSIMSIYSRLFYDDELIPVLSEKDSRESRLLSKLRCVFESEKDIPQAHGTF-FYGIIGENRQNNDSPSWFNPQEVREVFLMTIALYR-----ANVTADQIGIITPYQKQV----KMLRSMFIGTDVVMPKIGSVEEFQGQERDIILISTVRSSEE------------ILRMDARFSLGFVRCSKRLNVAVSRARAMMIIFGNPHLLAVDECWRQLILFCVKNNAYFGCD 1158          
BLAST of Mov10 like RISC complex RNA helicase 1 vs. Ensembl Fly
Match: armi (gene:FBgn0041164 transcript:FBtr0309841)

HSP 1 Score: 354.755 bits (909), Expect = 1.420e-103
Identity = 227/714 (31.79%), Postives = 365/714 (51.12%), Query Frame = 1
Query: 1456 KLKLYPIPEQLEQRVVNKED-------IMGLYAVLKEKLGPGNYSKKMDLLVHLEEVNAKEEMKELVLENVRLMRRRDTFGIEVPGLSEGRPSLMXXXXXXXXX-----XXXXXXTFSGSIEDILCEVIFVKFHATLESSYRNEECTVSFSHSRLPFRRMHLGIELACGTLGDGILFPGKIDMKSSQCVRLSRAGLNELSGVNLMKENELRLV--QLKFYNESLNELQRVAVVRILHGYSRPLPYVLFGPPGTGKTVTLVEAILQVYKNVASSRILVCAPSNSAADLLCLRLDESGVLETGEMVRMNAYRRSILSELSDKEPIPARVLPYCKSVD----------------------DLAEVAMYRIIICTCTSSGALYRLGLKTGHITHVFVDEAGQASEPEIMISLGFTNRCNGQIILAGDPMQLGPVIRSPYAQQL--QESYLHRLLLTCDLYKKQKEICAGSTTHFNPLIVTQLLQNYRAHPALLKLPSDMFYEGTLIPCV-------------VKNRFINWKWLPNPEVPLVFQGVRGKELRNPRNPSTYNPSEAVMVVRWIGRLLQDTDNIGKLKDKNISVITPYRAQVDCIRKLISSCLDNVNLAKLKVASVEEFQGQENEVVIISTVRSSLDESGNNGVHESFAILNMVGS-RLGFLSNKRRFNVSITRACSLLIVIGDPGLLKYDECWSSLMKYAKTNNAFIGSE 3441
            +L  + +P++L Q  +  E        I   Y+ L E L    Y  +  LL+HLEE+      +    +    +R  +   +++  L+E RPSL++GD + V           + ++ G I  +L + I +KFH++ +  Y  E+  + F  SR  FR+ H  I    G +G+  LFP K+  + +  + +             MK++++ L   +L++YN+SLN +Q+ AV  IL G +  +PYVLFGPPG+GKT+TL+E +LQ+ +N+  +RILV  PSNS+ADL+  RL +S  L  G+ +R+ +Y +       +K+ IP  ++ YC + D                          +  +RI I TCT+ G   +LG   GH THV  DEAGQ +EPE M+ +    +   Q++L+GDP QL  ++ S  A ++    S+L RLL      K  +     S   +NPL++T+LL NYRA P+++ + S +FY+  LIP +             ++  F + K +P       F G+ G+  +N  +PS +NP E   V      L +       +    I +ITPY+ QV    K++ S     ++   K+ SVEEFQGQE ++++ISTVRSS +            IL M     LGF+   +R NV+++RA +++I+ G+P LL  DECW  L+ +   NNA+ G +
Sbjct:  487 RLGCFEVPKELRQICLTSERRQEMIKAIEQHYSFLTEPLSIKTYMHRFRLLLHLEEIECFVNFRNYDRDRAHFLRDGEFLTLQIENLAERRPSLVIGDTLRVINPWSDPDSQTTKSYEGIIHKVLFDRILLKFHSSFQEKYNGEDYRLEFYFSRYSFRKQHHAISKIVGVMGEDFLFPSKVTKRENPQLDV------------YMKDDDMYLYDSKLEWYNQSLNSIQKRAVFNILRGEAENIPYVLFGPPGSGKTMTLIETLLQLVRNLPGARILVGTPSNSSADLVTKRLIDSKALLQGDFIRLVSYNQ------VEKDLIPPEIMSYCATSDVGAVGSCEDKMMVTESGLKLRCQAKFIGTHRITISTCTTLGNFLQLGFPAGHFTHVLFDEAGQCTEPETMVPIVMLTKKRSQVVLSGDPRQLQSIVTSRIASKMGFSISFLERLLERSPYRKDLQRFPESSG--YNPLVLTKLLYNYRALPSIMSIYSRLFYDDELIPVLSEKDSRESRLLSKLRCVFESEKDIPQAHGTF-FYGIIGENRQNNDSPSWFNPQEVREVFLMTIALYR-----ANVTADQIGIITPYQKQV----KMLRSMFIGTDVVMPKIGSVEEFQGQERDIILISTVRSSEE------------ILRMDARFSLGFVRCSKRLNVAVSRARAMMIIFGNPHLLAVDECWRQLILFCVKNNAYFGCD 1158          
BLAST of Mov10 like RISC complex RNA helicase 1 vs. Ensembl Fly
Match: CG6701 (gene:FBgn0033889 transcript:FBtr0303989)

HSP 1 Score: 212.616 bits (540), Expect = 1.225e-55
Identity = 154/470 (32.77%), Postives = 240/470 (51.06%), Query Frame = 1
Query: 2080 SLNELQRVAVVRILHGYSRPLPYVLFGPPGTGKTVTLVEAILQVYKNVASSRILVCAPSNSAADLLCLRL-------DESGVLETGEMVRMNAYRR-----SILSELSDKEPIPARVLPYCKSVDDLAEVAMYRIIICTCTSSGALYRLGLKTGHI-THVFVDEAGQASEPEIMISLGFTNRCNGQIILAGDPMQLGPVIRSPYAQQLQESYLHRLLLTCDLYKKQKEICAGSTTHFNPLIVTQLLQNYRAHPALLKLPSDMFYEGTL---IPCVVKNRFINWKWLPNPEVPLVFQGVRGKELRNPRNPSTYNPSEAVMVVRWIGRLLQDTDNIGKLKDKNISVITPYRAQVDCIRKLISSCLDNVNLAKLKVASVEEFQGQENEVVIISTVRSSLDESGNNGVHESFAILNMVGSRLGFLSNKRRFNVSITRACSLLIVIGDPGLLKYDECWSSLMKYAKTNNAFIGSE 3441
            S N  Q  AV +I        PY++FGPPGTGKT T+VEAI Q+Y N   + ILV A SN+A D + LRL        +S       +   N  RR      +L E S+   +     P  ++V        YRI+ICT + +G L   G    ++ THVFVDEA  ++E E+++ +  T      +IL+GD  QLGPV++S   Q+  E  L   L    L +K  ++    +  +N  + T+L++N+R+HP ++ L ++M+YEG L    P  +  RF NW +LPN   P++F  V G  +    + S  N  E  +V+ ++  L+    N  KL   +I +I+PY+ Q   I++     L+  N +++   SVE FQG+E  V+I+S VRS                      +LGFL+N+RR NV ++R  SLLI+IG+P  L  +  +  +++  +     +G +
Sbjct:  611 STNPEQMQAVRQIALSPRLKAPYIVFGPPGTGKTSTIVEAIYQLYINRPETHILVLAGSNTACDEVALRLLRAIAKAPQSQPRPLTRIFSANCDRRIDNIDDLLLEYSNMYTV--HFYPAVQAVHQ------YRIVICTLSLAGKLSTGGFAANNVYTHVFVDEAAASTEAEVLMGITCTLSPTLNLILSGDHKQLGPVLQS---QRANEWGLGLTLFERLLQRKCYQVEEDGS--YNASVQTRLIRNFRSHPEIVSLYNNMYYEGHLRTEAPMEIVCRFHNWFYLPNATFPIMFHSVFGTTMNTKSSVSLCNNKEIDVVMDYVKDLMYFGLNGEKLLQTDIGIISPYKNQYQRIQEQ----LNMRNWSQIDCGSVELFQGKEKHVIIVSFVRS-------------------FTPKLGFLNNERRLNVLLSRPISLLILIGNPRTLSQNSDFQHIIEMCRNRKTLVGEQ 1044          
BLAST of Mov10 like RISC complex RNA helicase 1 vs. Ensembl Fly
Match: CG6701 (gene:FBgn0033889 transcript:FBtr0339957)

HSP 1 Score: 212.616 bits (540), Expect = 1.225e-55
Identity = 154/470 (32.77%), Postives = 240/470 (51.06%), Query Frame = 1
Query: 2080 SLNELQRVAVVRILHGYSRPLPYVLFGPPGTGKTVTLVEAILQVYKNVASSRILVCAPSNSAADLLCLRL-------DESGVLETGEMVRMNAYRR-----SILSELSDKEPIPARVLPYCKSVDDLAEVAMYRIIICTCTSSGALYRLGLKTGHI-THVFVDEAGQASEPEIMISLGFTNRCNGQIILAGDPMQLGPVIRSPYAQQLQESYLHRLLLTCDLYKKQKEICAGSTTHFNPLIVTQLLQNYRAHPALLKLPSDMFYEGTL---IPCVVKNRFINWKWLPNPEVPLVFQGVRGKELRNPRNPSTYNPSEAVMVVRWIGRLLQDTDNIGKLKDKNISVITPYRAQVDCIRKLISSCLDNVNLAKLKVASVEEFQGQENEVVIISTVRSSLDESGNNGVHESFAILNMVGSRLGFLSNKRRFNVSITRACSLLIVIGDPGLLKYDECWSSLMKYAKTNNAFIGSE 3441
            S N  Q  AV +I        PY++FGPPGTGKT T+VEAI Q+Y N   + ILV A SN+A D + LRL        +S       +   N  RR      +L E S+   +     P  ++V        YRI+ICT + +G L   G    ++ THVFVDEA  ++E E+++ +  T      +IL+GD  QLGPV++S   Q+  E  L   L    L +K  ++    +  +N  + T+L++N+R+HP ++ L ++M+YEG L    P  +  RF NW +LPN   P++F  V G  +    + S  N  E  +V+ ++  L+    N  KL   +I +I+PY+ Q   I++     L+  N +++   SVE FQG+E  V+I+S VRS                      +LGFL+N+RR NV ++R  SLLI+IG+P  L  +  +  +++  +     +G +
Sbjct:  611 STNPEQMQAVRQIALSPRLKAPYIVFGPPGTGKTSTIVEAIYQLYINRPETHILVLAGSNTACDEVALRLLRAIAKAPQSQPRPLTRIFSANCDRRIDNIDDLLLEYSNMYTV--HFYPAVQAVHQ------YRIVICTLSLAGKLSTGGFAANNVYTHVFVDEAAASTEAEVLMGITCTLSPTLNLILSGDHKQLGPVLQS---QRANEWGLGLTLFERLLQRKCYQVEEDGS--YNASVQTRLIRNFRSHPEIVSLYNNMYYEGHLRTEAPMEIVCRFHNWFYLPNATFPIMFHSVFGTTMNTKSSVSLCNNKEIDVVMDYVKDLMYFGLNGEKLLQTDIGIISPYKNQYQRIQEQ----LNMRNWSQIDCGSVELFQGKEKHVIIVSFVRS-------------------FTPKLGFLNNERRLNVLLSRPISLLILIGNPRTLSQNSDFQHIIEMCRNRKTLVGEQ 1044          
BLAST of Mov10 like RISC complex RNA helicase 1 vs. Ensembl Zebrafish
Match: mov10b.1 (Moloney leukemia virus 10b, tandem duplicate 1 [Source:NCBI gene;Acc:556024])

HSP 1 Score: 377.096 bits (967), Expect = 8.009e-113
Identity = 243/661 (36.76%), Postives = 366/661 (55.37%), Query Frame = 1
Query: 1534 VLKEKLGPGNYSKKMDLLVHLEEVNAKEEMKELVLENVRLMRRRDT--FGIEVPGLSEGRPSLMXXXXXXXXXXXXXXXT----FSGSIEDILCEVIFVKFHATL-ESSYRNEECTVSFSHSRLPFRRMHLGIELACGTLGDGILFPGKIDMKSSQCVRLSRAGLNELSGVNLMKENELRLVQLKFYNESLNELQRVAVVRILHGYSRPLPYVLFGPPGTGKTVTLVEAILQVYKNVASSRILVCAPSNSAADLLCLRLDESGVLETGEMVRMNAYRRS---ILSELSDKEPIPARVLPY-CKSVDDLAEVAMYRIIICTCTSSGALYRLGLKTGHITHVFVDEAGQASEPEIMISL-GFTNRCNGQIILAGDPMQLGPVIRSPYAQQ--LQESYLHRLLLTCDLYKKQKEICAGSTTHFNPLIVTQLLQNYRAHPALLKLPSDMFYEGTLIPC---VVKNRFINWKWLPNPEVPLVFQGVRGKELRNPRNPSTYNPSEAVMVVRWIGRLL--QDTDNIGKLKDKNISVITPYRAQVDCIRKLISSCLDNVNLA---KLKVASVEEFQGQENEVVIISTVRSS-----LDESGNNGVHESFAILNMVGSRLGFLSNKRRFNVSITRACSLLIVIGDPGLLKYDECWSSLMKYAKTNNAFIG 3435
             L+  L   NY  + DLL++LEE   + ++K    ++V ++R RD     +E+PG+SE RPS++ GD + +    +   +    + G +  +  + + + F   L E    N + +V F+ +RLP R  H  + +        +LFP            ++   LN +S       + LRL   K      N  Q+ AV  I+ G S+P PY++FGPPGTGKTVT+VEAI QV KN   +RIL CAPSNSAAD L  +L  S  ++   + R+ A  R+   I   L +   +    + + CK      ++  Y+I++CT  ++G L   G   GH +H+FVDEAG A EPEI+IS+ G  N   GQ++LAGDP QLGP++RSP+A +  L  S L RL+   +LY+K         T F+   VT+LLQNYR+HP++LK+P+++FY+  L  C   +   ++  W+ LP    P++F GV GK+ R   +PS +N SE   ++ ++ +LL  Q    I K+  K+I +I PYR QV+ IR+ I    +  +L+   +LKV SVEEFQGQE +V+I+STVRSS     LD+  N                +GFL N++RFNV++TRA +LLI++G+P +L+ DE W   M Y      + G
Sbjct:  356 TLESDLSFNNYMDRFDLLLYLEEDQMRMDIKRYNKKDVSMVRDRDKKLLVLELPGVSENRPSVLRGDHLLLTKSEELQNSNVTKYKGYVHRVELDQVKLGFSKRLLERFIDNMKFSVEFTINRLPLRLQHRAVHMVVQHHLKDVLFP------------VASRRLNPVS------PSALRLFDQKLEK---NPEQKTAVCNIVAGTSKPAPYLVFGPPGTGKTVTIVEAIKQVEKNTGGARILACAPSNSAADQLGEKLITSQHVDARNIYRIYASSRNPKEIPKVLENNSNVEGENIIFPCKE-----DLMPYKIVVCTLVTAGRLVSGGFPVGHFSHIFVDEAGHAVEPEIVISVAGLLNAETGQLVLAGDPKQLGPILRSPFAIKYGLGLSLLERLMTQNELYQK-------GDTGFDNRYVTKLLQNYRSHPSILKVPNELFYDNELKACADEISSRQYCTWEHLPKRGFPVIFHGVVGKDERESTSPSFFNTSEIDKIMDYLKKLLLTQAKKGIAKISPKDIGIIAPYRKQVEKIRQAIKIHRELKSLSGIEELKVGSVEEFQGQERKVIIVSTVRSSKEHIILDDKFN----------------IGFLKNEKRFNVAVTRAKALLIMVGNPIILRTDEIWGRFMNYCIQERGYTG 967          
BLAST of Mov10 like RISC complex RNA helicase 1 vs. Ensembl Zebrafish
Match: mov10a (Mov10 RISC complex RNA helicase a [Source:ZFIN;Acc:ZDB-GENE-091230-8])

HSP 1 Score: 373.629 bits (958), Expect = 1.175e-111
Identity = 243/668 (36.38%), Postives = 364/668 (54.49%), Query Frame = 1
Query: 1507 KEDIMGLYAVLKEKLGPGNYSKKMDLLVHLEEVNAKEEMKELVLENVRLM---RRRDTFGIEVPGLSEGRPSLMXXXXXX---XXXXXXXXXTFSGSIEDILCEVIFVKFHATLESSY-RNEECTVSFSHSRLPFRRMHLGIELACGTLGDGILFPGKIDMKSSQCVRLSRAGLNELSGVNLMKENELRLVQLKFYNESL--NELQRVAVVRILHGYSRPLPYVLFGPPGTGKTVTLVEAILQVYKNVASSRILVCAPSNSAADLLCLRLDESGVLETGEMVRMNAYRRSILSELSDKEPIPARVLPYC---KSVDDL-----AEVAMYRIIICTCTSSGALYRLGLKTGHITHVFVDEAGQASEPEIMISL-GFTNRCNGQIILAGDPMQLGPVIRSPYAQ--QLQESYLHRLLLTCDLYKKQKEICAGSTTHFNPLIVTQLLQNYRAHPALLKLPSDMFYEGTL---IPCVVKNRFINWKWLPNPEVPLVFQGVRGKELRNPRNPSTYNPSEAVMVVRWIGRLLQDTDNIG--KLKDKNISVITPYRAQVDCIRKLISSCLDNVNLAKLKVASVEEFQGQENEVVIISTVRSSLDESGNNGVHESFAILNMVGSRLGFLSNKRRFNVSITRACSLLIVIGDPGLLKYDECWSSLMKYAKTNNAFIG 3435
            K+ +  +  +L  +L   NYS++  LL+HLEE+  + ++K+  L    +      +    ++VPG++E RPS++ GDK+N      +      + G +  +  + + + F   L   +  N +  V F+ +R P R  H  +ELA       +LFP   D   S+                        L  L  +N+ L  N  Q+ AV  IL G SRP PY++FGPPGTGKTVT+VEAI QV K+ A S IL CAPSNSA DLLC RL   G ++   + R+ A  R       D   +P ++L +    ++ D         +  Y II+ T  ++G L   G+  GH TH+F+DEAGQA EPE +I + G  +   GQ++LAGDP QLGPV+RSP AQ   L +S L RL+    LY+K ++      + ++   VT+LL+NYR+HPA+LK+P+++FYE  L      + +  F  W+ LP    P+VF GV GK+ R   +PS +N +E  ++V ++  L+Q     G  KL   +I +I PYR QV+ IRK +++  +      +KV SVEEFQGQE +V+I+STVRSS++      + + F I        GFLSN++RFNV++TRA  LLIV+G+P +L  D  W   ++Y +    + G
Sbjct:  339 KQHLPRVRRLLDTQLCMKNYSERFHLLLHLEEIQMEVDIKKYDLYGKTMTLDKTNKKLLILKVPGVAENRPSVLRGDKLNVCLSDDRNQPITVYEGYVHRVELDKVILGFSRKLLQKFVNNMKFDVEFNINRFPLRLQHRAVELAVQHALGNVLFPSDKDTGHSE------------------------LPHLSMFNKDLENNPEQKAAVQHILSGSSRPAPYLIFGPPGTGKTVTVVEAIKQVDKSKAQSHILACAPSNSACDLLCERL--LGHVDAHRIYRLCAPSR-------DPRTVPQKLLKHSNWNEAQDSFLLPSKETLIGYSIIVVTLVTAGRLVSGGVAMGHFTHIFIDEAGQAVEPECIIGIAGLLDPLKGQLVLAGDPQQLGPVLRSPLAQLHGLGQSLLERLMKRNALYQKSQD----DNSKYDSRFVTKLLRNYRSHPAILKIPNELFYENELQVFANQMEREAFCQWEHLPRKGFPVVFHGVMGKDEREANSPSFFNVTEIEVIVNYLNNLMQTQGKKGLPKLGPNDIGIIAPYRKQVEKIRKALNTVGELKKWKDIKVGSVEEFQGQERKVIIVSTVRSSVNYV---KMDQDFNI--------GFLSNEKRFNVAMTRAKGLLIVVGNPVILSKDPTWQKFIQYCEQEQGYTG 958          
BLAST of Mov10 like RISC complex RNA helicase 1 vs. Ensembl Zebrafish
Match: mov10b.2 (Moloney leukemia virus 10b, tandem duplicate 2 [Source:NCBI gene;Acc:555950])

HSP 1 Score: 371.318 bits (952), Expect = 9.174e-111
Identity = 239/659 (36.27%), Postives = 365/659 (55.39%), Query Frame = 1
Query: 1534 VLKEKLGPGNYSKKMDLLVHLEEVNAKEEMKELVLENVRLMRRRDT--FGIEVPGLSEGRPSLMXXXXXXXXXXXXXXXT----FSGSIEDILCEVIFVKFHATL-ESSYRNEECTVSFSHSRLPFRRMHLGIELACGTLGDGILFPGKIDMKSSQCVRLSRAGLNELSGVNLMKENELRLVQLKFYNESLNELQRVAVVRILHGYSRPLPYVLFGPPGTGKTVTLVEAILQV-YKNVASSRILVCAPSNSAADLLCLRLDESGVLETGEMVRMNAYRRSILSELSDKEPIPARVLPY-CKSVDDLAEVAMYRIIICTCTSSGALYRLGLKTGHITHVFVDEAGQASEPEIMISL-GFTNRCNGQIILAGDPMQLGPVIRSPYAQQ--LQESYLHRLLLTCDLYKKQKEICAGSTTHFNPLIVTQLLQNYRAHPALLKLPSDMFYEGTLIPC---VVKNRFINWKWLPNPEVPLVFQGVRGKELRNPRNPSTYNPSEAVMVVRWIGRLL--QDTDNIGKLKDKNISVITPYRAQVDCIRKLISSCLDNVNLA---KLKVASVEEFQGQENEVVIISTVRSS-----LDESGNNGVHESFAILNMVGSRLGFLSNKRRFNVSITRACSLLIVIGDPGLLKYDECWSSLMKYAKTNNAFIG 3435
             L+  L   NY  + DLL++LEE   + ++K    ++V ++R RD     +E+PG+SE RPS++ GD + +    +   +    + G +  +  + + + F   L E    N + +V F+ +RLP R  H  + +        +LFP            ++   LN +S       + LR ++        N  Q+ AV  I+ G S+P PY++FGPPGTGKTVT+VEAI QV  KN   +RIL CAPSNSAAD L  +L  S  ++   + R+ A  R+      +   +    + + CK      ++  Y+I++CT  ++G L   G   GH +H+FVDEAG A EPEI+IS+ G  N   GQ++LAGDP QLGP++RSP+A +  L  S L RL+   +LY+K         T F+   VT+LLQNYR+HP++LK+P+++FY+  L  C   +   ++  W+ LP    P++F GV GK+ R   +PS +N SE   ++ ++ +LL  Q    I K+  K+I +I PYR QV+ IR+ I    +  +L+   +LKV SVEEFQGQE +V+I+STVRSS     LD+  N                +GFL N++RFNV++TRA +LLI++G+P +L+ DE W   M Y+     + G
Sbjct:  345 TLESDLSFNNYMDRFDLLLYLEEDQMRMDIKRYNKKDVSMVRDRDKKLLVLELPGVSENRPSVLRGDHLLLTKSEELQNSNVTKYKGYVHRVELDQVKLGFSKRLLEHFIDNMKFSVEFTINRLPLRLQHRAVHMVVQHHLKDVLFP------------VASRSLNPVS------PSALRSLEK-------NPEQKTAVCNIVAGTSKPAPYLVFGPPGTGKTVTIVEAIKQVKLKNTGGARILACAPSNSAADQLGEKLITSQHVDARNIYRIYASSRNPKEIPKNNSNVEGENIIFPCKE-----DLMPYKIVVCTLVTAGRLVSGGFPVGHFSHIFVDEAGHAVEPEIVISVAGLLNAETGQLVLAGDPKQLGPILRSPFAIKYGLGLSLLERLMTQNELYQK-------GDTGFDNRYVTKLLQNYRSHPSILKVPNELFYDNELKACADEISSRQYCTWEHLPKRGFPVIFHGVVGKDERESTSPSFFNTSEIDKIMDYLKKLLLTQAKKGIAKISPKDIGIIAPYRKQVEKIRQAIKIHRELKSLSGIEELKVGSVEEFQGQERKVIIVSTVRSSKEHIILDDKFN----------------IGFLKNEKRFNVAVTRAKALLIMVGNPIILRTDEIWGRFMNYSIQEGGYTG 950          
BLAST of Mov10 like RISC complex RNA helicase 1 vs. Ensembl Zebrafish
Match: mov10b.2 (Moloney leukemia virus 10b, tandem duplicate 2 [Source:NCBI gene;Acc:555950])

HSP 1 Score: 362.073 bits (928), Expect = 2.094e-107
Identity = 239/663 (36.05%), Postives = 365/663 (55.05%), Query Frame = 1
Query: 1531 AVLKEKLGPGNYSKKMDLLVHLEEVNAKEEMKELVLENVRLMRRRDT--FGIEVPGLSEGRPSLMXXXXXXXXXXXXXXXT----FSGSIEDI-LCEVIFVKFHATLESSYRNE-ECTVSFSHSRLPFRRMHLGIELACGTLGDGILFPGKIDMKSSQCVRLSRAGLNELSGVNLMKENELRLVQLKFYNESLNELQRVAVVRILHGYSRPLPYVLFGPPGTGKTVTLVEAILQVYKNVASSRILVCAPSNSAADLLCLRLDESGVLETGEMVRMNAYRRS---ILSELSDKEPIPARVLPY-CKSVDDLAEVAMYRIIICTCTSSGALYRLGLKTGHITHVFVDEAGQASEPEIMISL-GFTNRCNGQIILAGDPMQLGPVIRSPYA--QQLQESYLHRLLLTCDLYKKQKEICAGSTTHFNPLIVTQLLQNYRAHPALLKLPSDMFYEGTLIPC---VVKNRFINWKWLPNPEVPLVFQGVRGKELRNPRNPSTYNPSEAVMVVRWIGRLL--QDTDNIGKLKDKNISVITPYRAQVDCIRKLISS---CLDNVNLAKLKVASVEEFQGQENEVVIISTVRS-----SLDESGNNGVHESFAILNMVGSRLGFLSNKRRFNVSITRACSLLIVIGDPGLLKYDECWSSLMKYAKTNNAFIG 3435
            ++L+  L   NY+++ DLL++LEE     ++K    ++V L R RD    G+ +PG+SE RPS++ GD + +    + + +    + G +  + L +V        L+  Y ++ +  V F+ +R+P R  H  + +A       +LFP            ++   LN +S         LRL   K      N  Q  AV  I+ G S+P PY++FGPPGTGKTVT+VEAI QV KN+  + IL CAPSNSAAD LC +L  S  ++  ++ R+ A  R+   I   L D   +   ++ + CK      ++  Y+I+ICT  ++G L   G    H TH+FVDEAG A E E +IS+ G  N   GQ++LAGDP QLGP++RSP A    L  S L RL+   DLYK+           F+   V++L+ NYR+HP +L++P+ +FY+G L  C   +  N++  W+ LP+   P++F GV GK+ R   +PS +N  E  ++V ++ +LL  Q    I ++  K+I +I PYR QV+ I++ I +     D + +  LKV SVEEFQGQE +V+++STVRS     SLDE+ N                +GFL N++RFNV++TRA SLLI++G+P +L+ DE W   + +      + G
Sbjct:  351 SLLQSPLTFDNYAERFDLLLYLEECQMHVDIKRYNKDSVTLHRDRDKRLMGLNLPGVSENRPSVLRGDHLLLTKSEEVTFSNVTKYKGYVHRVELDQVKLGLSKRFLKDVYIDKMKFRVEFTVNRIPVRLQHRAVHMAVQHNLKDVLFP------------VASRSLNPVS------PPALRLFDRKL---EYNFQQYSAVCNIVAGTSKPAPYLVFGPPGTGKTVTIVEAIKQVEKNIPDAYILACAPSNSAADQLCEKLITSEHVDAHKIYRLYASSRNQKDIPKILKDNCNVDEEIIDFPCKE-----DLMSYKILICTLVTAGRLVTGGFSEDHFTHIFVDEAGHAVESETIISVAGLLNAEKGQLVLAGDPKQLGPILRSPLAINHGLDVSLLERLMTQNDLYKR-------GDVEFDNRYVSKLIMNYRSHPYILEVPNRLFYDGELKACADEISSNQYCMWEHLPSKGFPVIFHGVPGKDERESNSPSFFNIYEINILVDYLKKLLLTQPKKGISRIFPKDIGIIAPYRKQVEKIKRAIDADKDFQDYMGIDNLKVGSVEEFQGQERKVIMVSTVRSSVKYISLDETFN----------------IGFLKNEKRFNVAVTRAKSLLIMVGNPMILRTDESWGRFIDFCLERGGYTG 964          
BLAST of Mov10 like RISC complex RNA helicase 1 vs. Ensembl Zebrafish
Match: mov10b.2 (Moloney leukemia virus 10b, tandem duplicate 2 [Source:NCBI gene;Acc:555950])

HSP 1 Score: 361.303 bits (926), Expect = 5.453e-107
Identity = 240/668 (35.93%), Postives = 366/668 (54.79%), Query Frame = 1
Query: 1516 IMGLYAVLKEKLGPGNYSKKMDLLVHLEEVNAKEEMKELVLENVRLMRRRDT--FGIEVPGLSEGRPSLMXXXXXXXXXXXXXXXT----FSGSIEDI-LCEVIFVKFHATLESSYRNE-ECTVSFSHSRLPFRRMHLGIELACGTLGDGILFPGKIDMKSSQCVRLSRAGLNELSGVNLMKENELRLVQLKFYNESLNELQRVAVVRILHGYSRPLPYVLFGPPGTGKTVTLVEAILQVYKNVASSRILVCAPSNSAADLLCLRLDESGVLETGEMVRMNAYRRS---ILSELSDKEPIPARVLPY-CKSVDDLAEVAMYRIIICTCTSSGALYRLGLKTGHITHVFVDEAGQASEPEIMISL-GFTNRCNGQIILAGDPMQLGPVIRSPYA--QQLQESYLHRLLLTCDLYKKQKEICAGSTTHFNPLIVTQLLQNYRAHPALLKLPSDMFYEGTLIPC---VVKNRFINWKWLPNPEVPLVFQGVRGKELRNPRNPSTYNPSEAVMVVRWIGRLL--QDTDNIGKLKDKNISVITPYRAQVDCIRKLISS---CLDNVNLAKLKVASVEEFQGQENEVVIISTVRS-----SLDESGNNGVHESFAILNMVGSRLGFLSNKRRFNVSITRACSLLIVIGDPGLLKYDECWSSLMKYAKTNNAFIG 3435
            +  L ++L+  L   NY+++ DLL++LEE     ++K    ++V L R RD    G+ +PG+SE RPS++ GD + +    + + +    + G +  + L +V        L+  Y ++ +  V F+ +R+P R  H  + +A       +LFP            ++   LN +S         LRL   K      N  Q  AV  I+ G S+P PY++FGPPGTGKTVT+VEAI QV KN+  + IL CAPSNSAAD LC +L  S  ++  ++ R+ A  R+   I   L D   +   ++ + CK      ++  Y+I+ICT  ++G L   G    H TH FVDEAG A E E +IS+ G  N   GQ++LAGDP QLGP++RSP A    L  S L RL+   DLYK+           F+   V++L+ NYR+HP +L++P+ +FY+G L  C   +  N++  W+ LP+   P++F GV GK+ R   +PS +N  E  ++V ++ +LL  Q    I ++  K+I +I PYR QV+ I++ I +     D + +  LKV SVEEFQGQE +V+++STVRS     SLDE+ N                +GFL N++RFNV++TRA SLLI++G+P +L+ DE W   + +      + G
Sbjct:  354 LKDLQSLLQSPLTFDNYAERFDLLLYLEECQMHVDIKRYNKDSVTLHRDRDKRLMGLNLPGVSENRPSVLRGDHLLLTKSEEVTFSNVTKYKGYVHRVELDQVKLGLSKRFLKDVYIDKMKFRVEFTVNRIPVRLQHRAVHMAVQHNLKDVLFP------------MASRSLNPVS------PPALRLFDRKL---EYNFQQYSAVCNIVAGTSKPAPYLVFGPPGTGKTVTIVEAIKQVEKNIPDAYILACAPSNSAADQLCEKLITSEHVDAHKIYRLYASSRNQKDIPKILKDNCNVDEEMIDFPCKE-----DLMSYKILICTLVTAGRLVTGGFSEDHFTHNFVDEAGHAVESETIISVAGLLNAEKGQLVLAGDPKQLGPILRSPLAINHGLDVSLLERLMTQNDLYKR-------GDVEFDNRYVSKLIMNYRSHPYILEVPNRLFYDGELKACADEISSNQYCMWEHLPSKGFPVIFHGVPGKDERESNSPSFFNIYEINILVDYLKKLLLTQPKKGISRIFPKDIGIIAPYRKQVEKIKRAIDADKDFQDYMGIDNLKVGSVEEFQGQERKVIMVSTVRSSVKYISLDETFN----------------IGFLKNEKRFNVAVTRAKSLLIMVGNPMILRTDESWGRFIDFCLERGGYTG 972          
BLAST of Mov10 like RISC complex RNA helicase 1 vs. Ensembl Xenopus
Match: rhebl1 (RHEB like 1 [Source:Xenbase;Acc:XB-GENE-493839])

HSP 1 Score: 492.271 bits (1266), Expect = 5.541e-154
Identity = 299/702 (42.59%), Postives = 410/702 (58.40%), Query Frame = 1
Query: 1450 PHKLKLYPIPEQLEQRVVNKEDIMGLYAVLKEKLGPGNYSKKMDLLVHLEEVNAKEEMKELVLENVRLMRRRDTFGIEVPGLSEGRPSLMX--XXXXXXXXXXXXXXTFSGSIEDILCEVIFVKFHATLESSYRNEECTVSFSHSRLPFRRMHLGIELACGTLGDGILFPGKIDMKSSQCV-----------RLSRAGLNELS-------GVNLMKENELRLVQLK---------------FYNESLNELQRVAVVRILHGYSRPLPYVLFGPPGTGKTVTLVEAILQVYKNVASSRILVCAPSNSAADLLCLRLDESGVLETGEMVRMNAYRRSILSELSDKEPIPARVLPYCKSVDDLAEVAMYRIIICTCTSSGALYRLGLKTGHITHVFVDEAGQASEPEIMISLGFTNRCNGQIILAGDPMQLGPVIRS--PYAQQLQESYLHRLLLTCDLYKKQKEICAGSTTHFNPLIVTQLLQNYRAHPALLKLPSDMFYEGTLIPC---VVKNRFINWKWLPNPEVPLVFQGVRGKELRNPRNPSTYNPSEAVMVVRWIGRLLQDTDNIGKLKDKNISVITPYRAQVDCIRKLISSCLDNVNLAKLKVASVEEFQGQENEVVIISTVRSSLDESGNNGVHESFAILNMVGSRLGFLSNKRRFNVSITRACSLLIVIGDPGLLKYDECWSSLMKYAKTNNAFIG 3435
            P  L LYPIP++L +    K DI+ L   L E L   NY K+M  L+ LE+++A+ E++E  L  V L +R     +EVPG++EGRP L       +  +     ++ F G I +I  E I ++ +  LE SY+ E   V F  +R+  RR    +E A   LG  +LFP  ++++S Q             +  + G  E +       G N +  +++  V  +               F+N  LN  Q++AV RIL G  RP PY+LFGPPGTGKTVT++EAILQ+Y  +  SRILVCAPSNSAADL+CLRL +S  LE G MVR+NA  R        +E +   V PYC   +D+ + + +RIII TC+S+G  Y++GL+ GH THVFVDEAGQASEPE +I LG  +   GQIILAGDPMQLGP+I+S    A  L  S+L RL+    LY + +E   G+  ++NPL++T+L++NYR+H ALL LPS +FY   L  C    V N+ + W  LP+   PL+F GVRG E+R   NPS +NPSEAV  +R+   L +       +  K+I VITPYR QV+ IR L    L   +L+ +KV SVEEFQGQE  V+IIS VRS  D      +HE    L      LGFL + +RFNV+ITR  +LLIV+G+P +L  D C  +L++Y+  N A+ G
Sbjct:  476 PSFLPLYPIPDRLRKCTEQKMDILALEPCLGEVLTLSNYRKRMSTLLWLEDIHAEMEIQEFSLSGVCLQKRGGFLLLEVPGIAEGRPFLNQGDKVFLKYQELTTTAIQFVGLIVEIHEEEITLRVNEELEQSYKFEPMDVEFVVNRVTSRRCQFAVEQA-EHLGQKVLFPDTVELQSPQVASRDTSEIDCPEKKEKTGYQETNQSNPTSRGKNAVYMSDMVTVATQTSTKGSGSPVKKKGQFFNNLLNNHQKLAVKRILGGECRPTPYILFGPPGTGKTVTIIEAILQIYYALPDSRILVCAPSNSAADLVCLRLHQSNQLEPGSMVRVNATCRL-------EETVCDAVRPYCGPGEDIRKASRFRIIISTCSSAGMFYQIGLRVGHFTHVFVDEAGQASEPECLIPLGLISEVTGQIILAGDPMQLGPIIKSRVSLAYGLNVSFLERLMAR-PLYLRDEE-SYGACGNYNPLLITKLMKNYRSHAALLHLPSKLFYHKELEVCADPAVVNKLLRWDKLPHKGFPLIFHGVRGTEMREGSNPSWFNPSEAVQAMRYCCVLAKHVTT--SVSAKDIGVITPYRKQVEKIRTL----LRTADLSDIKVGSVEEFQGQEFLVIIISMVRSCED-----SLHEDSRHL------LGFLCSPKRFNVAITRPKALLIVLGNPHVLVKDPCICALLEYSVINGAYTG 1150          
BLAST of Mov10 like RISC complex RNA helicase 1 vs. Ensembl Xenopus
Match: rhebl1 (RHEB like 1 [Source:Xenbase;Acc:XB-GENE-493839])

HSP 1 Score: 492.656 bits (1267), Expect = 2.362e-153
Identity = 299/702 (42.59%), Postives = 410/702 (58.40%), Query Frame = 1
Query: 1450 PHKLKLYPIPEQLEQRVVNKEDIMGLYAVLKEKLGPGNYSKKMDLLVHLEEVNAKEEMKELVLENVRLMRRRDTFGIEVPGLSEGRPSLMX--XXXXXXXXXXXXXXTFSGSIEDILCEVIFVKFHATLESSYRNEECTVSFSHSRLPFRRMHLGIELACGTLGDGILFPGKIDMKSSQCV-----------RLSRAGLNELS-------GVNLMKENELRLVQLK---------------FYNESLNELQRVAVVRILHGYSRPLPYVLFGPPGTGKTVTLVEAILQVYKNVASSRILVCAPSNSAADLLCLRLDESGVLETGEMVRMNAYRRSILSELSDKEPIPARVLPYCKSVDDLAEVAMYRIIICTCTSSGALYRLGLKTGHITHVFVDEAGQASEPEIMISLGFTNRCNGQIILAGDPMQLGPVIRS--PYAQQLQESYLHRLLLTCDLYKKQKEICAGSTTHFNPLIVTQLLQNYRAHPALLKLPSDMFYEGTLIPC---VVKNRFINWKWLPNPEVPLVFQGVRGKELRNPRNPSTYNPSEAVMVVRWIGRLLQDTDNIGKLKDKNISVITPYRAQVDCIRKLISSCLDNVNLAKLKVASVEEFQGQENEVVIISTVRSSLDESGNNGVHESFAILNMVGSRLGFLSNKRRFNVSITRACSLLIVIGDPGLLKYDECWSSLMKYAKTNNAFIG 3435
            P  L LYPIP++L +    K DI+ L   L E L   NY K+M  L+ LE+++A+ E++E  L  V L +R     +EVPG++EGRP L       +  +     ++ F G I +I  E I ++ +  LE SY+ E   V F  +R+  RR    +E A   LG  +LFP  ++++S Q             +  + G  E +       G N +  +++  V  +               F+N  LN  Q++AV RIL G  RP PY+LFGPPGTGKTVT++EAILQ+Y  +  SRILVCAPSNSAADL+CLRL +S  LE G MVR+NA  R        +E +   V PYC   +D+ + + +RIII TC+S+G  Y++GL+ GH THVFVDEAGQASEPE +I LG  +   GQIILAGDPMQLGP+I+S    A  L  S+L RL+    LY + +E   G+  ++NPL++T+L++NYR+H ALL LPS +FY   L  C    V N+ + W  LP+   PL+F GVRG E+R   NPS +NPSEAV  +R+   L +       +  K+I VITPYR QV+ IR L    L   +L+ +KV SVEEFQGQE  V+IIS VRS  D      +HE    L      LGFL + +RFNV+ITR  +LLIV+G+P +L  D C  +L++Y+  N A+ G
Sbjct:  556 PSFLPLYPIPDRLRKCTEQKMDILALEPCLGEVLTLSNYRKRMSTLLWLEDIHAEMEIQEFSLSGVCLQKRGGFLLLEVPGIAEGRPFLNQGDKVFLKYQELTTTAIQFVGLIVEIHEEEITLRVNEELEQSYKFEPMDVEFVVNRVTSRRCQFAVEQA-EHLGQKVLFPDTVELQSPQVASRDTSEIDCPEKKEKTGYQETNQSNPTSRGKNAVYMSDMVTVATQTSTKGSGSPVKKKGQFFNNLLNNHQKLAVKRILGGECRPTPYILFGPPGTGKTVTIIEAILQIYYALPDSRILVCAPSNSAADLVCLRLHQSNQLEPGSMVRVNATCRL-------EETVCDAVRPYCGPGEDIRKASRFRIIISTCSSAGMFYQIGLRVGHFTHVFVDEAGQASEPECLIPLGLISEVTGQIILAGDPMQLGPIIKSRVSLAYGLNVSFLERLMAR-PLYLRDEE-SYGACGNYNPLLITKLMKNYRSHAALLHLPSKLFYHKELEVCADPAVVNKLLRWDKLPHKGFPLIFHGVRGTEMREGSNPSWFNPSEAVQAMRYCCVLAKHVTT--SVSAKDIGVITPYRKQVEKIRTL----LRTADLSDIKVGSVEEFQGQEFLVIIISMVRSCED-----SLHEDSRHL------LGFLCSPKRFNVAITRPKALLIVLGNPHVLVKDPCICALLEYSVINGAYTG 1230          
BLAST of Mov10 like RISC complex RNA helicase 1 vs. Ensembl Xenopus
Match: rhebl1 (RHEB like 1 [Source:Xenbase;Acc:XB-GENE-493839])

HSP 1 Score: 476.478 bits (1225), Expect = 2.399e-149
Identity = 291/667 (43.63%), Postives = 393/667 (58.92%), Query Frame = 1
Query: 1450 PHKLKLYPIPEQLEQRVVNKEDIMGLYAVLKEKLGPGNYSKKMDLLVHLEEVNAKEEMKELVLENVRLMRRRDTFGIEVPGLSEGRPSLMXXXXXXXXXXXXXXXTFSGSIEDILCEVIFVKFHATLESSYRNEECTVSFSHSRLPFRRMHLGIELACGTLGDGILFPGKIDMKSSQCVRLSRAGLNELSGVNLMKENELRLVQLKFYNESLNELQRVAVVRILHGYSRPLPYVLFGPPGTGKTVTLVEAILQVYKNVASSRILVCAPSNSAADLLCLRLDESGVLETGEMVRMNAYRRSILSELSDKEPIPARVLPYCKSVDDLAEVAMYRIIICTCTSSGALYRLGLKTGHITHVFVDEAGQASEPEIMISLGFTNRCNGQIILAGDPMQLGPVIRS--PYAQQLQESYLHRLLLTCDLYKKQKEICAGSTTHFNPLIVTQLLQNYRAHPALLKLPSDMFYEGTLIPC---VVKNRFINWKWLPNPEVPLVFQGVRGKELRNPRNPSTYNPSEAVMVVRWIGRLLQDTDNIGKLKDKNISVITPYRAQVDCIRKLISSCLDNVNLAKLKVASVEEFQGQENEVVIISTVRSSLDESGNNGVHESFAILNMVGSRLGFLSNKRRFNVSITRACSLLIVIGDPGLLKYDECWSSLMKYAKTNNAFIG 3435
            P  L LYPIP++L +    K DI+ L   L E L   NY K+M  L+ LE+++A+ E++E  L  V L +R     +EVPG++EGRP L          +G+ ++  SG    I  E I ++ +  LE SY+ E   V F  +R+  RR    +E A             +  K +  +R S     +  G              +F+N  LN  Q++AV RIL G  RP PY+LFGPPGTGKTVT++EAILQ+Y  +  SRILVCAPSNSAADL+CLRL +S  LE G MVR+NA  R        +E +   V PYC   +D+ + + +RIII TC+S+G  Y++GL+ GH THVFVDEAGQASEPE +I LG  +   GQIILAGDPMQLGP+I+S    A  L  S+L RL+    LY + +E   G+  ++NPL++T+L++NYR+H ALL LPS +FY   L  C    V N+ + W  LP+   PL+F GVRG E+R   NPS +NPSEAV  +R+   L +       +  K+I VITPYR QV+ IR L    L   +L+ +KV SVEEFQGQE  V+IIS VRS  D      +HE    L      LGFL + +RFNV+ITR  +LLIV+G+P +L  D C  +L++Y+  N A+ G
Sbjct:  415 PSFLPLYPIPDRLRKCTEQKMDILALEPCLGEVLTLSNYRKRMSTLLWLEDIHAEMEIQEFSLSGVCLQKRGGFLLLEVPGIAEGRPFL---------NQGNLALLLSGGF-CIHEEEITLRVNEELEQSYKFEPMDVEFVVNRVTSRRCQFAVEQA-----------EHLGQKGNYRIRYSFGSPVKKKG--------------QFFNNLLNNHQKLAVKRILGGECRPTPYILFGPPGTGKTVTIIEAILQIYYALPDSRILVCAPSNSAADLVCLRLHQSNQLEPGSMVRVNATCRL-------EETVCDAVRPYCGPGEDIRKASRFRIIISTCSSAGMFYQIGLRVGHFTHVFVDEAGQASEPECLIPLGLISEVTGQIILAGDPMQLGPIIKSRVSLAYGLNVSFLERLMAR-PLYLRDEE-SYGACGNYNPLLITKLMKNYRSHAALLHLPSKLFYHKELEVCADPAVVNKLLRWDKLPHKGFPLIFHGVRGTEMREGSNPSWFNPSEAVQAMRYCCVLAKHVTT--SVSAKDIGVITPYRKQVEKIRTL----LRTADLSDIKVGSVEEFQGQEFLVIIISMVRSCED-----SLHEDSRHL------LGFLCSPKRFNVAITRPKALLIVLGNPHVLVKDPCICALLEYSVINGAYTG 1020          
BLAST of Mov10 like RISC complex RNA helicase 1 vs. Ensembl Xenopus
Match: rhebl1 (RHEB like 1 [Source:Xenbase;Acc:XB-GENE-493839])

HSP 1 Score: 476.093 bits (1224), Expect = 8.919e-149
Identity = 291/667 (43.63%), Postives = 393/667 (58.92%), Query Frame = 1
Query: 1450 PHKLKLYPIPEQLEQRVVNKEDIMGLYAVLKEKLGPGNYSKKMDLLVHLEEVNAKEEMKELVLENVRLMRRRDTFGIEVPGLSEGRPSLMXXXXXXXXXXXXXXXTFSGSIEDILCEVIFVKFHATLESSYRNEECTVSFSHSRLPFRRMHLGIELACGTLGDGILFPGKIDMKSSQCVRLSRAGLNELSGVNLMKENELRLVQLKFYNESLNELQRVAVVRILHGYSRPLPYVLFGPPGTGKTVTLVEAILQVYKNVASSRILVCAPSNSAADLLCLRLDESGVLETGEMVRMNAYRRSILSELSDKEPIPARVLPYCKSVDDLAEVAMYRIIICTCTSSGALYRLGLKTGHITHVFVDEAGQASEPEIMISLGFTNRCNGQIILAGDPMQLGPVIRS--PYAQQLQESYLHRLLLTCDLYKKQKEICAGSTTHFNPLIVTQLLQNYRAHPALLKLPSDMFYEGTLIPC---VVKNRFINWKWLPNPEVPLVFQGVRGKELRNPRNPSTYNPSEAVMVVRWIGRLLQDTDNIGKLKDKNISVITPYRAQVDCIRKLISSCLDNVNLAKLKVASVEEFQGQENEVVIISTVRSSLDESGNNGVHESFAILNMVGSRLGFLSNKRRFNVSITRACSLLIVIGDPGLLKYDECWSSLMKYAKTNNAFIG 3435
            P  L LYPIP++L +    K DI+ L   L E L   NY K+M  L+ LE+++A+ E++E  L  V L +R     +EVPG++EGRP L          +G+ ++  SG    I  E I ++ +  LE SY+ E   V F  +R+  RR    +E A             +  K +  +R S     +  G              +F+N  LN  Q++AV RIL G  RP PY+LFGPPGTGKTVT++EAILQ+Y  +  SRILVCAPSNSAADL+CLRL +S  LE G MVR+NA  R        +E +   V PYC   +D+ + + +RIII TC+S+G  Y++GL+ GH THVFVDEAGQASEPE +I LG  +   GQIILAGDPMQLGP+I+S    A  L  S+L RL+    LY + +E   G+  ++NPL++T+L++NYR+H ALL LPS +FY   L  C    V N+ + W  LP+   PL+F GVRG E+R   NPS +NPSEAV  +R+   L +       +  K+I VITPYR QV+ IR L    L   +L+ +KV SVEEFQGQE  V+IIS VRS  D      +HE    L      LGFL + +RFNV+ITR  +LLIV+G+P +L  D C  +L++Y+  N A+ G
Sbjct:  463 PSFLPLYPIPDRLRKCTEQKMDILALEPCLGEVLTLSNYRKRMSTLLWLEDIHAEMEIQEFSLSGVCLQKRGGFLLLEVPGIAEGRPFL---------NQGNLALLLSGGF-CIHEEEITLRVNEELEQSYKFEPMDVEFVVNRVTSRRCQFAVEQA-----------EHLGQKGNYRIRYSFGSPVKKKG--------------QFFNNLLNNHQKLAVKRILGGECRPTPYILFGPPGTGKTVTIIEAILQIYYALPDSRILVCAPSNSAADLVCLRLHQSNQLEPGSMVRVNATCRL-------EETVCDAVRPYCGPGEDIRKASRFRIIISTCSSAGMFYQIGLRVGHFTHVFVDEAGQASEPECLIPLGLISEVTGQIILAGDPMQLGPIIKSRVSLAYGLNVSFLERLMAR-PLYLRDEE-SYGACGNYNPLLITKLMKNYRSHAALLHLPSKLFYHKELEVCADPAVVNKLLRWDKLPHKGFPLIFHGVRGTEMREGSNPSWFNPSEAVQAMRYCCVLAKHVTT--SVSAKDIGVITPYRKQVEKIRTL----LRTADLSDIKVGSVEEFQGQEFLVIIISMVRSCED-----SLHEDSRHL------LGFLCSPKRFNVAITRPKALLIVLGNPHVLVKDPCICALLEYSVINGAYTG 1068          
BLAST of Mov10 like RISC complex RNA helicase 1 vs. Ensembl Xenopus
Match: rhebl1 (RHEB like 1 [Source:Xenbase;Acc:XB-GENE-493839])

HSP 1 Score: 413.305 bits (1061), Expect = 5.629e-126
Identity = 268/670 (40.00%), Postives = 370/670 (55.22%), Query Frame = 1
Query: 1450 PHKLKLYPIPEQLEQRVVNKEDIMGLYAVLKEKLGPGNYSKKMDLLVHLEEVNAKEEMKELVLENVRLMRRRDTFGIEVPGLSEGRPSLMX--XXXXXXXXXXXXXXTFSGSIEDILCEVIFVKFHATLESSYRNEECTVSFSHSRLPFRRMHLGIELACGTLGDGILFPGKIDMKSSQCVRLSRAGLNELSGVNLMKENELRLVQLKFYNESLNELQRVAVVRILHGYSRPLPYVLFGPPGTGKTVTLVEAILQVYKNVASSRILVCAPSNSAADLLCLRLDESGVLETGEMVRMNAYRRSILSELSDKEPIPARVLPYCKSVDDLAEVAMYRIIICTCTSSGALYRLGLKTGHITHVFVDEAGQASEPEIMISLGFTNRCNGQIILAGDPMQLGPVIRS--PYAQQLQESYLHRLLLTCDLYKKQKEICAGSTTHFNPLIVTQ--LLQNYRAHPALL--KLPSDMFYEGTLIPCVVKNRFINWKWLPNPEVPLVFQGVRGKELRNPRNPSTYNPSEAVMVVRWIGRLLQDTDNIGKLKDKNISVITPYRAQVDCIRKLISSCLDNVNLAKLKVASVEEFQGQENEVVIISTVRSSLDESGNNGVHESFAILNMVGSRLGFLSNKRRFNVSITRACSLLIVIGDPGLLKYDECWSSLMKYAKTNNAFIG 3435
            P  L LYPIP++L +    K DI+ L   L E L   NY K+M  L+ LE+++A+ E++E  L  V L +R     +EVPG++EGRP L       +  +     ++ F G I +I  E I ++ +  LE SY+ E   V F  +R+  RR    +E A             +  K +  +R S     +  G              +F+N  LN  Q++AV RIL G  RP PY+LFGPPGTGKTVT++EAILQ+Y  +  SRILVCAPSNSAADL+CLRL +S  LE G MVR+NA  R        +E +   V PYC   +D+ + + +RIII TC+S+G  Y++GL+ GH THVFVDEAGQASEPE +I LG  +   GQIILAGDPMQLGP+I+S    A  L  S+L RL+    LY + +E   G+  ++NPL+V +  L+  + +  A++   L S  +Y+                              +G E+R   NPS +NPSEAV  +R+   L +       +  K+I VITPYR QV+ IR L    L   +L+ +KV SVEEFQGQE  V+IIS VRS  D    +  H            LGFL + +RFNV+ITR  +LLIV+G+P +L  D C  +L++Y+  N A+ G
Sbjct:  409 PSFLPLYPIPDRLRKCTEQKMDILALEPCLGEVLTLSNYRKRMSTLLWLEDIHAEMEIQEFSLSGVCLQKRGGFLLLEVPGIAEGRPFLNQGDKVFLKYQELTTTAIQFVGLIVEIHEEEITLRVNEELEQSYKFEPMDVEFVVNRVTSRRCQFAVEQA-----------EHLGQKGNYRIRYSFGSPVKKKG--------------QFFNNLLNNHQKLAVKRILGGECRPTPYILFGPPGTGKTVTIIEAILQIYYALPDSRILVCAPSNSAADLVCLRLHQSNQLEPGSMVRVNATCRL-------EETVCDAVRPYCGPGEDIRKASRFRIIISTCSSAGMFYQIGLRVGHFTHVFVDEAGQASEPECLIPLGLISEVTGQIILAGDPMQLGPIIKSRVSLAYGLNVSFLERLMAR-PLYLRDEE-SYGACGNYNPLLVLKAILICCFHSELAVMYETLDSFTYYD------------------------------KGTEMREGSNPSWFNPSEAVQAMRYCCVLAKHVTT--SVSAKDIGVITPYRKQVEKIRTL----LRTADLSDIKVGSVEEFQGQEFLVIIISMVRSCEDSLHEDSRH-----------LLGFLCSPKRFNVAITRPKALLIVLGNPHVLVKDPCICALLEYSVINGAYTG 997          
BLAST of Mov10 like RISC complex RNA helicase 1 vs. Ensembl Mouse
Match: Mov10l1 (Mov10 like RISC complex RNA helicase 1 [Source:MGI Symbol;Acc:MGI:1891384])

HSP 1 Score: 415.231 bits (1066), Expect = 2.591e-125
Identity = 225/464 (48.49%), Postives = 305/464 (65.73%), Query Frame = 1
Query: 2065 KFYNESLNELQRVAVVRILHGYSRPLPYVLFGPPGTGKTVTLVEAILQVYKNVASSRILVCAPSNSAADLLCLRLDESGVLETGEMVRMNAYRRSILSELSDKEPIPARVLPYCKSVDDLAEVAMYRIIICTCTSSGALYRLGLKTGHITHVFVDEAGQASEPEIMISLGFTNRCNGQIILAGDPMQLGPVIRSPYAQQ--LQESYLHRLLLTCDLYKKQKEICAGSTTHFNPLIVTQLLQNYRAHPALLKLPSDMFYEGTLIPCV---VKNRFINWKWLPNPEVPLVFQGVRGKELRNPRNPSTYNPSEAVMVVRWIGRLLQDTDNIGKLKDKNISVITPYRAQVDCIRKLISSCLDNVNLAKLKVASVEEFQGQENEVVIISTVRSSLDESGNNGVHESFAILNMVGSRLGFLSNKRRFNVSITRACSLLIVIGDPGLLKYDECWSSLMKYAKTNNAFIGSE 3441
            +F+N  LNE Q++AV RIL G  RPLPY+LFGPPGTGKTVT++EA+LQV+  +  SRILVCAPSNSAADL+CLRL ES VL+   MVR+NA  R        +E I   + PYC+  +D+   + +RIII TC+S+G  Y++G++ G+ THVFVDEAGQASEPE +I LG  +  NGQI+LAGDPMQLGPVI+S  A    L  S L RL+      + +     G+   +NPL+VT+L++NYR+H ALL LPS +FY   L  C    V    + W+ LP    PL+F GVRG E R  R+PS ++P+EAV V+R+   L +   +  ++  K+I VITPYR QV+ I+ L    L NV+L  +KV SVEEFQGQE  V++ISTVRS+ D   ++               LGFLSN +RFNV+ITR  +LLI++G+P +L  D C+ +L++Y+ +N  + G +
Sbjct:  741 EFFNPVLNENQKLAVRRILSGDCRPLPYILFGPPGTGKTVTIIEAVLQVHYALPDSRILVCAPSNSAADLVCLRLHESKVLKPAAMVRVNATCRF-------EETIIDAIKPYCRDGEDIWRASRFRIIITTCSSAGLFYQIGVRVGYFTHVFVDEAGQASEPECLIPLGLISDINGQIVLAGDPMQLGPVIKSRLAMAYGLNVSMLERLMSRPAYLRDENAF--GACGAYNPLLVTKLVKNYRSHSALLALPSRLFYHRELEVCADPKVVTSLLGWEKLPRKGFPLIFHGVRGNEAREGRSPSWFSPAEAVQVMRYCCLLARSVSS--QVSSKDIGVITPYRKQVEKIKIL----LRNVDLTDIKVGSVEEFQGQEYLVIVISTVRSNEDRFEDDRYF------------LGFLSNSKRFNVAITRPKALLIILGNPHVLVRDPCFGALLEYSVSNGVYTGCD 1177          

HSP 2 Score: 91.2781 bits (225), Expect = 4.923e-18
Identity = 65/179 (36.31%), Postives = 99/179 (55.31%), Query Frame = 1
Query: 1450 PHKLKLYPIPEQLEQRVVNKEDIMGLYAVLKEKLGPGNYSKKMDLLVHLEEVNAKEEMKELVLENVRLMRRRDTFGIEVPGLSEGRPSLMXXXXXXXXXXXXXXXT--FSGSIEDILCEVIFVKFHATLESSYRNEECTVSFSHSRLPFRRMHLGIELACGTLGDGILFPGKIDMKSSQ 1980
            P  L  YPIP++L++ V  K DI+    +L E L   NY +K   L+ LEE++A+ E+KE  +  V L R+ D   +EVPGL+E RPSL  GDK+ +K +  +     + G + +I  E + +K +   E  Y  E   V F+++R   RR H  +E     LG  +LFP +I ++S Q
Sbjct:  432 PSFLPQYPIPDRLKKCVEQKIDILTFQPLLAELLNMSNYKEKFSTLLWLEEIHAEIELKEYNMSRVVLKRKGDLLVLEVPGLAESRPSLYAGDKLILKSQEYNGHVIEYIGYVMEIHEEDVTLKLNPGFEQMYNFEPMDVEFTYNRTTSRRCHYALEQVI-HLGVKVLFPEEIILQSPQ 609          
BLAST of Mov10 like RISC complex RNA helicase 1 vs. Ensembl Mouse
Match: Mov10l1 (Mov10 like RISC complex RNA helicase 1 [Source:MGI Symbol;Acc:MGI:1891384])

HSP 1 Score: 415.616 bits (1067), Expect = 5.189e-125
Identity = 225/464 (48.49%), Postives = 305/464 (65.73%), Query Frame = 1
Query: 2065 KFYNESLNELQRVAVVRILHGYSRPLPYVLFGPPGTGKTVTLVEAILQVYKNVASSRILVCAPSNSAADLLCLRLDESGVLETGEMVRMNAYRRSILSELSDKEPIPARVLPYCKSVDDLAEVAMYRIIICTCTSSGALYRLGLKTGHITHVFVDEAGQASEPEIMISLGFTNRCNGQIILAGDPMQLGPVIRSPYAQQ--LQESYLHRLLLTCDLYKKQKEICAGSTTHFNPLIVTQLLQNYRAHPALLKLPSDMFYEGTLIPCV---VKNRFINWKWLPNPEVPLVFQGVRGKELRNPRNPSTYNPSEAVMVVRWIGRLLQDTDNIGKLKDKNISVITPYRAQVDCIRKLISSCLDNVNLAKLKVASVEEFQGQENEVVIISTVRSSLDESGNNGVHESFAILNMVGSRLGFLSNKRRFNVSITRACSLLIVIGDPGLLKYDECWSSLMKYAKTNNAFIGSE 3441
            +F+N  LNE Q++AV RIL G  RPLPY+LFGPPGTGKTVT++EA+LQV+  +  SRILVCAPSNSAADL+CLRL ES VL+   MVR+NA  R        +E I   + PYC+  +D+   + +RIII TC+S+G  Y++G++ G+ THVFVDEAGQASEPE +I LG  +  NGQI+LAGDPMQLGPVI+S  A    L  S L RL+      + +     G+   +NPL+VT+L++NYR+H ALL LPS +FY   L  C    V    + W+ LP    PL+F GVRG E R  R+PS ++P+EAV V+R+   L +   +  ++  K+I VITPYR QV+ I+ L    L NV+L  +KV SVEEFQGQE  V++ISTVRS+ D   ++               LGFLSN +RFNV+ITR  +LLI++G+P +L  D C+ +L++Y+ +N  + G +
Sbjct:  793 EFFNPVLNENQKLAVRRILSGDCRPLPYILFGPPGTGKTVTIIEAVLQVHYALPDSRILVCAPSNSAADLVCLRLHESKVLKPAAMVRVNATCRF-------EETIIDAIKPYCRDGEDIWRASRFRIIITTCSSAGLFYQIGVRVGYFTHVFVDEAGQASEPECLIPLGLISDINGQIVLAGDPMQLGPVIKSRLAMAYGLNVSMLERLMSRPAYLRDENAF--GACGAYNPLLVTKLVKNYRSHSALLALPSRLFYHRELEVCADPKVVTSLLGWEKLPRKGFPLIFHGVRGNEAREGRSPSWFSPAEAVQVMRYCCLLARSVSS--QVSSKDIGVITPYRKQVEKIKIL----LRNVDLTDIKVGSVEEFQGQEYLVIVISTVRSNEDRFEDDRYF------------LGFLSNSKRFNVAITRPKALLIILGNPHVLVRDPCFGALLEYSVSNGVYTGCD 1229          

HSP 2 Score: 91.6633 bits (226), Expect = 4.694e-18
Identity = 65/179 (36.31%), Postives = 99/179 (55.31%), Query Frame = 1
Query: 1450 PHKLKLYPIPEQLEQRVVNKEDIMGLYAVLKEKLGPGNYSKKMDLLVHLEEVNAKEEMKELVLENVRLMRRRDTFGIEVPGLSEGRPSLMXXXXXXXXXXXXXXXT--FSGSIEDILCEVIFVKFHATLESSYRNEECTVSFSHSRLPFRRMHLGIELACGTLGDGILFPGKIDMKSSQ 1980
            P  L  YPIP++L++ V  K DI+    +L E L   NY +K   L+ LEE++A+ E+KE  +  V L R+ D   +EVPGL+E RPSL  GDK+ +K +  +     + G + +I  E + +K +   E  Y  E   V F+++R   RR H  +E     LG  +LFP +I ++S Q
Sbjct:  484 PSFLPQYPIPDRLKKCVEQKIDILTFQPLLAELLNMSNYKEKFSTLLWLEEIHAEIELKEYNMSRVVLKRKGDLLVLEVPGLAESRPSLYAGDKLILKSQEYNGHVIEYIGYVMEIHEEDVTLKLNPGFEQMYNFEPMDVEFTYNRTTSRRCHYALEQVI-HLGVKVLFPEEIILQSPQ 661          
BLAST of Mov10 like RISC complex RNA helicase 1 vs. Ensembl Mouse
Match: Mov10 (Mov10 RISC complex RNA helicase [Source:MGI Symbol;Acc:MGI:97054])

HSP 1 Score: 352.443 bits (903), Expect = 6.577e-104
Identity = 228/618 (36.89%), Postives = 332/618 (53.72%), Query Frame = 1
Query: 1678 IEVPGLSEGRPSLMX----XXXXXXXXXXXXXXTFSGSIEDILCEVIFVKFHATLESSYRNE-ECTVSFSHSRLPFRRMHLGIELACGTLGDGILFPGKIDMKSSQCVRLSRAGLNELSGVNLMKENELRLVQLKFYNESL--NELQRVAVVRILHGYSRPLPYVLFGPPGTGKTVTLVEAILQVYKNVASSRILVCAPSNSAADLLCLRLDESGVLETGEMVRMNAYRRSILSELSDKEPIPARVLPYCKSVDDLAE--------VAMYRIIICTCTSSGALYRLGLKTGHITHVFVDEAGQASEPEIMISLGF------TNRCNGQIILAGDPMQLGPVIRSPYA--QQLQESYLHRLLLTCDLYKKQKEICAGSTTHFNPLIVTQLLQNYRAHPALLKLPSDMFYEGTLIPC---VVKNRFINWKWLPNPEVPLVFQGVRGKELRNPRNPSTYNPSEAVMVVRWIGRLLQDTDNIGK--LKDKNISVITPYRAQVD----CIRKLISSCLDNVNLAKLKVASVEEFQGQENEVVIISTVRSSLDESGNNGVHESFAILNMVGSRLGFLSNKRRFNVSITRACSLLIVIGDPGLLKYDECWSSLMKYAKTNNAFIG 3435
            +EVPG++E RPS++        ++ + + DD VT+ G +  +  + + + F  +L S + +     V+F+ +R P R  H  +EL     G  +L+P    + S               GV+L+  +    V+ K Y+ SL  N  Q  A+  I+ G +RP PY++FGPPGTGKTVTLVEAI QV K++  + IL CAPSNS ADLLC RL           V + +    +L+   D   +P  +   C       E        +  YR++I T  ++  L        H TH+F+DEAG   EPE ++++        T    GQ++LAGDP QLGPV+RSP A    L  S L RLL    LYKK           ++P  +T+LL+NYR+HP +L +P+ ++Y+G L  C   V + RF  W+ LP    P++F GV GK+ R   +PS +NP EA  V  ++ +LL  +   GK  L  +N+ VI+PYR QV+    CI KL        ++  LKV SVEEFQGQE  V++ISTVRSS          +SF  L++    LGFL N +RFNV++TRA +LLIV+G+P LL +D  W + +++ K N  + G
Sbjct:  380 LEVPGVAESRPSVLRGDHLFALLSSETQQDDPVTYKGFVHKVELDRVKLSFSTSLLSRFVDGLTFKVNFTFNRQPLRVQHRALELT----GRWVLWPMLFPVASR--------------GVSLLPSD----VKFKLYDRSLESNPEQLQAMKHIVRGTTRPAPYIIFGPPGTGKTVTLVEAIKQVVKHLPKAHILACAPSNSGADLLCQRL----------RVHLPSSIYRLLAPSRDIRMVPEDIKTCCNWDAKKGEYVYPAKKHLQQYRVLITTLITASRLVSAQFPIDHFTHIFIDEAGHCMEPESLVAIAGLMDVKETGNPGGQLVLAGDPRQLGPVLRSPLALKHGLGYSLLERLLAYNSLYKK-------GPNGYDPQFITKLLRNYRSHPTILDIPNQLYYDGELQACADVVDRERFCRWEGLPQQGFPIIFHGVMGKDEREGNSPSFFNPEEAATVTSYLKQLLAPSSKKGKARLSPRNVGVISPYRKQVEKIRYCITKLDRELRGLDDIKDLKVGSVEEFQGQERSVILISTVRSS----------QSFVQLDL-DFNLGFLKNPKRFNVAVTRAKALLIVVGNPLLLGHDPDWKTFLEFCKENGGYTG 947          
BLAST of Mov10 like RISC complex RNA helicase 1 vs. Ensembl Mouse
Match: Mov10 (Mov10 RISC complex RNA helicase [Source:MGI Symbol;Acc:MGI:97054])

HSP 1 Score: 352.443 bits (903), Expect = 6.985e-104
Identity = 228/618 (36.89%), Postives = 332/618 (53.72%), Query Frame = 1
Query: 1678 IEVPGLSEGRPSLMX----XXXXXXXXXXXXXXTFSGSIEDILCEVIFVKFHATLESSYRNE-ECTVSFSHSRLPFRRMHLGIELACGTLGDGILFPGKIDMKSSQCVRLSRAGLNELSGVNLMKENELRLVQLKFYNESL--NELQRVAVVRILHGYSRPLPYVLFGPPGTGKTVTLVEAILQVYKNVASSRILVCAPSNSAADLLCLRLDESGVLETGEMVRMNAYRRSILSELSDKEPIPARVLPYCKSVDDLAE--------VAMYRIIICTCTSSGALYRLGLKTGHITHVFVDEAGQASEPEIMISLGF------TNRCNGQIILAGDPMQLGPVIRSPYA--QQLQESYLHRLLLTCDLYKKQKEICAGSTTHFNPLIVTQLLQNYRAHPALLKLPSDMFYEGTLIPC---VVKNRFINWKWLPNPEVPLVFQGVRGKELRNPRNPSTYNPSEAVMVVRWIGRLLQDTDNIGK--LKDKNISVITPYRAQVD----CIRKLISSCLDNVNLAKLKVASVEEFQGQENEVVIISTVRSSLDESGNNGVHESFAILNMVGSRLGFLSNKRRFNVSITRACSLLIVIGDPGLLKYDECWSSLMKYAKTNNAFIG 3435
            +EVPG++E RPS++        ++ + + DD VT+ G +  +  + + + F  +L S + +     V+F+ +R P R  H  +EL     G  +L+P    + S               GV+L+  +    V+ K Y+ SL  N  Q  A+  I+ G +RP PY++FGPPGTGKTVTLVEAI QV K++  + IL CAPSNS ADLLC RL           V + +    +L+   D   +P  +   C       E        +  YR++I T  ++  L        H TH+F+DEAG   EPE ++++        T    GQ++LAGDP QLGPV+RSP A    L  S L RLL    LYKK           ++P  +T+LL+NYR+HP +L +P+ ++Y+G L  C   V + RF  W+ LP    P++F GV GK+ R   +PS +NP EA  V  ++ +LL  +   GK  L  +N+ VI+PYR QV+    CI KL        ++  LKV SVEEFQGQE  V++ISTVRSS          +SF  L++    LGFL N +RFNV++TRA +LLIV+G+P LL +D  W + +++ K N  + G
Sbjct:  380 LEVPGVAESRPSVLRGDHLFALLSSETQQDDPVTYKGFVHKVELDRVKLSFSTSLLSRFVDGLTFKVNFTFNRQPLRVQHRALELT----GRWVLWPMLFPVASR--------------GVSLLPSD----VKFKLYDRSLESNPEQLQAMKHIVRGTTRPAPYIIFGPPGTGKTVTLVEAIKQVVKHLPKAHILACAPSNSGADLLCQRL----------RVHLPSSIYRLLAPSRDIRMVPEDIKTCCNWDAKKGEYVYPAKKHLQQYRVLITTLITASRLVSAQFPIDHFTHIFIDEAGHCMEPESLVAIAGLMDVKETGNPGGQLVLAGDPRQLGPVLRSPLALKHGLGYSLLERLLAYNSLYKK-------GPNGYDPQFITKLLRNYRSHPTILDIPNQLYYDGELQACADVVDRERFCRWEGLPQQGFPIIFHGVMGKDEREGNSPSFFNPEEAATVTSYLKQLLAPSSKKGKARLSPRNVGVISPYRKQVEKIRYCITKLDRELRGLDDIKDLKVGSVEEFQGQERSVILISTVRSS----------QSFVQLDL-DFNLGFLKNPKRFNVAVTRAKALLIVVGNPLLLGHDPDWKTFLEFCKENGGYTG 947          
BLAST of Mov10 like RISC complex RNA helicase 1 vs. Ensembl Mouse
Match: Mov10 (Mov10 RISC complex RNA helicase [Source:MGI Symbol;Acc:MGI:97054])

HSP 1 Score: 352.443 bits (903), Expect = 2.680e-103
Identity = 228/618 (36.89%), Postives = 332/618 (53.72%), Query Frame = 1
Query: 1678 IEVPGLSEGRPSLMX----XXXXXXXXXXXXXXTFSGSIEDILCEVIFVKFHATLESSYRNE-ECTVSFSHSRLPFRRMHLGIELACGTLGDGILFPGKIDMKSSQCVRLSRAGLNELSGVNLMKENELRLVQLKFYNESL--NELQRVAVVRILHGYSRPLPYVLFGPPGTGKTVTLVEAILQVYKNVASSRILVCAPSNSAADLLCLRLDESGVLETGEMVRMNAYRRSILSELSDKEPIPARVLPYCKSVDDLAE--------VAMYRIIICTCTSSGALYRLGLKTGHITHVFVDEAGQASEPEIMISLGF------TNRCNGQIILAGDPMQLGPVIRSPYA--QQLQESYLHRLLLTCDLYKKQKEICAGSTTHFNPLIVTQLLQNYRAHPALLKLPSDMFYEGTLIPC---VVKNRFINWKWLPNPEVPLVFQGVRGKELRNPRNPSTYNPSEAVMVVRWIGRLLQDTDNIGK--LKDKNISVITPYRAQVD----CIRKLISSCLDNVNLAKLKVASVEEFQGQENEVVIISTVRSSLDESGNNGVHESFAILNMVGSRLGFLSNKRRFNVSITRACSLLIVIGDPGLLKYDECWSSLMKYAKTNNAFIG 3435
            +EVPG++E RPS++        ++ + + DD VT+ G +  +  + + + F  +L S + +     V+F+ +R P R  H  +EL     G  +L+P    + S               GV+L+  +    V+ K Y+ SL  N  Q  A+  I+ G +RP PY++FGPPGTGKTVTLVEAI QV K++  + IL CAPSNS ADLLC RL           V + +    +L+   D   +P  +   C       E        +  YR++I T  ++  L        H TH+F+DEAG   EPE ++++        T    GQ++LAGDP QLGPV+RSP A    L  S L RLL    LYKK           ++P  +T+LL+NYR+HP +L +P+ ++Y+G L  C   V + RF  W+ LP    P++F GV GK+ R   +PS +NP EA  V  ++ +LL  +   GK  L  +N+ VI+PYR QV+    CI KL        ++  LKV SVEEFQGQE  V++ISTVRSS          +SF  L++    LGFL N +RFNV++TRA +LLIV+G+P LL +D  W + +++ K N  + G
Sbjct:  453 LEVPGVAESRPSVLRGDHLFALLSSETQQDDPVTYKGFVHKVELDRVKLSFSTSLLSRFVDGLTFKVNFTFNRQPLRVQHRALELT----GRWVLWPMLFPVASR--------------GVSLLPSD----VKFKLYDRSLESNPEQLQAMKHIVRGTTRPAPYIIFGPPGTGKTVTLVEAIKQVVKHLPKAHILACAPSNSGADLLCQRL----------RVHLPSSIYRLLAPSRDIRMVPEDIKTCCNWDAKKGEYVYPAKKHLQQYRVLITTLITASRLVSAQFPIDHFTHIFIDEAGHCMEPESLVAIAGLMDVKETGNPGGQLVLAGDPRQLGPVLRSPLALKHGLGYSLLERLLAYNSLYKK-------GPNGYDPQFITKLLRNYRSHPTILDIPNQLYYDGELQACADVVDRERFCRWEGLPQQGFPIIFHGVMGKDEREGNSPSFFNPEEAATVTSYLKQLLAPSSKKGKARLSPRNVGVISPYRKQVEKIRYCITKLDRELRGLDDIKDLKVGSVEEFQGQERSVILISTVRSS----------QSFVQLDL-DFNLGFLKNPKRFNVAVTRAKALLIVVGNPLLLGHDPDWKTFLEFCKENGGYTG 1020          
BLAST of Mov10 like RISC complex RNA helicase 1 vs. UniProt/SwissProt
Match: sp|Q9BXT6|M10L1_HUMAN (RNA helicase Mov10l1 OS=Homo sapiens OX=9606 GN=MOV10L1 PE=2 SV=1)

HSP 1 Score: 486.108 bits (1250), Expect = 1.591e-150
Identity = 302/712 (42.42%), Postives = 419/712 (58.85%), Query Frame = 1
Query: 1450 PHKLKLYPIPEQLEQRVVNKEDIMGLYAVLKEKLGPGNYSKKMDLLVHLEEVNAKEEMKELVLENVRLMRRRDTFGIEVPGLSEGRPSLMXXXXXXXXXXXX--XXXTFSGSIEDILCEVIFVKFHATLESSYRNEECTVSFSHSRLPFRRMHLGIELACGTLGDGILFPGKIDMKSSQCV-RLSRAGLNELSGVNLMKEN------------ELRLV----------------------------QLKFYNESLNELQRVAVVRILHGYSRPLPYVLFGPPGTGKTVTLVEAILQVYKNVASSRILVCAPSNSAADLLCLRLDESGVLETGEMVRMNAYRRSILSELSDKEPIPARVLPYCKSVDDLAEVAMYRIIICTCTSSGALYRLGLKTGHITHVFVDEAGQASEPEIMISLGFTNRCNGQIILAGDPMQLGPVIRSPYAQQ--LQESYLHRLLLTCDLYKKQKEICAGSTTHFNPLIVTQLLQNYRAHPALLKLPSDMFYEGTLIPCV---VKNRFINWKWLPNPEVPLVFQGVRGKELRNPRNPSTYNPSEAVMVVRWIGRLLQDTDNIGKLKDKNISVITPYRAQVDCIRKLISSCLDNVNLAKLKVASVEEFQGQENEVVIISTVRSSLDESGNNGVHESFAILNMVGSRLGFLSNKRRFNVSITRACSLLIVIGDPGLLKYDECWSSLMKYAKTNNAFIGSE 3441
            P  L  YPIP++L + V  K DI+    +L E L   NY +K   L+ LEE+ A+ E+KE  +  + L R  D   +EVPGL+EGRPSL  GDK+ +K +     ++ +   + +I  E + +K +   E +Y  E   V F+++R   RR H  +E     LG  +LFP +I ++S Q     + A   + SG +  K+N            E R V                            +++F+N  LNE Q++AV RIL G  RPLPY+LFGPPGTGKTVT++EA+LQV+  +  SRILVCAPSNSAADL+CLRL ES VL+   MVR+NA  R        +E +   V PYC+  +D+ + + +RIII TC+SSG  Y++G++ GH THVFVDEAGQASEPE +I LG  +  +GQI+LAGDPMQLGPVI+S  A    L  S+L R L++   Y++ +        H NPL+VT+L++NYR+H ALL LPS +FY   L  C    V    + W+ LP    PL+F GVRG E R  ++PS +NP+EAV V+R+   L     +  ++   +I VITPYR QV+ IR L    L NV+L  +KV SVEEFQGQE  V+IISTVRS+ D   ++               LGFLSN +RFNV+ITR  +LLIV+G+P +L  D C+ +L++Y+ TN  ++G +
Sbjct:  492 PSFLPQYPIPDRLRKCVEQKIDILTFQPLLAELLNMSNYKEKFSTLLWLEEIYAEMELKEYNMSGIILRRNGDLLVLEVPGLAEGRPSLYAGDKLILKTQEYNGHAIEYISYVTEIHEEDVTLKINPEFEQAYNFEPMDVEFTYNRTTSRRCHFALEHVI-HLGVKVLFPEEIILQSPQVTGNWNHAQDTKSSGQSTSKKNRKTMTDQAEHGTEERRVGDKDLPVLAPFTAEMSDWVDEIQTPKARKMEFFNPVLNENQKLAVKRILSGDCRPLPYILFGPPGTGKTVTIIEAVLQVHFALPDSRILVCAPSNSAADLVCLRLHESKVLQPATMVRVNATCRF-------EEIVIDAVKPYCRDGEDIWKASRFRIIITTCSSSGLFYQIGVRVGHFTHVFVDEAGQASEPECLIPLGLMSDISGQIVLAGDPMQLGPVIKSRLAMAYGLNVSFLER-LMSRPAYQRDENAFGACGAH-NPLLVTKLVKNYRSHEALLMLPSRLFYHRELEVCADPTVVTSLLGWEKLPKKGFPLIFHGVRGSEAREGKSPSWFNPAEAVQVLRYCCLLAHSISS--QVSASDIGVITPYRKQVEKIRIL----LRNVDLMDIKVGSVEEFQGQEYLVIIISTVRSNEDRFEDDRYF------------LGFLSNSKRFNVAITRPKALLIVLGNPHVLVRDPCFGALLEYSITNGVYMGCD 1175          
BLAST of Mov10 like RISC complex RNA helicase 1 vs. UniProt/SwissProt
Match: sp|Q99MV5|M10L1_MOUSE (RNA helicase Mov10l1 OS=Mus musculus OX=10090 GN=Mov10l1 PE=1 SV=1)

HSP 1 Score: 413.305 bits (1061), Expect = 1.224e-123
Identity = 224/464 (48.28%), Postives = 304/464 (65.52%), Query Frame = 1
Query: 2065 KFYNESLNELQRVAVVRILHGYSRPLPYVLFGPPGTGKTVTLVEAILQVYKNVASSRILVCAPSNSAADLLCLRLDESGVLETGEMVRMNAYRRSILSELSDKEPIPARVLPYCKSVDDLAEVAMYRIIICTCTSSGALYRLGLKTGHITHVFVDEAGQASEPEIMISLGFTNRCNGQIILAGDPMQLGPVIRSPYAQQ--LQESYLHRLLLTCDLYKKQKEICAGSTTHFNPLIVTQLLQNYRAHPALLKLPSDMFYEGTLIPCV---VKNRFINWKWLPNPEVPLVFQGVRGKELRNPRNPSTYNPSEAVMVVRWIGRLLQDTDNIGKLKDKNISVITPYRAQVDCIRKLISSCLDNVNLAKLKVASVEEFQGQENEVVIISTVRSSLDESGNNGVHESFAILNMVGSRLGFLSNKRRFNVSITRACSLLIVIGDPGLLKYDECWSSLMKYAKTNNAFIGSE 3441
            +F+N  LNE Q++AV RIL G  RPLPY+LFGPPGTGKTVT++EA+LQV+  +  SRILVCAPSNSAADL+CLRL ES V +   MVR+NA  R        +E I   + PYC+  +D+   + +RIII TC+S+G  Y++G++ G+ THVFVDEAGQASEPE +I LG  +  NGQI+LAGDPMQLGPVI+S  A    L  S L RL+      + +     G+   +NPL+VT+L++NYR+H ALL LPS +FY   L  C    V    + W+ LP    PL+F GVRG E R  R+PS ++P+EAV V+R+   L +   +  ++  K+I VITPYR QV+ I+ L    L NV+L  +KV SVEEFQGQE  V++ISTVRS+ D   ++               LGFLSN +RFNV+ITR  +LLI++G+P +L  D C+ +L++Y+ +N  + G +
Sbjct:  741 EFFNPVLNENQKLAVRRILSGDCRPLPYILFGPPGTGKTVTIIEAVLQVHYALPDSRILVCAPSNSAADLVCLRLHESKVPKPAAMVRVNATCRF-------EETIIDAIKPYCRDGEDIWRASRFRIIITTCSSAGLFYQIGVRVGYFTHVFVDEAGQASEPECLIPLGLISDINGQIVLAGDPMQLGPVIKSRLAMAYGLNVSMLERLMSRPAYLRDENAF--GACGAYNPLLVTKLVKNYRSHSALLALPSRLFYHRELEVCADPKVVTSLLGWEKLPRKGFPLIFHGVRGNEAREGRSPSWFSPAEAVQVMRYCCLLARSVSS--QVSSKDIGVITPYRKQVEKIKIL----LRNVDLTDIKVGSVEEFQGQEYLVIVISTVRSNEDRFEDDRYF------------LGFLSNSKRFNVAITRPKALLIILGNPHVLVRDPCFGALLEYSVSNGVYTGCD 1177          

HSP 2 Score: 91.2781 bits (225), Expect = 4.258e-17
Identity = 65/179 (36.31%), Postives = 99/179 (55.31%), Query Frame = 1
Query: 1450 PHKLKLYPIPEQLEQRVVNKEDIMGLYAVLKEKLGPGNYSKKMDLLVHLEEVNAKEEMKELVLENVRLMRRRDTFGIEVPGLSEGRPSLMXXXXXXXXXXXXXXXT--FSGSIEDILCEVIFVKFHATLESSYRNEECTVSFSHSRLPFRRMHLGIELACGTLGDGILFPGKIDMKSSQ 1980
            P  L  YPIP++L++ V  K DI+    +L E L   NY +K   L+ LEE++A+ E+KE  +  V L R+ D   +EVPGL+E RPSL  GDK+ +K +  +     + G + +I  E + +K +   E  Y  E   V F+++R   RR H  +E     LG  +LFP +I ++S Q
Sbjct:  432 PSFLPQYPIPDRLKKCVEQKIDILTFQPLLAELLNMSNYKEKFSTLLWLEEIHAEIELKEYNMSRVVLKRKGDLLVLEVPGLAESRPSLYAGDKLILKSQEYNGHVIEYIGYVMEIHEEDVTLKLNPGFEQMYNFEPMDVEFTYNRTTSRRCHYALEQVI-HLGVKVLFPEEIILQSPQ 609          
BLAST of Mov10 like RISC complex RNA helicase 1 vs. UniProt/SwissProt
Match: sp|Q5ZKD7|MOV10_CHICK (Putative helicase MOV-10 OS=Gallus gallus OX=9031 GN=MOV10 PE=2 SV=1)

HSP 1 Score: 378.637 bits (971), Expect = 8.424e-113
Identity = 257/715 (35.94%), Postives = 387/715 (54.13%), Query Frame = 1
Query: 1423 LRSVLTKVYPHKLKLYPIPEQLEQRVV------NKEDIMGLYAVLKEKLGPGNYSKKMDLLVHLEEVNAKEEMKELVLENVRLMRRRDTFGIEVPGLSEGRPSLMXXXXXXXXXXXXXXXT----FSGSIEDILCEVIFVKFHATLESSYRNE-ECTVSFSHSRLPFRRMHLGIELACGTLGDGILFPGKIDMKSSQCVRLSRAGLNELSGVNLMKENELRLVQLKFYNESL--NELQRVAVVRILHGYSRPLPYVLFGPPGTGKTVTLVEAILQVYKNVASSRILVCAPSNSAADLLCLRLDESGVLETGEMVRMNAYRRSILSELSDKEPIPARVLPYCKSVDDLAEVAM---------YRIIICTCTSSGALYRLGLKTGHITHVFVDEAGQASEPEIMISLGF--------TNRCNGQIILAGDPMQLGPVIRSPYAQQ--LQESYLHRLLLTCDLYKKQKEICAGSTTHFNPLIVTQLLQNYRAHPALLKLPSDMFYEGTLIPCV-----VKNRFINWKWLPNPEVPLVFQGVRGKELRNPRNPSTYNPSEAVMVVRWIGRLLQDTDNIG--KLKDKNISVITPYRAQVDCIRKLISSCLDNV-----NLAKLKVASVEEFQGQENEVVIISTVRSSLDESGNNGVHESFAILNMVGSRLGFLSNKRRFNVSITRACSLLIVIGDPGLLKYDECWSSLMKYAKTNNAFIG 3435
            L++ L K  P  L  YP P+ L++ ++           M + ++L+  L P NY +K +LL+HLEE+  + +++   L+ V +++ R    + VPG++E RPS++ GD +   +  +   +    + G +  +  E + + F   L   + N+ +  V+F+ +RLP +  H    +A     D +LFP      S+ C R    G+                 Q ++++  +  NE Q  AV  I+ G SRP PY++FGPPGTGKTVTLVEAI QV+     +RIL CAPSNSAADLLC RL          +     YR  I++  ++ + +PA V P C + DD  +  +         YRI+I T  ++G L       G+ +HVF+DE G A EPE ++++          TN   GQ++LAGDP QLGPV RSP A Q  L  S L RL+L   LY K  E        +NP  VT+LL NYR+H A+LK+P+++FY+  L         V+N +  W+ LPN  VP++F GV G++ R  ++PS +N +E  +VV+++ +LLQ     G   +  K I +I+PYR QV+ IR  I+S  D V     ++ +LKV SVEEFQGQE  V++ISTVRS    S    + ++F        RLGFL N +R NV++TRA +LLIV+G+  +L  D  W   ++Y +   A+ G
Sbjct:  282 LKNELEKEIP--LGTYPYPKSLKETIMLGPKTSPDSSWMKMQSLLEAPLQPENYKQKFELLLHLEEIQLEVDIRRYDLQEVPMVQNRALLLLNVPGVAENRPSVLRGDHLFASLSSERDSSPRVLYKGYVHGVELERVQLGFSPKLMKKFVNDLKFDVTFTFNRLPLQVQHRAAAMAMQKGLDSVLFP------SASCQRSLFTGI----------------FQPRWFDRKVEANEEQCQAVKHIVTGMSRPAPYLIFGPPGTGKTVTLVEAIKQVWSCFKDARILACAPSNSAADLLCQRL-------LTNIAPRYIYR--IMASSANYKDVPADVRPCC-NWDDSEKCYVYPSKKLLKPYRILITTLVTAGRLVSANFPPGYFSHVFIDECGHAVEPESVVAIAGLLTTMDPDTNPNGGQLVLAGDPQQLGPVPRSPLAAQHGLGTSLLERLMLHNALYAKSDE-------GYNPQFVTKLLWNYRSHKAILKVPNELFYDSELKAYEGSEPDVRNFYCTWEELPNRGVPIIFHGVCGEDEREAKSPSFFNTAEIEVVVQYLQKLLQSQGRRGCPTISPKEIGIISPYRKQVEKIRLAITS-KDPVLRALPDIGQLKVGSVEEFQGQERRVILISTVRSC---SEYLQLDQTF--------RLGFLKNPKRLNVALTRAKALLIVVGNAAVLSKDPHWHRFLRYCRDEGAYRG 943          
BLAST of Mov10 like RISC complex RNA helicase 1 vs. UniProt/SwissProt
Match: sp|Q1LXK4|M10B1_DANRE (Putative helicase mov-10-B.1 OS=Danio rerio OX=7955 GN=mov10b.1 PE=2 SV=2)

HSP 1 Score: 377.096 bits (967), Expect = 6.046e-112
Identity = 243/661 (36.76%), Postives = 366/661 (55.37%), Query Frame = 1
Query: 1534 VLKEKLGPGNYSKKMDLLVHLEEVNAKEEMKELVLENVRLMRRRDT--FGIEVPGLSEGRPSLMXXXXXXXXXXXXXXXT----FSGSIEDILCEVIFVKFHATL-ESSYRNEECTVSFSHSRLPFRRMHLGIELACGTLGDGILFPGKIDMKSSQCVRLSRAGLNELSGVNLMKENELRLVQLKFYNESLNELQRVAVVRILHGYSRPLPYVLFGPPGTGKTVTLVEAILQVYKNVASSRILVCAPSNSAADLLCLRLDESGVLETGEMVRMNAYRRS---ILSELSDKEPIPARVLPY-CKSVDDLAEVAMYRIIICTCTSSGALYRLGLKTGHITHVFVDEAGQASEPEIMISL-GFTNRCNGQIILAGDPMQLGPVIRSPYAQQ--LQESYLHRLLLTCDLYKKQKEICAGSTTHFNPLIVTQLLQNYRAHPALLKLPSDMFYEGTLIPC---VVKNRFINWKWLPNPEVPLVFQGVRGKELRNPRNPSTYNPSEAVMVVRWIGRLL--QDTDNIGKLKDKNISVITPYRAQVDCIRKLISSCLDNVNLA---KLKVASVEEFQGQENEVVIISTVRSS-----LDESGNNGVHESFAILNMVGSRLGFLSNKRRFNVSITRACSLLIVIGDPGLLKYDECWSSLMKYAKTNNAFIG 3435
             L+  L   NY  + DLL++LEE   + ++K    ++V ++R RD     +E+PG+SE RPS++ GD + +    +   +    + G +  +  + + + F   L E    N + +V F+ +RLP R  H  + +        +LFP            ++   LN +S       + LRL   K      N  Q+ AV  I+ G S+P PY++FGPPGTGKTVT+VEAI QV KN   +RIL CAPSNSAAD L  +L  S  ++   + R+ A  R+   I   L +   +    + + CK      ++  Y+I++CT  ++G L   G   GH +H+FVDEAG A EPEI+IS+ G  N   GQ++LAGDP QLGP++RSP+A +  L  S L RL+   +LY+K         T F+   VT+LLQNYR+HP++LK+P+++FY+  L  C   +   ++  W+ LP    P++F GV GK+ R   +PS +N SE   ++ ++ +LL  Q    I K+  K+I +I PYR QV+ IR+ I    +  +L+   +LKV SVEEFQGQE +V+I+STVRSS     LD+  N                +GFL N++RFNV++TRA +LLI++G+P +L+ DE W   M Y      + G
Sbjct:  356 TLESDLSFNNYMDRFDLLLYLEEDQMRMDIKRYNKKDVSMVRDRDKKLLVLELPGVSENRPSVLRGDHLLLTKSEELQNSNVTKYKGYVHRVELDQVKLGFSKRLLERFIDNMKFSVEFTINRLPLRLQHRAVHMVVQHHLKDVLFP------------VASRRLNPVS------PSALRLFDQKLEK---NPEQKTAVCNIVAGTSKPAPYLVFGPPGTGKTVTIVEAIKQVEKNTGGARILACAPSNSAADQLGEKLITSQHVDARNIYRIYASSRNPKEIPKVLENNSNVEGENIIFPCKE-----DLMPYKIVVCTLVTAGRLVSGGFPVGHFSHIFVDEAGHAVEPEIVISVAGLLNAETGQLVLAGDPKQLGPILRSPFAIKYGLGLSLLERLMTQNELYQK-------GDTGFDNRYVTKLLQNYRSHPSILKVPNELFYDNELKACADEISSRQYCTWEHLPKRGFPVIFHGVVGKDERESTSPSFFNTSEIDKIMDYLKKLLLTQAKKGIAKISPKDIGIIAPYRKQVEKIRQAIKIHRELKSLSGIEELKVGSVEEFQGQERKVIIVSTVRSSKEHIILDDKFN----------------IGFLKNEKRFNVAVTRAKALLIMVGNPIILRTDEIWGRFMNYCIQERGYTG 967          
BLAST of Mov10 like RISC complex RNA helicase 1 vs. UniProt/SwissProt
Match: sp|Q1LXK5|M10B2_DANRE (Putative helicase mov-10-B.2 OS=Danio rerio OX=7955 GN=mov10b.2 PE=3 SV=1)

HSP 1 Score: 361.303 bits (926), Expect = 4.117e-106
Identity = 240/668 (35.93%), Postives = 366/668 (54.79%), Query Frame = 1
Query: 1516 IMGLYAVLKEKLGPGNYSKKMDLLVHLEEVNAKEEMKELVLENVRLMRRRDT--FGIEVPGLSEGRPSLMXXXXXXXXXXXXXXXT----FSGSIEDI-LCEVIFVKFHATLESSYRNE-ECTVSFSHSRLPFRRMHLGIELACGTLGDGILFPGKIDMKSSQCVRLSRAGLNELSGVNLMKENELRLVQLKFYNESLNELQRVAVVRILHGYSRPLPYVLFGPPGTGKTVTLVEAILQVYKNVASSRILVCAPSNSAADLLCLRLDESGVLETGEMVRMNAYRRS---ILSELSDKEPIPARVLPY-CKSVDDLAEVAMYRIIICTCTSSGALYRLGLKTGHITHVFVDEAGQASEPEIMISL-GFTNRCNGQIILAGDPMQLGPVIRSPYA--QQLQESYLHRLLLTCDLYKKQKEICAGSTTHFNPLIVTQLLQNYRAHPALLKLPSDMFYEGTLIPC---VVKNRFINWKWLPNPEVPLVFQGVRGKELRNPRNPSTYNPSEAVMVVRWIGRLL--QDTDNIGKLKDKNISVITPYRAQVDCIRKLISS---CLDNVNLAKLKVASVEEFQGQENEVVIISTVRS-----SLDESGNNGVHESFAILNMVGSRLGFLSNKRRFNVSITRACSLLIVIGDPGLLKYDECWSSLMKYAKTNNAFIG 3435
            +  L ++L+  L   NY+++ DLL++LEE     ++K    ++V L R RD    G+ +PG+SE RPS++ GD + +    + + +    + G +  + L +V        L+  Y ++ +  V F+ +R+P R  H  + +A       +LFP            ++   LN +S         LRL   K      N  Q  AV  I+ G S+P PY++FGPPGTGKTVT+VEAI QV KN+  + IL CAPSNSAAD LC +L  S  ++  ++ R+ A  R+   I   L D   +   ++ + CK      ++  Y+I+ICT  ++G L   G    H TH FVDEAG A E E +IS+ G  N   GQ++LAGDP QLGP++RSP A    L  S L RL+   DLYK+           F+   V++L+ NYR+HP +L++P+ +FY+G L  C   +  N++  W+ LP+   P++F GV GK+ R   +PS +N  E  ++V ++ +LL  Q    I ++  K+I +I PYR QV+ I++ I +     D + +  LKV SVEEFQGQE +V+++STVRS     SLDE+ N                +GFL N++RFNV++TRA SLLI++G+P +L+ DE W   + +      + G
Sbjct:  354 LKDLQSLLQSPLTFDNYAERFDLLLYLEECQMHVDIKRYNKDSVTLHRDRDKRLMGLNLPGVSENRPSVLRGDHLLLTKSEEVTFSNVTKYKGYVHRVELDQVKLGLSKRFLKDVYIDKMKFRVEFTVNRIPVRLQHRAVHMAVQHNLKDVLFP------------MASRSLNPVS------PPALRLFDRKL---EYNFQQYSAVCNIVAGTSKPAPYLVFGPPGTGKTVTIVEAIKQVEKNIPDAYILACAPSNSAADQLCEKLITSEHVDAHKIYRLYASSRNQKDIPKILKDNCNVDEEMIDFPCKE-----DLMSYKILICTLVTAGRLVTGGFSEDHFTHNFVDEAGHAVESETIISVAGLLNAEKGQLVLAGDPKQLGPILRSPLAINHGLDVSLLERLMTQNDLYKR-------GDVEFDNRYVSKLIMNYRSHPYILEVPNRLFYDGELKACADEISSNQYCMWEHLPSKGFPVIFHGVPGKDERESNSPSFFNIYEINILVDYLKKLLLTQPKKGISRIFPKDIGIIAPYRKQVEKIKRAIDADKDFQDYMGIDNLKVGSVEEFQGQERKVIMVSTVRSSVKYISLDETFN----------------IGFLKNEKRFNVAVTRAKSLLIMVGNPMILRTDESWGRFIDFCLERGGYTG 972          
BLAST of Mov10 like RISC complex RNA helicase 1 vs. TrEMBL
Match: A0A0M3RSS3 (Moloney leukemia virus 10-like 1-like protein OS=Macrostomum lignano OX=282301 PE=2 SV=1)

HSP 1 Score: 563.918 bits (1452), Expect = 2.223e-178
Identity = 368/1078 (34.14%), Postives = 546/1078 (50.65%), Query Frame = 1
Query:  469 NKIEQLPQKQ------VGMITYACNDNL---TFNNEIKFHQRDCGPNSFRPSKGDWVVVQYDHSVDYYSIIGLSPLRYLDFEGVISSFDGNIGYVDREIFFNKSIT--KGVRLSRGVYVYGTAIESVQNRRCNFRALTIFCKMSSNVNKG---LQM-RLKTMNKIENGIKT---------PHNLGLRLNPKAVEFGEQNINETRSKEVTITNENDFPMTLTGIALLSETNNQFVI--ENCGKEMKISGNSSLKVSVKCVPQFPGFDTQKLFIEGLNKDSTESTESWKLMLDVSVYVFDPV-----LSSISLEGTEKEP----GDKXXXXXXXXXXXXXXMGGVHHLSAAAPVK-LRSVLTKVYPHKLKLYPIPEQLEQRVVN-------------------KEDIMGLYAVLKEKLGPGN-YSKKMDLLVHLEEVNAKEEMKELVLENVRLMRR---RDTFGIEVPGLSEGRPSLM-----------XXXXXXXXXXXXXXXTFSGSIEDILCEVIFVKFHATLESSY-----RNEECT--VSFSHSRLPFRRMHLGIELA--CGTLGDGILFP--GKIDMKSSQ-CVRLSRAGLNELSGVNLMKENELRLVQLKFYNESLNELQRVAVVRILHGYSRPLPYVLFGPPGTGKTVTLVEAILQVYKNVASSRILVCAPSNSAADLLCLRLDESGVLETGEMVRMNAYRRSILSELSDKEPIPARVLPYCKSVDDLAEVAMYRIIICTCTSSGALYRLGLKTGHITHVFVDEAGQASEPEIMISLGFTNRCNGQIILAGDPMQLGPVIRSPYAQQ--LQESYLHRLLLTCDLYKKQKEICAGSTTH--FNPLIVTQLLQNYRAHPALLKLPSDMFYEGTLIPCV---VKNRFINWKWLPNPEVPLVFQGVRGKELRNPRNPSTYNPSEAVMVVRWIGRLLQDTDNIGKLKDKNISVITPYRAQVDCIRKLISSCLDNVNLAKLKVASVEEFQGQENEVVIISTVRSSLDESGNNGVHESFAILNMVGSRLGFLSNKRRFNVSITRACSLLIVIGDPGLLKYDECWSSLMKYAKTNNAFIG 3435
            N++ QL  +Q      +  I  +CN         N ++F      P S+RP  GDWV  + D + +   +  + PLR + F G ++S   + GY + E++F+      +  RL RG  V+G AIESVQ+R CN+RA+ +          G    QM  L TM   E+ + T         PH  G++  P    F   ++     ++V+ITN  D P+   G  + S TN+QF +  E     + +S   S+++ ++C+ + PG DTQ   +E            + + L ++V V DP+     L S +   T   P    G  +  ++    S     G V        V+  R   T   PH+L  +  P  + + ++                    +  ++  +  L E L PG  Y+ K+  L+HLEE+     +++  L+   L      R    +EVPGL+EGRPSL+              ++           + G + ++ C    +KFH  L S+          CT  V F  +R  +RR H  + LA    +L    LFP     D+K  Q C R                        L+F+N  LNE QR AV R+L G  RP PYV+FGPPGTGKTVTLVE  LQ+   +  SR+LVCAPSNSAAD L  RL  SG +  G++VR+NA RR  +  ++      A V P     D L   AM+R+++ TC ++G L+ L L+ GH TH  +DEAGQA+EPE+++ +   +    Q++LAGDPMQLGPV++SP+AQ+  L ES LHRLL +   Y +    C G      ++PL+VT+LLQNYR+HP LL++ S +FY   LIPCV     NRF+ W  LPNP +PL+F GV G++ R   +PS +NP+E V+V R++  LL     +  ++D  I V+TPYR Q + IR ++ +     +   ++VASVEEFQGQE + +++STVRS  D    +  H           RLGFL++ RRFNVS++RA  LL+V+G+P LL  D CW +L++YA  N  ++G
Sbjct:   87 NRLAQLEARQKPKPSNLVTIVSSCNQRSRTGVLENSLEFSMELAWPESYRPFVGDWVTAELDWTEEQAKVTRVQPLRMMRFSGRVTSMAASHGYANGEVYFHAGAVQPRAQRLRRGDPVHGVAIESVQSRTCNYRAVVVHLGEEDQAQTGNTWSQMWDLGTMVPHESHLLTVSAGSSLTDPHAAGVQFQPPICNFSRASLGSDLERKVSITNAGDEPIVWLGARVDSTTNDQFCVVKEEGDARLTVSPGDSVEMLIRCLCRLPGTDTQLCIVE---------FAEFSVGLSLTVTVADPLCDSGPLQSAASSATTPRPYASFGRGARRHVAGFDSQIYDTGDVDSARVLPGVRPARGPETIRLPHRLGQHQPPPSMARLILGAGDGDGDGDDNKDDDEAEIERRLLAGWPSLAEPLSPGRCYAAKLSALLHLEELAEALSLRQYSLDLAMLEPAGPGRQYLALEVPGLAEGRPSLLFGDKVRARPNASLQQLEALNSRPADPGYEGYVHELRCSQALLKFHPHLHSALAQTLLSQSPCTFSVQFCVNRTGYRRCHHAVSLAGSSSSLPWPTLFPELDSADVKPPQACCR-----------------------SLEFFNSRLNERQRCAVRRVLAGRRRPRPYVVFGPPGTGKTVTLVECALQLLNRLPDSRLLVCAPSNSAADQLADRLLASGRVSAGQLVRLNAARRKDVESVTTPAVAAASVGP-----DRLGRAAMHRVLVATCVTTGWLHGLRLRRGHFTHALIDEAGQATEPELLLPISLASE---QVVLAGDPMQLGPVVQSPWAQKFGLGESLLHRLLESSPAYAR----CPGRYPDDGYDPLLVTKLLQNYRSHPGLLQVYSSLFYHSELIPCVDPASGNRFLTWPSLPNPHLPLLFHGVIGEDRREGDSPSWFNPAETVLVTRYVIDLLAHWPGLADVED-GIGVVTPYRKQAEKIRAMLLA----TDSPDVRVASVEEFQGQERQAIVLSTVRSQPDLLAFDRQH-----------RLGFLASPRRFNVSVSRAAGLLVVVGNPHLLAADPCWLALIRYALDNGCYVG 1104          
BLAST of Mov10 like RISC complex RNA helicase 1 vs. TrEMBL
Match: A0A267GAQ5 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig010313g1 PE=4 SV=1)

HSP 1 Score: 563.918 bits (1452), Expect = 2.560e-178
Identity = 369/1078 (34.23%), Postives = 546/1078 (50.65%), Query Frame = 1
Query:  469 NKIEQLPQKQ------VGMITYACNDNL---TFNNEIKFHQRDCGPNSFRPSKGDWVVVQYDHSVDYYSIIGLSPLRYLDFEGVISSFDGNIGYVDREIFFNKSIT--KGVRLSRGVYVYGTAIESVQNRRCNFRALTIFCKMSSNVNKG---LQM-RLKTMNKIENGIKT---------PHNLGLRLNPKAVEFGEQNINETRSKEVTITNENDFPMTLTGIALLSETNNQFVI--ENCGKEMKISGNSSLKVSVKCVPQFPGFDTQKLFIEGLNKDSTESTESWKLMLDVSVYVFDPV-----LSSISLEGTEKEP----GDKXXXXXXXXXXXXXXMGGVHHLSAAAPVK-LRSVLTKVYPHKLKLYPIPEQLEQRVVN-------------------KEDIMGLYAVLKEKLGPGN-YSKKMDLLVHLEEVNAKEEMKELVLENVRLMRR---RDTFGIEVPGLSEGRPSLM-----------XXXXXXXXXXXXXXXTFSGSIEDILCEVIFVKFHATLESSY-----RNEECT--VSFSHSRLPFRRMHLGIELA--CGTLGDGILFP--GKIDMKSSQ-CVRLSRAGLNELSGVNLMKENELRLVQLKFYNESLNELQRVAVVRILHGYSRPLPYVLFGPPGTGKTVTLVEAILQVYKNVASSRILVCAPSNSAADLLCLRLDESGVLETGEMVRMNAYRRSILSELSDKEPIPARVLPYCKSVDDLAEVAMYRIIICTCTSSGALYRLGLKTGHITHVFVDEAGQASEPEIMISLGFTNRCNGQIILAGDPMQLGPVIRSPYAQQ--LQESYLHRLLLTCDLYKKQKEICAGSTTH--FNPLIVTQLLQNYRAHPALLKLPSDMFYEGTLIPCV---VKNRFINWKWLPNPEVPLVFQGVRGKELRNPRNPSTYNPSEAVMVVRWIGRLLQDTDNIGKLKDKNISVITPYRAQVDCIRKLISSCLDNVNLAKLKVASVEEFQGQENEVVIISTVRSSLDESGNNGVHESFAILNMVGSRLGFLSNKRRFNVSITRACSLLIVIGDPGLLKYDECWSSLMKYAKTNNAFIG 3435
            N++ QL  +Q      +  I  +CN         N ++F      P S+RP  GDWV  + D + +   +  + PLR + F G ++S   + GY + E++F+      +  RL RG  V+G AIESVQ+R CN+RA+ +          G    QM  L TM   E+ + T         PH  G++  P    F   ++     ++V+ITN  D P+   G  + S TN+QF +  E     + +S   S+++ ++C+ + PG DTQ   +E            + + L ++V V DP+     L S +   T   P    G  +  ++    S     G V        V+  R   T   PH+L  +  P  + + ++                    +  ++  +  L E L PG  Y+ K+  L+HLEE+     +++  L+   L      R    +EVPGL+EGRPSL+              ++           + G + ++ C    +KFH  L S+          CT  V F  +R  +RR H  + LA    +L    LFP     D+K  Q C R                        L+F+N  LNE QR AV RIL G  RP PYV+FGPPGTGKTVTLVE  LQ+   +  SR+LVCAPSNSAAD L  RL  SG +  G++VR+NA RR  +  ++      A V P     D L   AM+R+++ TC ++G L+ L L+ GH TH  +DEAGQA+EPE+++ +   +    Q++LAGDPMQLGPV++SP+AQ+  L ES LHRLL +   Y +    C G      ++PL+VT+LLQNYR+HP LL++ S +FY   LIPCV     NRF+ W  LPNP +PL+F GV G + R   +PS +NP+E V+V R++  LL     +  ++D  I V+TPYR Q + IR ++ +     +   ++VASVEEFQGQE + +++STVRS  D    +  H           RLGFL++ RRFNVS++RA  LL+V+G+P LL  D CW +L++YA  N+ ++G
Sbjct:   94 NRLAQLEARQKPKPSNLVTIVSSCNQRSRTGVLENSLEFSMELAWPESYRPFVGDWVTAELDWTEEQAKVTRVQPLRMMRFSGRVTSMAASHGYANGEVYFHAGAVQPRAQRLRRGDPVHGVAIESVQSRTCNYRAVVVHLGEEDQAQTGNTWSQMWDLGTMVPHESHLLTVSAGSSLTDPHAAGVQFQPPICNFSRASLGSDLERKVSITNAGDEPIVWLGARVDSTTNDQFCVVKEEGDARLTVSPGDSVEMLIRCLCRLPGTDTQLCIVE---------FAEFSVGLSLTVTVADPLCDSGPLQSAASSATTPRPYASFGRGARRHVAGFDSQIYDTGDVDSARVLPGVRPARGPETIRLPHRLGQHQPPPSMARLILGAGDGDGDGDDNKDDDEAEIERRLLAGWPSLAEPLSPGRCYAAKLSALLHLEELAEALSLRQYSLDLAMLEPAGPGRQYLALEVPGLAEGRPSLLFGDKVRARPNASLQQLEALNSRPADPGYEGYVHELRCSQALLKFHPHLHSALAQTLPSQSPCTFSVQFCVNRTGYRRCHHAVSLAGSSSSLPWPTLFPELDSADVKPPQACCR-----------------------SLEFFNSRLNERQRCAVRRILAGRRRPRPYVVFGPPGTGKTVTLVECALQLLNRLPDSRLLVCAPSNSAADQLADRLLASGRVSAGQLVRLNAARRKDVESVTTPAVAAASVGP-----DRLGRAAMHRVLVATCVTTGWLHGLRLRRGHFTHALIDEAGQATEPELLLPISLASE---QVVLAGDPMQLGPVVQSPWAQKFGLGESLLHRLLESSPAYAR----CPGRYPDDGYDPLLVTKLLQNYRSHPGLLQVYSSLFYHSELIPCVDPASGNRFLTWPSLPNPHLPLLFHGVIGDDRREGDSPSWFNPAETVLVTRYVIDLLAHWPGLADVED-GIGVVTPYRKQAEKIRAMLLA----TDSPDVRVASVEEFQGQERQAIVLSTVRSQPDLLAFDRHH-----------RLGFLASPRRFNVSVSRAAGLLVVVGNPHLLAADPCWLALIRYALDNSCYVG 1111          
BLAST of Mov10 like RISC complex RNA helicase 1 vs. TrEMBL
Match: A0A0L8FVI3 (Uncharacterized protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22007303mg PE=4 SV=1)

HSP 1 Score: 547.74 bits (1410), Expect = 2.463e-172
Identity = 386/1123 (34.37%), Postives = 592/1123 (52.72%), Query Frame = 1
Query:  205 SVKGLVTYLDGNKNGRIDGYVNFDSSSVIIFQCEEKNLSIGSEVFMDIIRNSKTSPWFASKIEVLSCHNKGNIEDWDDDNNLDVIKNNNKIEQLPQKQVGMITYACNDNLTFNNEIKFHQRDCGPNSFRPSKGDWVVVQYDHSVDYYSIIGLSPLRYLDFEGVISSFDGNIGYVDREIFFN-KSITKGVRLSRGVYVYGTAIESVQNRRCNFRALTIFCKMSSNVNKGLQMRLKTMNKIENGIKTPHN--LGLRLNPKA-------VEFGEQNINETRSKEVTITNENDFPMTLTGIALLSETNNQFVIENCG--KEM-----------KISGNSSLK------VSVKCVPQFPGFDTQKLFIEGLNKDSTESTESWKLMLDVSVYVFDPVLSSISLEGTEKEPGDKXXXXXXXXXXXXXXMGGVHHLSAAAPVKLRSVLTKV-YPHKLKLYPIPEQLEQRVVNKEDIMGLYAVLKEKLGPGNYSKKMDLLVHLEEVNAKEEMKELVLENVRLMRRRDTFGIEVPGLSEGRPS-LMXXXXXXXXXXXXXXXTFSGSIEDILCEVIFVKFHATLESSYRNEECTVSFSHSRLPFRRMHLGIELACGTLGDGILFPGKIDMK-------SSQCVRLSR-AGLNELSGVNLMKENELRLVQLKFYNESLNELQRVAVVRILHGYSRPLPYVLFGPPGTGKTVTLVEAILQVYKNVASSRILVCAPSNSAADLLCLRLDESGVLETGEMVRMNAYRRSILSELSDKEPIPARVLPYCKSVDDLAEVAMYRIIICTCTSSGALYRLGLKTGHITHVFVDEAGQASEPEIMISLGFTNRCNGQIILAGDPMQLGPVIRSPYAQQ--LQESYLHRLLLTCDLYKKQKEICAGSTTHFNPLIVTQLLQNYRAHPALLKLPSDMFYEGTL---IPCVVKNRFINWKWLPNPEVPLVFQGVRGKELRNPRNPSTYNPSEAVMVVRWIGRLLQDTDNIGKLKDKNISVITPYRAQVDCIRKLISSCLDNVNLAKLKVASVEEFQGQENEVVIISTVRSSLDESGNNGVHESFAILNMVGSRLGFLSNKRRFNVSITRACSLLIVIGDPGLLKYDECWSSLMKYAKTNNAFIGSE 3441
            +  G +T L GN +G IDG V F  + V+  Q  +    +G+EV +   R  +   W+A ++ +L    + N  D  DD+N     +N  +++L    VG IT         N +I F   +C    + P  GDWV V    +        + PLR   F   +S    + GY+ ++IFF  K+   G +      V  TAIES Q + CN+RA+++            ++     N+IE     PH+  LG  L  K         +FG+ +  E++   + I N  + P TL  I L +E   Q+ ++     KEM           ++ G   L+      V++ C  ++ G   + L +   +K        +++   ++V V DP  + +  + ++   G + +    +    S   G V       P +  +   K+  P KL  Y +P+++   V+N +++  ++  L+E L   NY  K  LL++LEE+    +++   LE V L    +   ++VPGL+EGRPS L+           +    F G + ++  + +++KF+A   S Y  E+  V F+ +R P RR H  +E A   LG  +LFP  ++ +       S Q    S        S V++  +     + L+F+N  LN+ Q  AV RIL G  RP+PY+LFGPPGTGKT+TLVE ILQ+   +  SRIL CAPSNSAADLL  RL +SG+L+  +MVR+NA++R       +++ IP ++ PYC S ++L  V  YRIII TC +SG LY  GLK GH THVF+DEAGQA+EPE +I +G     +GQI L+GDP QLGP++ SPY +   L+ S+L R ++  +LY +  E    ++ +F+P++VT+L+ NYR+HPALL LPS +FY   L       + +    WK LPN  VP++F G+RG++LR    PS +NP E V VVR++  LL D  +   L +++I +ITPYR QV+ IR L+S    +V    +KV SVEEFQGQE + +IIS VR++ +    +  H            LGFL N +RFNV ITRA +LLI++G+P +L +D  W +L+KY   N+A++G E
Sbjct:   49 TFTGYITNLFGN-HGLIDGDVYFSYNVVVGSQRPQ----VGNEVSVIASRQHREGGWYADQVSILKQWTEENDSDHSDDSNESESVSNGLLKEL-APGVGTITQCHLGEGLINEDIPFKIENC-IKGYIPEVGDWVTVDLRENNGEVVAFDVQPLRQQQFTSEVSVVLRDHGYIKKDIFFYVKACADGYKPQCKDQVCCTAIESKQGK-CNWRAISVS-----------RLPRSPHNQIETA---PHSNYLGDLLKDKEGIIISGISDFGKMSKEESKVITLWIRNNGNHPQTLLEIQLPTE-EIQYHVDRLKVVKEMMASSKSASSSREVKGQLVLQPKMAAYVNISCTTKYIG-SHKVLLVFKFDK--------FRIGRHLTVTVIDPYQNYMP-QQSQPIQGSQQSKTPFTRYRESMDEGWV------VPGEKITRFPKLQLPKKLGQYRVPQEIRNAVINSDELREVFPFLEETLCYENYESKFSLLLYLEEIQLDIDIRAFDLEQVCLNIVGEYLSLKVPGLAEGRPSVLVGDRVYLSTPGAEGGPVFEGIVHEVHSDEVYLKFNAEFHSKYLGEDYDVRFTFNRTPLRRFHQAVEYA-PNLGRNVLFPTTVENQPPLYNPSSDQATESSYLTPTKSASRVDISSQ-----LTLQFFNRQLNDRQMSAVKRILLGQCRPMPYILFGPPGTGKTITLVETILQILTKLPGSRILACAPSNSAADLLAERLHKSGILKLTDMVRLNAFQR-------NEDNIPDKIRPYCSSGNNLDIVVHYRIIISTCVNSGVLYTYGLKPGHFTHVFIDEAGQATEPECLIPVGLVAGTDGQITLSGDPEQLGPILHSPYTKSHGLELSFLER-IMGQELYSRD-ETKFVTSGYFDPMLVTKLIYNYRSHPALLHLPSVLFYANELEVKAEKTLTHSLCGWKSLPNKTVPILFHGIRGEDLREGNCPSWFNPFETVQVVRYLQGLLADYSSY--LTEEDIGIITPYRKQVEKIRMLLSHLGRDV----VKVGSVEEFQGQERKAIIISAVRTNEELMNFDQRH-----------ILGFLCNPKRFNVCITRAQALLIIVGNPYVLMHDFYWLTLLKYCVENDAYVGCE 1100          
BLAST of Mov10 like RISC complex RNA helicase 1 vs. TrEMBL
Match: A0A1S3HIP4 (RNA helicase Mov10l1 OS=Lingula unguis OX=7574 GN=LOC106155619 PE=4 SV=1)

HSP 1 Score: 540.421 bits (1391), Expect = 8.821e-168
Identity = 390/1128 (34.57%), Postives = 582/1128 (51.60%), Query Frame = 1
Query:  205 SVKGLVTYLDGNKNGRIDG--YVNFDSSSVIIFQCEEKNLSIGSEVFMDIIRNSKTSPWFASKIEVLSCHNKGNIED--WD-----DDNNLDVIKNNNKIEQLP--QKQVGMITYACNDNLTFNNEIKFHQRDCGPNSFRPSKGDWVVVQYDHSVD--YYSIIGLSPLRYLDFEGVISSFDGNIGYVDREIFFNKSI-TKGVRLSRGVYVYGTAIESVQNRRCNFRALTIFCKMS-SNVNKGLQMRLKTMNKIENGIKTPHNLGLRLNPKA-------VEFGEQNINETRSKEVTITNEND-------------FPMTLTGIALLSETNNQFVIENCGKEMKISGNSSLKVSVKCVPQFPGFDTQKLFIEGLNKDSTESTESWKLMLDVSVYVFDPVLSSISLEGTEKEPGDKXXXXXXXXXXXXXXMGGVHHLSAAAPVKLRSVLTKVYPHKLKLYPIPEQLEQRVVNKEDIMGLYAVLKEKLGPGNYSKKMDLLVHLEEVNAKEEMKELVLENVRLMRRRDTFGIEVPGLSEGRPSLMXXXXXXXXXXXXXXX--TFSGSIEDILCEVIFVKFHATLESSYRNEECTVSFSHSRLPFRRMHLGIELACGTLGDGILFP----GKIDMKSSQCVRLSRAGLNELSGVNLMKENELRLVQLKFYNESLNELQRVAVVRILHGYSRPLPYVLFGPPGTGKTVTLVEAILQVYKNVASSRILVCAPSNSAADLLCLRLDESGVLETGEMVRMNAYRRSILSELSDKEPIPARVLPYCKSVDDLAEVAMYRIIICTCTSSGALYRLGLKTGHITHVFVDEAGQASEPEIMISLGFTNRCNGQIILAGDPMQLGPVIRSPYA--QQLQESYLHRLLLTCDLYKKQKEICAGSTTHFNPLIVTQLLQNYRAHPALLKLPSDMFYEGTLIPC---VVKNRFINWKWLPNPEVPLVFQGVRGKELRNPRNPSTYNPSEAVMVVRWIGRLLQDTDNIGKLKDKNISVITPYRAQVDCIRKLISSCLDNVNLAKLKVASVEEFQGQENEVVIISTVRS-----SLDESGNNGVHESFAILNMVGSRLGFLSNKRRFNVSITRACSLLIVIGDPGLLKYDECWSSLMKYAKTNNAFIG 3435
            ++ G VT L  N  G +D   Y  FDS   +I  C     ++G+ V +  +R  +   W A ++          IED  WD      +NN + I + +  EQ+     QV M+T    D    N+E+ F  +    + F P +GDWVV Q   + +  Y +   +SPLR  DF G I++     G++D EI+F  S   +G +  RG  V G  +ES Q + C++RA T+   +     +K  +  L++   + NG  +   L   L  K          FG+  + E +S  + I N N               P  L     + +   Q   +  G+   +   +++ V+V+C     G D Q L  +          + + +   +SV V DP  +S+        P ++     +   +S         L    P +++SV    +P +L  + IP +L+  +  K +++ L   L E L   NY+ +   L+HLEE+  + E+++  LE+V L R  +   + VPGL+EGRPS+ +GDKV +   GD  V   + G +  +L E + +KFH +   +Y  EE  V F+ +R   RR H  +  +   LG  +LFP     K+ + S    +++ A  ++                  F+N  LN  QR AV RIL G SRP PYVLFGPPGTGKTVT+VEAILQV   +  SRIL CAPSNSA DLL  +L +S ++   ++VR+NA+ R     L D   IP  + PYC + D+L     +R+++CTC ++G L  +GLK+GH TH F+DEAGQA+EP+  + +      + QI+LAGDPMQLGPV++S +A    LQ S+L R L+   LY +   +      +++PL+VT+L+ NYR+H  LL+LPS++FY G L  C    V +    W  LPN +VP++F G+RG++LR   +PS +NP EAV V++++  L+ +        D  I +ITPYR QV+ IR LI    D + + K+KV SVEEFQGQE  V+IISTVRS     S D   N                LGFLSN +RFNV+ITRA SLLIV G+P +L  DE W SL+ Y   + A++G
Sbjct:   55 TIDGTVTSLH-NGYGLVDNEIYFTFDS---VIGGCRP---ALGAHVHVQAVRQKQHGGWQAQRVV---------IEDSSWDGGQKLHNNNYNPIISQDDPEQVAIRDTQVAMVTSIKGDLGLLNDEVSFSVQSAALHGFAPYRGDWVVAQTTTNTETGYCTAESISPLREQDFSGEINAVLHGYGFIDEEIYFPLSACVQGYQPRRGDRVKGVMLESRQGK-CSWRARTVLPSIGVGESDKSSKTVLESPFPVINGPSSGGFLKKLLQDKGGITISQKTNFGKMELGELKSLVLWIRNTNSNETRTLKSCRFKTHPAALQFAVTVQQQTPQ-KGDVAGEGQALLPGTTVFVTVECKGMHLGQDKQLLIFD---------FDGYTIGRYMSVDVQDPQQTSLD----PSAPYNRKRNYGKYKAASQRNGSESWVLPGQRPQRMKSV---PFPARLPQFEIPRELKNCIFEKRELVNLAPELGEPLSMQNYTTRFSTLLHLEEIQMEIEIRDYDLESVTLRRVGEYLALAVPGLAEGRPSVAIGDKVVLSHPGDMEVGPQYEGYVHVVLSEEVLLKFHNSFHQNYYAEEYDVMFTINRTQLRRCHQAVRFS-KHLGTKVLFPVQLHPKMPVPSKSSAKVTGAKSSQ-----------------HFFNTVLNCHQRAAVSRILEGQSRPSPYVLFGPPGTGKTVTMVEAILQVLHTIPGSRILACAPSNSATDLLAEKLLQSNLVNKSDLVRLNAFNR-----LDDN--IPEFLKPYCTTGDNLEVACRHRVVLCTCITAGLLNTVGLKSGHFTHAFIDEAGQATEPDCAVPMNLMVGEDSQIVLAGDPMQLGPVLKSRHAITYGLQYSFLER-LMDSPLYARDM-VRFADHGNYDPLLVTKLIHNYRSHSKLLQLPSELFYHGELRECGSTSVTHCMCGWDRLPNKDVPIIFHGLRGEDLREGNSPSWFNPVEAVQVMKYLQALVNNPRCAITFDD--IGIITPYRKQVEKIRLLI----DKLGMEKVKVGSVEEFQGQERRVIIISTVRSNESQMSFDRRFN----------------LGFLSNPKRFNVAITRAQSLLIVCGNPHVLAQDEHWLSLLSYCVEHGAYVG 1099          
BLAST of Mov10 like RISC complex RNA helicase 1 vs. TrEMBL
Match: A0A210QJ86 (Helicase Mov10l1 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT11963 PE=4 SV=1)

HSP 1 Score: 522.316 bits (1344), Expect = 3.421e-162
Identity = 366/1106 (33.09%), Postives = 584/1106 (52.80%), Query Frame = 1
Query:  193 IKRESVKGLVTYLDGNKNGRIDGYVNFDSSSVIIFQCEEKNLSIGSEVFMDIIRNSKTSPWFASKIEVLSCHNKGNIEDWDDDNNLDVIKNNNKIEQLPQKQVGMITYACNDNLTFNNEIKF--HQRDCGPNSFRPSKGDWVVVQYDHSVDYYSIIG--LSPLRYLDFEGVISSFDGNIGYVDREIFFNKSITKG-VRLSRGVYVYGTAIESVQNRRCNFRALTIFCKMSSNVNKGLQMRLKTMNKIENGIKTPHNLGLRLNPKAVEFGEQNINETRSKEVTITNENDFPMTLTGIALLSETNNQFVIENCG----KEMKISGNSSLKVSVKCVPQFPGFDTQKLFIEGLNKDSTESTESWKLMLD-----VSVYVFDPVLSSISLEGTEKEPGDKXXXXXXXXXXXXXXMGGVHHLSAAAPVKLRSVLTKVY-PHKLKLYPIPEQLEQRVVNKEDIMGLYAVLKEKLGPGNYSKKMDLLVHLEEVNAKEEMKELVLENVRLMRRRDTFGIEVPGLSEGRPS-LMXXXXXXXXXXXXXXXTFSGSIEDILCEVIFVKFHATLESSYRNEECTVSFSHSRLPFRRMHLGIELACGTLGDGILFPGKIDMKSSQCV--RLSRAGLNELSGVNLMKENELRLVQLKFYNESLNELQRVAVVRILHGYSRPLPYVLFGPPGTGKTVTLVEAILQVYKNVASSRILVCAPSNSAADLLCLRLDESGVLETGEMVRMNAYRRSILSELSDKEPIPARVLPYCKSVDDLAEVAMYRIIICTCTSSGALYRLGLKTGHITHVFVDEAGQASEPEIMISLGFTNRCNGQIILAGDPMQLGPVIRSPYAQQ--LQESYLHRLLLTCDLYKKQKEICAGSTTHFNPLIVTQLLQNYRAHPALLKLPSDMFYEGTLIPCV---VKNRFINWKWLPNPEVPLVFQGVRGKELRNPRNPSTYNPSEAVMVVRWIGRLLQDTDNIGKLKDKNISVITPYRAQVDCIRKLISSCLDNVNLAKLKVASVEEFQGQENEVVIISTVRSSLDESGNNGVHESFAILNMVGSRLGFLSNKRRFNVSITRACSLLIVIGDPGLLKYDECWSSLMKYAKTNNAFIGSE 3441
            +  +S+ G VT+L  N +G ID  + F   ++      ++N   G  V     +      W A ++ + S       + WD + N   ++  +  E  P   VG++T+        ++ I F   + D G N+F P  GD+V      + D     G  + P+R  + +G ++    N GY++ E+FF+  + KG  R  +   V   A+ESVQ R  N+RA+++    +S       +   T +     ++   N G+ ++ K  ++G+  I ET+   + I N+   P  L      +E   Q  +E+        M   GN ++  ++   P         L+I  L +  +   E   L+       +  Y+   +  + S   T      +   N  S   +S        +    P ++     K+Y P +L  +P+PE+L   ++  +D+  +  V++E+LG  NY+ +   L+HLEE+    +++E  LE V     R+   ++VPGL+EGRPS L+    +       +   + G + +++ E + VKF      +   ++  V F+ +R   RR H  +  A   LG+ ++FP  +  K S+ +    SRA +  L   N  K    +   + +YN+ LN+ Q+ AV R+L G  RPLPY+LFGPPGTGKT+T+VE I+QV K + SSRIL C PSNSAADL+  R+ +SG ++T +MVR+NA +R       ++E +P  V PYC   D+L   + YR+++ TC S+G LY LG++ GH +HVFVDEAGQA+EPE MIS G     +GQI+LAGDPMQLGPV+RS ++ +  L+ S+L R L+   LY++ + + A     F+PL+VT+L+ NYR+H A+L L S +FY   L       V +   +W  L N   P++F G+RG++ R   +PS +NP+E V+VVR++  L++D  +  ++  +++ VITPYR QV+ IR LI    D + +  +KV SVEEFQGQE  V+IISTVRS+          E     +M  S LGFLSN +RFNV+I+RA  LLI+IG+P +L  D+ W +L+ Y   N+A+ G +
Sbjct:   75 VNNKSIDGKVTHL-YNTHGLIDNEIYFSFDAI----QGDQNPVRGDHVTGVAKQQHTDGGWHADQVILCS-------DFWDQEGNY--VEEVDHSE--PDAVVGVVTHFKGTEGYISDYIHFTFQKNDVGENNFFPCNGDYVTADIAKN-DAGQTEGRNIQPVRVEERDGQVTGALQNHGYIEGEVFFSYDVCKGGWRPKQWDKVKVVAVESVQGRN-NWRAISVEPVTTSYTPSAKFLISPTRSSFLEDLQRDKN-GIVVSMKN-DYGDVQIGETKKMMIWIENKGKSPQLLQRCHFPAEVT-QLRMESMKLMREHAMMTRGNQTVTGNITLYP------AASLYINILLEPRSVGLEKQLLIFTFKDFRIGRYITANIQDAYSTLVTTGSQYQQQKRNAMSRYRTSVNTPAGWTIPGEKPSRVG--WRKLYLPSRLPTFPVPERLRDSILEGDDLEAVVPVVEEELGYENYTARFKTLLHLEEIQMDIDIREFDLERVSFRPVREFLALKVPGLAEGRPSILIGDRIIVTDPGDSNGPAYEGYVHELMSEDVLVKFSQNFHQTNNGKDFNVVFTFNRASLRRCHQAVSFAV-NLGENVVFPATLLPKLSRLLTSNKSRASVVPL---NYQKPASNKTQAMSYYNQWLNDQQKAAVTRVLQGQCRPLPYILFGPPGTGKTMTIVETIIQVLKKMPSSRILACTPSNSAADLIAERIHKSGQVKTSDMVRLNAVQR-------NQETVPNCVRPYCCYGDNLDLASHYRVVVSTCASAGILYTLGIQAGHFSHVFVDEAGQATEPECMISCGMVAGADGQIVLAGDPMQLGPVLRSKHSSKFGLELSFLER-LINMPLYQRNESMFADHGC-FDPLLVTKLVDNYRSHQAILSLSSQLFYNAELREQADRRVTHALCDWHMLTNTGFPVLFHGIRGEDSREGDSPSWFNPAETVLVVRYLQGLMRDEKH--QVAAEDVGVITPYRKQVEKIRLLI----DKLGMDMVKVGSVEEFQGQEKPVIIISTVRST----------ERLIGFDMKHS-LGFLSNPKRFNVAISRAQCLLIIIGNPFVLSQDKYWQTLIHYCIENHAYTGCD 1121          
BLAST of Mov10 like RISC complex RNA helicase 1 vs. Ensembl Cavefish
Match: ENSAMXT00000014945.2 (Mov10 like RISC complex RNA helicase 1 [Source:NCBI gene;Acc:103044404])

HSP 1 Score: 451.44 bits (1160), Expect = 8.426e-139
Identity = 288/725 (39.72%), Postives = 412/725 (56.83%), Query Frame = 1
Query: 1390 VHHLSAAAPVKLRSVLTKVYPHKLKLYPIPEQLEQRVVNKEDIMGLYAVLKEKLGPGNYSKKMDLLVHLEEVNAKEEMKELVLENVRLMRRRDTFGIEVPGLSEGRPSLMXXXXXXXXXXXXXXXT--FSGSIEDILCEVIFVKFHATLESSYRNEECTVSFSHSRLPFRRMHLGIELACGTLGDGILFPGKIDM---------------KSSQ----------CVRLSRAGLN-ELSGVNLMKENELRLVQL------KFYNESLNELQRVAVVRILHGYSRPLPYVLFGPPGTGKTVTLVEAILQVYKNVASSRILVCAPSNSAADLLCLRLDESGVLETGEMVRMNAYRRSILSELSDKEPIPARVLPYCKSVDDLAEVAMYRIIICTCTSSGALYRLGLKTGHITHVFVDEAGQASEPEIMISLGFTNRCNGQIILAGDPMQLGPVIRSPYAQQ--LQESYLHRLLLTCDLYKKQKEICAGSTTHFNPLIVTQLLQNYRAHPALLKLPSDMFYEGTLIPCVVKNRFI-----NWKWLPNPEVPLVFQGVRGKELRNPRNPSTYNPSEAVMVVRWIGRLLQDTDNIGKLKDKNISVITPYRAQVDCIRKLISSCLDNVNLAKLKVASVEEFQGQENEVVIISTVRSSLDESGNNGVHESFAILNMVGSRLGFLSNKRRFNVSITRACSLLIVIGDPGLLKYDECWSSLMKYAKTNNAFIGSE 3441
            V  ++ A PV+L     +  P+ L  Y +P+ L + V  K+D++ +   L E L   +       L+ LEE+ A++E++E  +    L +      +EVPGL EGRPSL +GDKV ++          + G + +I  E + ++ +   + SY  E   V F+++R+  RR H  +E A    G+ +LFP  + +               KS++          CV   ++ L  ++  V    + +L+          +F+N +LN  QR AV RIL G  RP PYVLFGPPGTGKT+TLVEAILQVY  V  SRILVC PSNSAADL+C+RL ESG L    + R+NA  R        +E IP  +  Y ++ +D+     +RI++ TC+S+G  Y++GL+ GH THVF+DEAGQA+EPE  I LG  +   GQI+LAGDP QLGPV++S  A+   L  S L RL+    LY       + S   +NPL+VT+L+ NYR+H  LL LPS +FY G L  CV   R +     +W  LP    PL+F GVRG E+R   NPS +NP EAV V+ +  +L +   N   +   +I +I+PYR QV+ IR L    L  V L  +KV SVEEFQGQE  V+I+STVRS+ D SG++           + + LGFLSN +RFNV+ITR+ +LLI IG+P +L  + C+ +L++YA  N A++G +
Sbjct:  479 VRVMAPAPPVRLAR---RHLPNFLGNYTVPQALRECVEAKKDVLVVQPALGEPLSLSSMGAHFSALLWLEELQAEKELREFSINGALLRKGTIYLHLEVPGLCEGRPSLFIGDKVVLRKPCSGGFVVEYIGYVTEISEEDVSLRVNKDFQQSYLGEPLDVEFTYNRVTMRRCHCALEQA-KHFGENVLFPKVLQLQHPVWTGEWEPEKLQKSNEDEPPEQDEGVCVNGEKSPLTMDMVSVYTQTKTDLKTPAKHTPKPGQFFNSNLNPAQRQAVKRILGGECRPTPYVLFGPPGTGKTITLVEAILQVYHRVTGSRILVCTPSNSAADLICIRLHESGFLPAASLARVNATCRL-------EESIPEVLHQYSRAGEDIRNACFHRIVVSTCSSAGMFYQIGLRIGHFTHVFLDEAGQATEPEAQIPLGLLSERTGQIVLAGDPKQLGPVVKSKLAEAFGLGVSLLERLMAN-PLY-------SCSENGYNPLLVTKLVYNYRSHEVLLALPSRLFYGGEL--CVRSQRSVVDSLCHWGRLPTKGFPLIFHGVRGSEMREGSNPSWFNPVEAVQVMLYCCQLAKRLYN--PIPATDIGIISPYRKQVEKIRVL----LHKVGLGDIKVGSVEEFQGQEFLVIILSTVRSNEDLSGSD-----------LQNVLGFLSNPKRFNVAITRSKALLITIGNPHVLIKEACFYALLQYAYDNGAYLGCD 1165          

HSP 2 Score: 60.8474 bits (146), Expect = 8.172e-9
Identity = 58/220 (26.36%), Postives = 97/220 (44.09%), Query Frame = 1
Query:   97 ITNYLKPTSFNSDREEYGERFYTGGYDDVQKDIKRESVKGLVTYLDGNKNGRIDGYVNFDSSSVIIFQCEEKNLSIGSEVFMDIIRNSKTSPWFASKIEVLSCHNKGNIEDWDDDNNLDVIKNNNKIEQLPQKQVGMITYACNDNLTFNNEIKFHQRDCGPNSFRPSKGDWVVVQYDHSVDYYSIIG--LSPLRYLDFEGV-ISSFDGNIGYVDREIFFN 747
            I+  L P    ++ E+  E +Y GG  ++     R+   G+VT L     G ID  V F +  V+        L +G  V    +R+     W A ++E         ++ W+      +  + NK+  L    +G +T +C+ +  F N+  +  R      F P KGDWV  QY  S   +S     ++PLRY   + V +S+  G+ G V+  +FF+
Sbjct:    9 ISKLLSPLWRRAEDED-NEYYYGGGMKEI-----RQMRGGVVTQL-CQDYGLIDHSVYFTAGEVL----GGVPLCVGDPVHALAVRDGVHGGWRALRVE-------KQMDTWEGGARASLELDPNKLRSL----IGTVT-SCDKDGGFINQTTYFPRSALSEGFEPMKGDWVQAQYVISPLEWSSQARTVAPLRYRRMDKVYVSNIFGSNGIVEDSVFFS 205          
BLAST of Mov10 like RISC complex RNA helicase 1 vs. Ensembl Cavefish
Match: mov10b.1 (Moloney leukemia virus 10b, tandem duplicate 1 [Source:NCBI gene;Acc:556024])

HSP 1 Score: 372.474 bits (955), Expect = 1.575e-112
Identity = 252/664 (37.95%), Postives = 363/664 (54.67%), Query Frame = 1
Query: 1531 AVLKEKLGPGNYSKKMDLLVHLEEVNAKEEMKELVLENVRLMRRRDT---FGIEVPGLSEGRPSLMXXXXXXXXXXXXXXXTF----SGSIEDILCEVIFVKFHATLESSY-RNEECTVSFSHSRLPFRRMHLGIELACGTLGDGILFPGKIDMKSSQCVRLSRAGLNELSGVNLMKENELRLVQLKFYNESL--NELQRVAVVRILHGYSRPLPYVLFGPPGTGKTVTLVEAILQVYKNVASSRILVCAPSNSAADLLCLRLDESGVLETGEMVRMNAYRRSILSELSDKEPIPARVLPYCK-SVDDL-----AEVAMYRIIICTCTSSGALYRLGLKTGHITHVFVDEAGQASEPEIMISL-GFTNRCNGQIILAGDPMQLGPVIRSPYAQQ--LQESYLHRLLLTCDLYKKQKEICAGSTTHFNPLIVTQLLQNYRAHPALLKLPSDMFYEGTLIPCVVK---NRFINWKWLPNPEVPLVFQGVRGKELRNPRNPSTYNPSEAVMVVRWIGRLL---QDTDNIGKLKDKNISVITPYRAQVDCIRKLISSCLDNVNLAK----LKVASVEEFQGQENEVVIISTVRSSLDESGNNGVHESFAILNMVGSRLGFLSNKRRFNVSITRACSLLIVIGDPGLLKYDECWSSLMKYAKTNNAFIG 3435
            ++L+  L   NY+ +  LL++LEE     ++K    ENV + + +       +EVPG+SE RPS++ GD + +    D ++ F     G +  +  + + + F +   SS+  N +  V F+ +RL  R  H  ++LA     + +LFP      SS                            LK ++ +L  N  Q  AV  I+ G S+P PY++FGPPGTGKTVT+VEAI Q+ K +  +RIL CAPSNSAAD LC +L     +++ ++ R+ A  RS          IP  +L  C  S DD       E+  Y+I++ T  ++G L   GL  GH TH+FVDEAG A E E +I + G      GQ++LAGDP QLGP++RSP A Q  L  S L RL+    LY+K         T FNP  VT+LLQNYR+H ++LK+P++MFY+G L     +   + + NW+ LP    PL+F GV+GK+ R   +PS +N +E   V+ ++ +LL   Q    I K+  K+I +ITPYR QV+ +RK I  C   + + K    LKV SVEEFQGQE  V+I+STVRSS  E  N  +   F I        GFL+N++RFNV++TRA SLLIV+G+P +L  D  WS  ++Y      + G
Sbjct:  203 SLLETPLSFQNYADRFHLLLYLEEAQMLVDIKRYNKENVTMTQDKQNKKLLELEVPGVSENRPSVLRGDHLLLTKSKDLNLPFVTKYKGYVHRVELDKLKLGFSSKFLSSFINNMKFQVEFTFNRLLMRLQHRAVQLAVDHNLEEVLFPTGSTAPSSGTK-----------------------PPLKLFDRTLEKNHEQYTAVCNIVEGVSKPAPYLVFGPPGTGKTVTMVEAIKQLEKCIPGARILACAPSNSAADQLCEKLLPH--VDSHKVYRIYALSRS-------PAEIPPSLLDCCNLSGDDYEYPSKEELMDYKILVTTAYTAGRLVTGGLPAGHFTHIFVDEAGHAVESEAIIGIAGLLRAETGQLVLAGDPKQLGPILRSPIAIQYGLGLSLLERLMTKNPLYQK-------GETGFNPRYVTKLLQNYRSHRSILKIPNEMFYDGELQARADEYSTSLYCNWEHLPKRGFPLIFHGVQGKDERESSSPSFFNTTEITKVIDYLKKLLLTTQGKKGIAKISPKDIGIITPYRKQVEKLRKAIRMCDKELKVFKGIDELKVGSVEEFQGQERRVIIVSTVRSS-GEYIN--IDTDFNI--------GFLNNEKRFNVAMTRAKSLLIVVGNPIILSSDSTWSRFIQYCTDEGGYTG 816          
BLAST of Mov10 like RISC complex RNA helicase 1 vs. Ensembl Cavefish
Match: mov10a (putative helicase mov-10-B.1 [Source:NCBI gene;Acc:103034927])

HSP 1 Score: 351.673 bits (901), Expect = 9.447e-104
Identity = 229/660 (34.70%), Postives = 358/660 (54.24%), Query Frame = 1
Query: 1531 AVLKEKLGPGNYSKKMDLLVHLEEVNAKEEMKELVLENVRLMR---RRDTFGIEVPGLSEGRPSLMXXXXX---XXXXXXXXXXTFSGSIEDILCEVIFVKFHATLESSY-RNEECTVSFSHSRLPFRRMHLGIELACGTLGDGILFPGKIDMKSSQCVRLSRAGLNELSGVNLMKENELRLVQLKFYNESL--NELQRVAVVRILHGYSRPLPYVLFGPPGTGKTVTLVEAILQVYKNVASSRILVCAPSNSAADLLCLRLDESGVLETGEMVRMNAYRRSILSELSDKEPIPARVLPYC---KSVDDL----AEVAM-YRIIICTCTSSGALYRLGLKTGHITHVFVDEAGQASEPEIMISL-GFTNRCNGQIILAGDPMQLGPVIRSPYAQQ--LQESYLHRLLLTCDLYKKQKEICAGSTTHFNPLIVTQLLQNYRAHPALLKLPSDMFYEGTL---IPCVVKNRFINWKWLPNPEVPLVFQGVRGKELRNPRNPSTYNPSEAVMVVRWIG--RLLQDTDNIGKLKDKNISVITPYRAQVDCIRKLISSCLDNVNLAKLKVASVEEFQGQENEVVIISTVRSSLDESGNNGVHESFAILNMVGSRLGFLSNKRRFNVSITRACSLLIVIGDPGLLKYDECWSSLMKYAKTNNAFIG 3435
            AVL+  L    Y+++  LL+HLEE+  + ++K+  L N  + +    +    ++VPG++E RPS++ GD +     + K      + G +  +  + + + F   L   +  N +  V F+ +R P +  H  ++LA       +LFP    ++     +LS                         +N  L  N  Q  AV  IL G+S+P PY++FGPPGTGKTVTLVEAI QV ++   + +L CAPSNSA DLLC RL     ++   + R+ A  R       D   +P ++L +    +  D       E  M Y +I+ T  ++G L   G+  GH THVF+DEAGQA EPE ++ + G  +   GQ++LAGDP QLGP++RSP AQQ  L  S L RL+    LY+K  +   GS   +N   VT+LL+NYR+HPA+L++P+++FY+  L      + +  F +W+ LP    P++F GV GK+ R   +PS +N SE  +++ ++   +L Q    + KLK  +I +I PYR QV+ IRK + +  +      +KV SVEEFQGQE  V+++S VRSS+          S+  ++     +GFL+N++RFNV++TRA +LLIV+G+P +L  +  W   ++Y +    + G
Sbjct:  346 AVLETPLCIKQYAERFHLLLHLEEIQMEVDIKKYDLYNQTMTQDITNKKLLVLKVPGVAENRPSVLRGDHLNVCVSEDKAKPVTMYKGYVHRVELDRVKLGFSKKLVQKFVSNMKFDVEFNINRFPLKLQHRAVDLAVQHKLGNVLFPSGNKVEPPAVPKLS------------------------MFNRDLESNPEQSTAVQHILSGHSKPGPYLIFGPPGTGKTVTLVEAIKQVNRSGTVAHVLACAPSNSACDLLCERLLR--YVDGHHLYRLCASSR-------DPRTMPQKLLKHSNWDEGQDSFILPSKETLMGYSVIVVTLITAGRLVSGGVPVGHFTHVFIDEAGQAVEPECVVGIAGLLHPEKGQVVLAGDPQQLGPILRSPLAQQHGLGLSLLERLMTQNSLYQKTHD---GSQA-YNSCFVTKLLRNYRSHPAILEIPNELFYDNELQVFADQMEREAFCHWEHLPKQGFPVIFHGVMGKDEREANSPSFFNVSEIEVLISYLQKLKLTQGKKGLPKLKPADIGIIAPYRKQVEKIRKALQTVKELKQWNDIKVGSVEEFQGQEKRVIMVSAVRSSI----------SYVKMDQ-DFNIGFLTNEKRFNVAMTRAKALLIVVGNPVILNKNPTWQRFIQYCEQEQGYTG 957          
BLAST of Mov10 like RISC complex RNA helicase 1 vs. Ensembl Cavefish
Match: upf1 (UPF1 RNA helicase and ATPase [Source:NCBI gene;Acc:103031971])

HSP 1 Score: 157.147 bits (396), Expect = 1.817e-38
Identity = 137/495 (27.68%), Postives = 230/495 (46.46%), Query Frame = 1
Query: 2065 KFYNESLNELQRVAVVRILHGYSRPLPYVLFGPPGTGKTVTLVEAILQVYKNVASSRILVCAPSNSAADLLCLRLDESGVLETGEMVRMNAYRR----------SILSELSDKEPIPA-RVLPYCK-------SVDDLAEVAMYR-----------IIICTCTSSGA--LYRLGLKTGHITHVFVDEAGQASEPEIMISLGFTNRCNGQIILAGDPMQLGPVIRSPYAQQ--LQESYLHRLLLTCDLYKKQKEICAGSTTHFNPLIVTQLLQNYRAHPALLKLPSDMFYEGTLIPCVVK----NRFINWKWLPNPEVPLVFQGVRGKELRNPRNPSTYNPSEAVMVVRWIGRLLQDTDNIGKLKDKNISVITPYRAQVDCIRKLI--SSCLDNVNLAKLKVASVEEFQGQENEVVIISTVRSSLDESGNNGVHESFAILNMVGSRLGFLSNKRRFNVSITRACSLLIVIGDPGLLKYDECWSSLMKYAKTNNAFI 3432
            +F  + L +L    V  +     RPL  ++ GPPGTGKTVT    +  + +   +  +LVCAPSN A D L  ++ ++G+    ++VR+ A  R          ++ +++ + + +P  + L   K       S D+    A+ R           +I CTC  +G   L ++  ++     + +DE+ QA+EPE M+ +    +   Q+IL GD  QLGPV+    A +  L +S   RL++                    P+   +L   YR HPAL   PS++FYEG+L   V       +  +++W P P+ P+ F   +G+E       S  N +EA  V +   RLL+        K   I +ITPY  Q   + + +  S  L      ++++ASV+ FQG+E + +I+S VR++  +                   +GFL++ RR NV++TRA   +I++G+P  L     W+ L+ Y K     +
Sbjct:  442 RFTAQGLPDLNHSQVYAVKTVLQRPLS-LIQGPPGTGKTVTSATIVYHLARQ-GNGPVLVCAPSNIAVDQLTEKIHQTGL----KVVRLCAKSREAIDSPVSFLALHNQIRNMDSMPELQKLQQLKDETGELSSSDEKRYRALKRTAERELLMNADVICCTCVGAGDPRLAKMQFRS-----ILIDESTQATEPECMVPVVLGAK---QLILVGDHCQLGPVVMCKKAAKAGLSQSLFERLVVL----------------GIRPI---RLQVQYRMHPALSAFPSNIFYEGSLQNGVTAADRIKKGFDFQW-PQPDKPMFFYVTQGQEEIASSGTSYLNRTEAANVEKITTRLLK-----AGAKPDQIGIITPYEGQRSYLVQYMQFSGSLHTKLYQEVEIASVDAFQGREKDFIILSCVRANEHQG------------------IGFLNDPRRLNVALTRARYGVIIVGNPKALSKQPLWNHLLNYYKEQKVLV 879          
BLAST of Mov10 like RISC complex RNA helicase 1 vs. Ensembl Cavefish
Match: helz (helicase with zinc finger [Source:NCBI gene;Acc:103032941])

HSP 1 Score: 151.754 bits (382), Expect = 1.388e-36
Identity = 141/473 (29.81%), Postives = 229/473 (48.41%), Query Frame = 1
Query: 2083 LNELQRVAVVRILHGYSRPLPYVLF-GPPGTGKTVTLVEAILQVYKNVASSRILVCAPSNSAADLLCLRLDESGVLETGEMVRMNAYRRSILSELSDK--EPIPARVLPYCK--------SVDDLAEVAMYRIIICTCTSSGALYRLGLKTGHITHVFVDEAGQASEPEIMISLGFTNRCNGQIILAGDPMQLGPVIRSPYAQQLQESYLHRLLLTCDLYKKQKEICAGSTTHFNPLIVTQLL--QNYRAHPALLKLPSDMFYEGTLIPCVVKNRFINWKWLPNPEV-PLVFQGVRGKELRNPRNPSTYNPSEAVMVVRWIGRLLQDTD-NIGKLKDKNISVITPYRAQVDCIRKLISSCLDNVNLAKLKVASVEEFQGQENEVVIISTVRSSLD-ESGNNGVHESFAILNMVGSRL--GFLSNKRRFNVSITRACSLLIVIGDP-GLLKYDEC---WSSLMKYAKTNNAFIG 3435
            LN  Q+ A++ I    S  LP VL  GP GTGKT TL +A+  + K    SR+L+C  SNSAADL  ++      +E G     N + R +     ++  + +   V  YC          +    ++  +R+++ T ++S  L +L L+ G  TH+ +DEA QA E E ++ L   ++   +I+LAGD MQL P + S +A   +E  LH  LL   LY+           H+      ++L  +NYR+H A++   S++FYEG L+         + K  P+ +  PL F   RG++++   + + YN +E   +V  +  + +      GKL + +I V++PY  QV  IR    + L    + ++ V  V   QG++  V+ +STVR+    +     +     ++      L  GFLSN +  N +ITRA SL+ V+GDP  L     C   W + +     N +  G
Sbjct:  599 LNAKQKEAILAITTPLSINLPPVLIIGPYGTGKTFTLAQAVKHILKQ-PDSRVLICTHSNSAADLY-IKDYLHPYVEAG-----NPHARPLRVYFRNRWVKTVHPVVQQYCLISGAYFTFQMPTRQDIERHRVVVVTLSTSQYLCQLDLEPGLFTHILLDEAAQAMECETIMPLALASKST-RIVLAGDHMQLSPFVYSEFA---RERNLHVSLLD-RLYE-----------HYPSEYPCRILLCENYRSHEAIINYTSELFYEGKLM--------ASGKQPPHKDFYPLTFFTARGEDVQEKNSTAYYNNAEVFEIVERVEEMRKKWPVAWGKLDEGSIGVVSPYADQVFRIR----AELRKKRMHEVSVERVLNVQGKQFRVLFLSTVRTRHTCKHKQTAIKRKEQLVEDSTEDLDYGFLSNYKLLNTAITRAQSLVAVVGDPIALCSVGRCRKFWETFISICHENGSLHG 1036          
BLAST of Mov10 like RISC complex RNA helicase 1 vs. Ensembl Sea Lamprey
Match: upf1 (UPF1 RNA helicase and ATPase [Source:ZFIN;Acc:ZDB-GENE-040426-2836])

HSP 1 Score: 151.369 bits (381), Expect = 2.575e-37
Identity = 143/490 (29.18%), Postives = 226/490 (46.12%), Query Frame = 1
Query: 2083 LNELQRVAVVRILHGYSRPLPYVLFGPPGTGKTVTLVEAILQVYKNVASSRILVCAPSNSAADLLCLRLDESGVLETGEMVRMNAYRRSIL----------SELSDKEPIPA-RVLPYCK-------SVDDLAEVAMYR-----------IIICTCTSSGA--LYRLGLKTGHITHVFVDEAGQASEPEIMISLGFTNRCNGQIILAGDPMQLGPVIRSPYAQQ--LQESYLHRLLLTCDLYKKQKEICAGSTTHFNPLIVTQLLQNYRAHPALLKLPSDMFYEGTLIPCV-----VKNRFINWKWLPNPEVPLVFQGVRGKELRNPRNPSTYNPSEAVMVVRWIGRLLQDTDNIGKLKDKNISVITPYRAQVDCIRKLI--SSCLDNVNLAKLKVASVEEFQGQENEVVIISTVRSSLDESGNNGVHESFAILNMVGSRLGFLSNKRRFNVSITRACSLLIVIGDPGLLKYDECWSSLMKYAKTNNAFI 3432
            LN  Q  AV  +L    RPL  ++ GPPGTGKTVT    +  + K   S  +LVCAPSN A D L  ++  +G+    ++VR+ A  R  +          +++ + + +P  + L   K       S D+    A+ R           +I CTC  +G   L ++  ++     + +DE+ QA+EPE M+      +   Q+IL GD  QLGPV+    A +  L +S   RL++                    P+   +L   YR HPAL   PS++FYEG+L   V     VK  F ++ W   P+ P+ F   +G+E       S  N +EA  V +   RLL+        K   I +ITPY  Q   + + +  S  L      ++++ASV+ FQG+E + +I+S VR++  +                   +GFL++ RR NV++TRA   +I++G+P  L     W+ L+ Y K     +
Sbjct:  459 LNHSQVYAVKTVLQ---RPLS-LIQGPPGTGKTVTSATIVYHLAKQ-NSGPVLVCAPSNIAVDQLTEKIHRTGL----KVVRLCAKSREAIDSPVSFLALHNQIRNMDSLPELQKLQQLKDETGELSSADEKRYRALKRNAERELLMNADVICCTCVGAGDPRLAKMQYRS-----ILIDESTQATEPECMVPTVLGAK---QLILVGDHCQLGPVVMCKKAAKAGLCQSLFERLVVL----------------GIRPI---RLQVQYRMHPALSAFPSNIFYEGSLQNGVTAAERVKKGF-DFTWT-QPDKPMFFYVTQGQEEIASSGTSYLNRTEASNVEKITTRLLK-----AGAKPDQIGIITPYEGQRSYLVQYMQFSGSLHAKLYQEVEIASVDAFQGREKDFIILSCVRANEHQG------------------IGFLNDPRRLNVALTRAKYGVIIVGNPKALSKQPLWNHLLNYYKEQKVLV 887          
BLAST of Mov10 like RISC complex RNA helicase 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006694.1 (pep scaffold:Pmarinus_7.0:GL476853:158045:174859:1 gene:ENSPMAG00000006033.1 transcript:ENSPMAT00000006694.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 142.895 bits (359), Expect = 1.365e-34
Identity = 132/461 (28.63%), Postives = 222/461 (48.16%), Query Frame = 1
Query: 2143 PYVLFGPPGTGKTVTLVEAILQVYKNVASSRILVCAPSNSAADLLCLR-LDE---SGVLETGEMVRMNAYRR-SILSELSDKEPIPARVLPYCK--------SVDDLAEVAMYRIIICTCTSSGALYRLGLKTGHITHVFVDEAGQASEPEIMISLGFTNRCNGQIILAGDPMQLGPVIRSPYAQQLQESYLHRLLLTCDLYKKQKEICAGSTTHFNPLIVTQLLQNYRAHPALLKLPSDMFYEGTLIPCVVKNRFINWKWLP-------NPEV-PLVFQGVRGKELRNPRNPSTYNPSEAVMVVRWIGRLLQDTDNI-GKLKDKNISVITPYRAQVDCIRKLISSCLDNVNLAKLKVASVEEFQGQENEVVIISTVRS-----SLDESGNNGVHESFAILNMVGSRLGFLSNKRRFNVSITRACSLLIVIGDP-GLLKYDEC---WSSLMKYAKTNNAFI 3432
            P++++GP GTGKT TL +A +Q+     ++R+L+C  +NSAADL     L E   SG  E   +  +  +R  + +SE+         V  YC         +V  L  V  +R++I T      L++L L  GH +H+ +DEA QA E + +I L   +  + +++LAGD  Q+ P + S      Q  ++ R LL    +  Q++    +T   + +I+T    NYR+ P ++   S  FY G        N   ++K +        +P++ PL F  V GK   +    + YN +EA+ V   +  +LQ    I G+L+   I VI+ Y +QV    KLI   L   ++  + V +++  QG+E  V+++STVR+     S+   GN                LGFL++    N ++TRA +L++ +GD   L     C   W S ++ A  +++ +
Sbjct:  785 PFLMYGPFGTGKTYTLFQATVQILAE-PNARVLICTEANSAADLYIQEYLHEYVTSGFKEATPLRIVYKWRNMNTVSEV---------VRRYCCLDPNGPFFAVPSLEIVKAHRVVIATYAQCRTLWQLELPRGHFSHILLDEAAQALEADALIPLALADS-STRVLLAGDHKQITPKLYSMPNDDKQ--FVIRTLLQRLFHHYQRQ--NHNTAQCSRIILT---DNYRSRPEIVNFVSKHFYLG--------NHDKDFKGIKARADVPRHPDLYPLTFSHVSGKCDFDEVTRTWYNTTEALEVAERVANILQTWPEIHGRLEQSQICVISYYSSQV----KLIRYVLRRKHMGSVNVDTLQSIQGKEFTVIVLSTVRTRSSRQSMVTDGN----------------LGFLADACALNTAMTRARALVLAVGDAMALCSVGGCSRVWQSFLREAHVHSSML 1199          
BLAST of Mov10 like RISC complex RNA helicase 1 vs. Ensembl Sea Lamprey
Match: ighmbp2 (immunoglobulin mu DNA binding protein 2 [Source:ZFIN;Acc:ZDB-GENE-050419-258])

HSP 1 Score: 119.783 bits (299), Expect = 6.242e-28
Identity = 143/500 (28.60%), Postives = 202/500 (40.40%), Query Frame = 1
Query: 2059 QLKFYNESLNELQRVAVVRILHGYSRPLPYVLFGPPGTGKTVTLVEAILQVYKNVASSRILVCAPSNSAADLLCLRL--------------------------------DESGVL------------------ETGEMVRMNAYRRSILSELSDKEPIPARVLPYCKSVDDLAEVAMYRIIICTCTSSGALYRLG-LKTGHITHVFVDEAGQASEPEIMISLGFTNRCNGQIILAGDPMQLGPVIRSPYAQQ--LQESYLHRLLLTCDLYKKQKEICAGSTTHFNPLIVTQLLQNYRAHPALLKLPSDMFYEGTL--IPCVVKNRFINWKWLPNPE-----------VPLVFQGVRGKELRNPRNPSTYNPSEAVMVVRWIGRLLQDTDNIGKLKDKNISVITPYRAQVDCIRKLISSCLDNVNLAKLKVASVEEFQGQENEVVIISTVRSSLDESGNNGVHESFAILNMVGSRLGFLSNKRRFNVSITRACSLLIVIGD 3360
            Q++F N +L+  QR AV+  L   ++    ++ GPPGTGKT T+VE I Q  +     ++L CAPSN A D L  RL                                D++G++                  E GE  R+ A  RS+  EL ++E    R +   +S D         +I+ T T + A   L  L   H     VDE GQA E    + L    RC    +LAGD  QL P I S  A +  L  S + RL+                        V  L   YR + A++   S   Y+G L   P V  +     K LP  E           V     G+   EL   +  S  N  E  +V   +  L+        +K ++I+VI PY  QVD +R+ +S         +L++ SV+ FQG+E E VI+S VRS                 N  G  +GFL+  RR NV++TRA   L V+ D
Sbjct:  187 QVEFLNTALDHSQREAVIFAL---AQREVAIIHGPPGTGKTTTVVEIIQQTVRR--GEKVLACAPSNVAVDNLVERLACAGVRVLRLGHPARLLDSVRSRCLDAVLARGDDAGIVRDVRSDMDKVHAKLRNGSERGERARLQAEMRSLRKELREREDTAMRNI--LQSAD---------VILATTTGAWAGGPLKLLPPAHFAVAVVDECGQAVEAASWLPLLQAPRC----VLAGDHRQLPPTIVSQRAAEGGLAVSLMERLV-----------------ERLGSSAVRMLTVQYRMNAAIMDWASQHVYQGKLEAHPSVASHLL---KDLPGVEATDETALALLLVDTAGCGLLETELAGEQ--SKGNAGEVDIVSAHVQALID-----AGVKAEDIAVIAPYNLQVDMLRQKLSD-----RHPELEIRSVDGFQGREKEAVILSLVRS-----------------NRKGE-VGFLAEDRRINVAVTRARRHLAVVCD 616          
BLAST of Mov10 like RISC complex RNA helicase 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008666.1 (pep scaffold:Pmarinus_7.0:GL478401:184246:194592:-1 gene:ENSPMAG00000007841.1 transcript:ENSPMAT00000008666.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 109.768 bits (273), Expect = 3.087e-25
Identity = 126/494 (25.51%), Postives = 205/494 (41.50%), Query Frame = 1
Query: 2149 VLFGPPGTGKTVTLVEAILQVYKNVASSR-----------ILVCAPSNSAADLLCLRL------------------------DESGV--LETGEMVRMNAYRRSILSEL---SDKEPIPARVLPY----CKSVDDLA--EVAMYR---------------IIICTCTSSGALYRLGLKTGHITHVFVDEAGQASEPEIMISLGFTNRCNGQIILAGDPMQLGPVIRSPYAQQL--QESYLHRLLLTCDLYKKQKEICAGSTTHFNPLIVTQLLQNYRAHPALLKLPSDMFYEGTLIPCVVKNRFIN-----WKWLPNPEVPLVFQGVRGKEL------RNPRNPSTYNPSEAVMVVRWIGRLLQDTDNIGKLKDKNISVITPYRAQVDCIRKLISSCLDNVNLAKLKVASVEEFQGQENEVVIISTVRS-SLDESGNNGVHESFAILNMVGSRLGFLSNKRRFNVSITRACSLLIVIGDPGLLKYDECWSSLMK 3405
            V+ GPPGTGKTV  +  +   ++ + + R            L C PSN + D++   L                         E+ V  L + ++ R+N   +SI        D  P   ++  Y     + V DL   E+  Y+               ++I TC+++  +  + LK        VDE    +EPE +I L  + +   Q++L GD  QL P + +  A +L  ++S   R       Y K+                  L   YR HP + + P+  FY  T                   +   P  P +F  V GKE+            S  N +E   VVR +  L++     G + +K+I+++TPY AQ + I+K     L+  ++ K+   ++ + QG E   V++STVRS SLDE   N     + I     SRLGF+ ++ + NV++TRA   L +IG+  LL   + W  L++
Sbjct:   20 VIQGPPGTGKTVVGIHLVKWFHEVIKTLRENLQADAKHICSLYCGPSNKSVDVVAEHLVKIEDLKPLRVYGQQTEEEEFPIPGETDVIFLRSKKVPRVNLTIKSITLHYKIREDTNPYAQQIRKYDDGQTEEVKDLTLEEIIEYKKLIKDAKVIELKKSDVVITTCSTAATV--ILLKNLDPRVCLVDECAMCTEPECLIPLT-SYKDIAQVVLLGDHKQLRPFVLNRTAAKLGMEKSMFER-------YAKR---------------AIMLDTQYRMHPDICEFPAKQFYSETNKTLKTAKEVFGRPNSILGYAHKPSCPTLFGHVVGKEVTLVVSTEEGSENSKANKAEVEQVVRLVSELIKK----GSIAEKDIAILTPYNAQANEIQK----ALEKEHIKKVTATTITKSQGSEWRYVLLSTVRSCSLDEFKANP-SRGWQI-----SRLGFIIDENQVNVALTRAKEGLCIIGNQDLLMCSDLWKELIE 474          
BLAST of Mov10 like RISC complex RNA helicase 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008661.1 (pep scaffold:Pmarinus_7.0:GL478401:184160:191851:-1 gene:ENSPMAG00000007841.1 transcript:ENSPMAT00000008661.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 102.064 bits (253), Expect = 7.349e-23
Identity = 97/351 (27.64%), Postives = 158/351 (45.01%), Query Frame = 1
Query: 2401 YCKSVDD--LAEVAMYRIIICTCTSSGALYRLGLKTGHITHVFVDEAGQASEPEIMISLGFTNRCNGQIILAGDPMQLGPVIRSPYAQQL--QESYLHRLLLTCDLYKKQKEICAGSTTHFNPLIVTQLLQNYRAHPALLKLPSDMFYEGTLIPCVVKNRFIN-----WKWLPNPEVPLVFQGVRGKEL------RNPRNPSTYNPSEAVMVVRWIGRLLQDTDNIGKLKDKNISVITPYRAQVDCIRKLISSCLDNVNLAKLKVASVEEFQGQENEVVIISTVRS-SLDESGNNGVHESFAILNMVGSRLGFLSNKRRFNVSITRACSLLIVIGDPGLLKYDECWSSLMK 3405
            Y K + D  + E+    ++I TC+++  +  + LK        VDE    +EPE +I L  + +   Q++L GD  QL P + +  A +L  ++S   R       Y K+                  L   YR HP + + P+  FY  T                   +   P  P +F  V GKE+            S  N +E   VVR +  L++     G + +K+I+++TPY AQ + I+K     L+  ++ K+   ++ + QG E   V++STVRS SLDE   N     + I     SRLGF+ ++ + NV++TRA   L +IG+  LL   + W  L++
Sbjct:  103 YKKLIKDAKVIELKKSDVVITTCSTAATV--ILLKNLDPRVCLVDECAMCTEPECLIPLT-SYKDIAQVVLLGDHKQLRPFVLNRTAAKLGMEKSMFER-------YAKR---------------AIMLDTQYRMHPDICEFPAKQFYSETNKTLKTAKEVFGRPNSILGYAHKPSCPTLFGHVVGKEVTLVVSTEEGSENSKANKAEVEQVVRLVSELIKK----GSIAEKDIAILTPYNAQANEIQK----ALEKEHIKKVTATTITKSQGSEWRYVLLSTVRSCSLDEFKANP-SRGWQI-----SRLGFIIDENQVNVALTRAKEGLCIIGNQDLLMCSDLWKELIE 414          
BLAST of Mov10 like RISC complex RNA helicase 1 vs. Ensembl Yeast
Match: NAM7 (ATP-dependent RNA helicase of the SFI superfamily; involved in nonsense mediated mRNA decay; required for efficient translation termination at nonsense codons and targeting of NMD substrates to P-bodies; binds to the small ribosomal subunit via an interaction with Rps26; forms cytoplasmic foci upon DNA replication stress [Source:SGD;Acc:S000004685])

HSP 1 Score: 157.532 bits (397), Expect = 1.538e-39
Identity = 149/475 (31.37%), Postives = 222/475 (46.74%), Query Frame = 1
Query: 2083 LNELQRVAVVRILHGYSRPLPYVLFGPPGTGKTVTLVEAILQVYKNVASSRILVCAPSNSAADLLCLRLDESGVLETGEMVRMNA-YRRSILSELSD-------KEPIPARVLPYCKSVDDLAE---------VAMYR-----------IIICTCTSSGALYRLGLKTGHITHVFVDEAGQASEPEIMISLGFTNRCNGQIILAGDPMQLGPVI--RSPYAQQLQESYLHRLLLTCDLYKKQKEICAGSTTHFNPLIVTQLLQNYRAHPALLKLPSDMFYEGTLIPCV-VKNRFINWKWLPNP--EVPLVFQGVRGKELRNPRNPSTYNPSEAVMVVRWIGRLLQDTDNIGKLKDKNISVITPYRAQVDCIRKLI--SSCLDNVNLAKLKVASVEEFQGQENEVVIISTVRSSLDESGNNGVHESFAILNMVGSRLGFLSNKRRFNVSITRACSLLIVIGDPGLLKYDECWSSLM 3402
            LN  Q  AV  +L    RPL  +  GPPGTGKTVT    +  + K +   RILVCAPSN A D L  +L + G+    ++VR+ A  R  + S +S+              +    K  D++ E         V + R           ++ CTC  +G   RL  K      V +DE+ QASEPE +I +    +   Q+IL GD  QLGPVI  R      L++S   RL+               S  H    +  +L   YR +P L + PS+MFYEG+L   V ++ R +     P P   +P++F    G+E  +    S  N  EA+   R I +L +D      +K + I VITPY  Q   I + +  +  LD     K++VASV+ FQG+E + +I+S VR++  ++                  +GFL + RR NV +TRA   L+++G+P  L  +  W+ L+
Sbjct:  409 LNSSQSNAVSHVLQ---RPLSLIQ-GPPGTGKTVTSATIVYHLSK-IHKDRILVCAPSNVAVDHLAAKLRDLGL----KVVRLTAKSREDVESSVSNLALHNLVGRGAKGELKNLLKLKDEVGELSASDTKRFVKLVRKTEAEILNKADVVCCTCVGAGD-KRLDTK---FRTVLIDESTQASEPECLIPIV---KGAKQVILVGDHQQLGPVILERKAADAGLKQSLFERLI---------------SLGH----VPIRLEVQYRMNPYLSEFPSNMFYEGSLQNGVTIEQRTVPNSKFPWPIRGIPMMFWANYGREEISANGTSFLNRIEAMNCERIITKLFRDG-----VKPEQIGVITPYEGQRAYILQYMQMNGSLDKDLYIKVEVASVDAFQGREKDYIILSCVRANEQQA------------------IGFLRDPRRLNVGLTRAKYGLVILGNPRSLARNTLWNHLL 825          
BLAST of Mov10 like RISC complex RNA helicase 1 vs. Ensembl Yeast
Match: HCS1 (Hexameric DNA polymerase alpha-associated DNA helicase A; involved in lagging strand DNA synthesis; contains single-stranded DNA stimulated ATPase and dATPase activities; replication protein A stimulates helicase and ATPase activities [Source:SGD;Acc:S000001500])

HSP 1 Score: 134.42 bits (337), Expect = 1.012e-32
Identity = 136/507 (26.82%), Postives = 224/507 (44.18%), Query Frame = 1
Query: 2068 FYNESLNELQRVAVVRILHGYSRPLPYVLFGPPGTGKTVTLVEAILQVYKNVASSRILVCAPSNSAADLLCLRLD----ESGVLETGEMVRM-NAYRRSILSELSDKEPI--------------PARVLPYCKSVDDLAEVAMYR-------------------IIICTCTSSGA-----LYRLGLKTGHITHVFVDEAGQASEPEIMISLGFTNRCNGQIILAGDPMQLGPVIRSPYAQQLQESYLHRLLLTCDLYKKQKEICAGSTTHFNPLIVTQLLQNYRAHPALLKLPSDMFYEGTLIP-CVVKNRFINWKWLP-----------NPEVPLVFQGVRGKELRNPRNPST-----YNPSEAVMVVRWIGRLLQDTDNIGKLKDKNISVITPYRAQVDCIRKLISSCLDNVNLAKLKVASVEEFQGQENEVVIISTVRSSLDESGNNGVHESFAILNMVGSRLGFLSNKRRFNVSITRACSLLIVIGDPGLL-----KYDECWS 3393
            F N +LN+ Q+ A+   ++        ++ GPPGTGKT TL+E I Q+       RIL+C PSN + D +  RL      + +L  G   R+ ++ +R  L  LS K  I                ++  Y +  ++  E+ + R                   I++ T   S +     LYR          + +DE  QA EP+  I L        +++LAGD  QL P I++    +  ++ +H L  T  L+ +  +I           +V  L   YR +  +++ PS   Y G L+    V NR +    LP           + ++PL++   +G E +   + +T     YN  E  +V   I  L         + + +I VI+PY AQV  ++KLI    D + L  +++++V+ FQG+E +V+I+S VRS          +E F +        GFL  +RR NV++TR    L+V+G+  +L     KY + WS
Sbjct:  203 FLNPNLNDSQKTAINFAINNDLT----IIHGPPGTGKTFTLIELIQQLLIKNPEERILICGPSNISVDTILERLTPLVPNNLLLRIGHPARLLDSNKRHSLDILSKKNTIVKDISQEIDKLIQENKKLKNYKQRKENWNEIKLLRKDLKKREFKTIKDLIIQSRIVVTTLHGSSSRELCSLYRDDPNFQLFDTLIIDEVSQAMEPQCWIPLIAHQNQFHKLVLAGDNKQLPPTIKT----EDDKNVIHNLETT--LFDRIIKIFPKRD------MVKFLNVQYRMNQKIMEFPSHSMYNGKLLADATVANRLL--IDLPTVDATPSEDDDDTKIPLIWYDTQGDEFQETADEATILGSKYNEGEIAIVKEHIENLRS-----FNVPENSIGVISPYNAQVSHLKKLIH---DELKLTDIEISTVDGFQGREKDVIILSLVRS----------NEKFEV--------GFLKEERRLNVAMTRPRRQLVVVGNIEVLQRCGNKYLKSWS 665          
BLAST of Mov10 like RISC complex RNA helicase 1 vs. Ensembl Yeast
Match: SEN1 (ATP-dependent 5' to 3' RNA/DNA and DNA helicase; subunit of the exosome-associated Nrd1p complex that mediates 3' end formation of snRNAs, snoRNAs, CUTs and some mRNAs; helicase-independent role in transcription-coupled repair; coordinates replication with transcription, associating with moving forks and preventing errors that occur when forks encounter transcribed regions; homolog of Senataxin, implicated in Ataxia-Oculomotor Apraxia 2 and a dominant form of juvenile ALS [Source:SGD;Acc:S000004422])

HSP 1 Score: 100.523 bits (249), Expect = 1.159e-21
Identity = 92/331 (27.79%), Postives = 146/331 (44.11%), Query Frame = 1
Query: 2449 IICTCTSSGA---LYRLGLKTGHITHVFVDEAGQASEPEIMISLGFT-NRCNGQIILAGDPMQLGPVIRSPYAQQLQESYLHRLLLTCDLYKKQKEICAGSTTHFNPLIVTQLLQNYRAHPALLKLPSDMFYEGTLIPC----VVKNRFINWKWLPNPEVPL-VFQGVRGKELRNPRNPSTYNPSEAVMVVRWIGRLLQDTDNIGKLKDKNISVITPYRAQVDCIRKLISSCLDNVNLAKLKVASVEEFQGQENEVVIISTVRSSLDESGNNGVHESFAILNMVGSRLGFLSNKRRFNVSITRACSLLIVIGDPGLLKYDECWSSLMKYAK 3414
            IIC+  S  A   L  +G+K      V +DEA Q +E   +I L +   RC    I+ GDP QL P + S  A                 +K  + +      + +P +   L   YR HP++ K PS  FY+G L       ++  R   W  L  P  P   F  + G++ +N +  S  N  E  + +  +  L +  DN      K I +I+PYR Q+  +RK  +     +    +   +++ FQGQE E+++IS VR+                 +   S +GFL + RR NV++TRA + + V+G    L   + W  L++ AK
Sbjct: 1564 IICSTLSGSAHDVLATMGIK---FDTVIIDEACQCTELSSIIPLRYGGKRC----IMVGDPNQLPPTVLSGAASN---------------FKYNQSLFVRMEKNSSPYL---LDVQYRMHPSISKFPSSEFYQGRLKDGPGMDILNKR--PWHQL-EPLAPYKFFDIISGRQEQNAKTMSYTNMEEIRVAIELVDYLFRKFDNKIDFTGK-IGIISPYREQMQKMRKEFARYFGGMINKSIDFNTIDGFQGQEKEIILISCVRA-----------------DDTKSSVGFLKDFRRMNVALTRAKTSIWVLGHQRSLAKSKLWRDLIEDAK 1848          
BLAST of Mov10 like RISC complex RNA helicase 1 vs. Ensembl Yeast
Match: ECM32 (DNA dependent ATPase/DNA helicase; helicase belonging to the Dna2p- and Nam7p-like family of helicases that is involved in modulating translation termination; interacts with the translation termination factors, localized to polysomes [Source:SGD;Acc:S000000978])

HSP 1 Score: 97.8265 bits (242), Expect = 5.549e-21
Identity = 138/519 (26.59%), Postives = 201/519 (38.73%), Query Frame = 1
Query: 2059 QLKFYNESLNELQRVAVVRILHGYSRPLPYVLFGPPGTGKTVTLVEAILQVYKNVASSRILVCAPSNSAADLLCLRLDE-------------------SGVLETGEMVRMNAYRRSILSELSDKEPIPARVLPYCKSVDDLAEVAMYRIIICTCTSSGALYRLGLKTG--------HITHVFVDEAGQASEPEIMISLGFTNRCNGQIILAGDPMQLGPVIRSPYAQQLQESYLHRLLLTCDLYKKQKEICAGSTTHFNPLIVTQLLQNYRAHPALLKLPSDMFYEGTLIPCVVKNRFINWKWLPNPEVPLVF-QGVRGKELRNPRNPS-----TY-NPSEAVMVVRWIGRLLQDTDNIGKLKDKNISVITPYRAQVDCIRKLISSCL-------------DNVNLAK---------------------LKVASVEEFQGQENEVVIISTVRSSLDESGNNGVHESFAILNMVGSRLGFLSNKRRFNVSITRACSLLIVIGDPGLL-KYDECWSSLMKY 3408
            +LKF ++ LN  Q+ AV  +L+        +L GPPGTGKT T+ E I+QV +   +  IL  A SN A D +  ++ E                   S     GE+   N   +++  ++        R     KS D        R+     + S  ++   +  G            V +DEA Q+SE   ++ L      N   +  GD  QL      P   QL+ S   R+L               + T+ NPL+   L   YR HP + + P    Y G L   V   +    K  P  + PL F Q   G E R           TY N  E V +V+ I  L+ D     K+  + I VITPY AQ D +  +++  +             D + L                       L VA+V+ FQG E   +I S VR                  N   +++GFL +KRR NV++TRA   LIV+G+  +L K D  W   + Y
Sbjct:  641 RLKFSSDKLNRSQKTAVEHVLNNSI----TILQGPPGTGKTSTIEEIIIQVIERFHAFPILCVAASNIAIDNIAEKIMENRPQIKILRILSKKKEQQYSDDHPLGEICLHNIVYKNLSPDMQVVANKTRRGEMISKSEDTKFYKEKNRVTNKVVSQSQIIFTTNIAAGGRELKVIKECPVVIMDEATQSSEASTLVPLSLPGIRN--FVFVGDEKQLSSFSNIP---QLETSLFERVL--------------SNGTYKNPLM---LDTQYRMHPKISEFPIKKIYNGELKDGVTDEQ----KAWPGVQHPLFFYQCDLGPESRVRSTQRDIVGFTYENKHECVEIVKIIQILMLDK----KVPLEEIGVITPYSAQRDLLSDILTKNVVINPKQISMQQEYDEIELFNAAGSQGTAGSLQNNVINIINGLHVATVDSFQGHEKSFIIFSCVR------------------NNTENKIGFLRDKRRLNVALTRAKHGLIVVGNKNVLRKGDPLWKDYITY 1107          
BLAST of Mov10 like RISC complex RNA helicase 1 vs. Ensembl Yeast
Match: DNA2 (Tripartite DNA replication factor; single-stranded DNA-dependent ATPase, ATP-dependent nuclease, helicase; tracking protein for flap cleavage during Okazaki fragment maturation; involved in DNA repair/processing of meiotic DNA double strand breaks; component of telomeric chromatin with cell-cycle dependent localization; required for telomerase-dependent telomere synthesis; forms nuclear foci upon DNA replication stress; human homolog DNA2 complements yeast dna2 mutant [Source:SGD;Acc:S000001207])

HSP 1 Score: 75.8702 bits (185), Expect = 3.120e-14
Identity = 108/452 (23.89%), Postives = 195/452 (43.14%), Query Frame = 1
Query: 2080 SLNELQRVAVVRILHGYSRPLPYVLFGPPGTGKTVTLVEAILQVYKNVASSRILVCAPSNSAADLLCLRLDESGVLETGEMVRMNAYRRSILSELSDKEPIPARVLPYCKSVDDLAEVAMYRIIICTCTS-SGALYRLGLKTGHITHVFVDEAGQASEPEIMISLGFTNRCNGQIILAGDPMQLGPVIRSPYAQ--QLQESYLHRLLLTCDLYKK-------QKEICAGSTTHFNPLIVTQLLQ--NYRAHPALLKLP--------------SDMFYEGTLIPCVVKNRFINWKWLPNPEVPLVFQGVRGKELRNPRNPSTYNPSEAVMVVRWIGRLLQDTDNIGKLKDKNISVITPYRAQVDCIRKLISSCLDNVNLAKLKVASVEEFQGQENEVVIISTVRSSLDESGNNGVHESFAILNMVGSRLGFLSNKRRFNVSITRACSLLIVIG 3357
            +LN  Q+ A+ +++      L   + G PGTGKT  + E I  +       R+L+ + ++SA D + ++L  + +     ++R+   +  +  +     P  A V  Y    D L+++    ++  TC   +  L+ L  K     +V +DEA Q S P  +  L + NR     I+ GD  QL P++++  A+   L+ES        C+ + +       Q  +C    T  N LI    L+  N       L+LP              S  + E  L P   K  F+N+   P+    ++ Q  +          +  N  EA + ++ +  +L     +  +  ++I V+T YRAQ+  ++K+ +  +       L++ + ++FQG++ + +IIS VR +   +G                    L   RR NV++TRA S LI+IG
Sbjct: 1051 TLNLNQKEAIDKVMRAEDYAL---ILGMPGTGKTTVIAEIIKILVS--EGKRVLLTSYTHSAVDNILIKLRNTNI----SIMRL-GMKHKVHPDTQKYVPNYASVKSYN---DYLSKINSTSVVATTCLGINDILFTLNEK--DFDYVILDEASQISMPVALGPLRYGNR----FIMVGDHYQLPPLVKNDAARLGGLEESLFKTF---CEKHPESVAELTLQYRMCGDIVTLSNFLIYDNKLKCGNNEVFAQSLELPMPEALSRYRNESANSKQWLEDILEP-TRKVVFLNYDNCPD----IIEQSEKD---------NITNHGEAELTLQCVEGML-----LSGVPCEDIGVMTLYRAQLRLLKKIFNKNV----YDGLEILTADQFQGRDKKCIIISMVRRNSQLNGG-----------------ALLKELRRVNVAMTRAKSKLIIIG 1440          
BLAST of Mov10 like RISC complex RNA helicase 1 vs. Ensembl Nematostella
Match: EDO45106 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTX4])

HSP 1 Score: 417.157 bits (1071), Expect = 7.986e-135
Identity = 224/463 (48.38%), Postives = 297/463 (64.15%), Query Frame = 1
Query: 2068 FYNESLNELQRVAVVRILHGYSRPLPYVLFGPPGTGKTVTLVEAILQVYKNVASSRILVCAPSNSAADLLCLRLDESGVLETGEMVRMNAYRRSILSELSDKEPIPARVLPYCKSVDDLAEVAMYRIIICTCTSSGALYRLGLKTGHITHVFVDEAGQASEPEIMISLGFTNRCNGQIILAGDPMQLGPVIRSPYA--QQLQESYLHRLLLTCDLYKKQKEICAGSTTHFNPLIVTQLLQNYRAHPALLKLPSDMFYEGTLIPC---VVKNRFINWKWLPNPEVPLVFQGVRGKELRNPRNPSTYNPSEAVMVVRWIGRLLQDTDNIGKLKDKNISVITPYRAQVDCIRKLISSCLDNVNLAKLKVASVEEFQGQENEVVIISTVRSSLDESGNNGVHESFAILNMVGSRLGFLSNKRRFNVSITRACSLLIVIGDPGLLKYDECWSSLMKYAKTNNAFIGSE 3441
             YN  LNE QR AV RIL G SRP PY+LFGPPGTGKTVTLVEAILQV+  V SSR++ CAPSNSAADL+ +RL  SG ++ G+M+R+NA++R         + IP  +  YC   D L   A YRII+CTC+++G L+ LGLK GH THVFVDEAGQA+EPE +I +G     +GQIILAGDP QLGPV+RSP A    L  S L RL+    L   + E        ++PL+VT+L+ NYR+HP+LL+LPS +FY   L  C    ++ +   W+ LP    PLVF G++G+++R   +PS +NP EAV VVR++  L        KL D  + +ITPY+ QV+ IR L+S     V + ++KV SVEEFQGQE   +IISTVRS+    G +  H            +GFL N +RFNV++TRA SLL+V+G+P +L  D  W SL++Y    +A+ G +
Sbjct:   11 LYNSRLNERQRAAVARILSGQSRPTPYLLFGPPGTGKTVTLVEAILQVFHRVPSSRVIACAPSNSAADLMAVRLHRSGFIQEGDMIRLNAFQRV--------QEIPESINKYCVDTDSLQLAAHYRIIVCTCSTAGQLFSLGLKPGHFTHVFVDEAGQATEPECLIPIGLAAGEDGQIILAGDPFQLGPVLRSPVAISYGLNVSLLERLM--SGLLYARDETRFVDHGCYDPLLVTKLVNNYRSHPSLLRLPSALFYHSELRVCAERTMREQLSQWEMLPTQGTPLVFHGLKGEDMREGNSPSWFNPVEAVQVVRYVQALKNSATCPIKLAD--LGIITPYKKQVEKIRLLLS----RVGIDEVKVGSVEEFQGQERPAIIISTVRSTEAMVGFDVAHT-----------IGFLDNPKRFNVAVTRAQSLLVVVGNPHVLCRDPYWCSLLQYCVMVDAYTGCD 446          
BLAST of Mov10 like RISC complex RNA helicase 1 vs. Ensembl Nematostella
Match: EDO34496 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SP82])

HSP 1 Score: 347.436 bits (890), Expect = 3.930e-107
Identity = 218/537 (40.60%), Postives = 306/537 (56.98%), Query Frame = 1
Query: 1861 VSFSHSRLPFRRMHLGIELACGTLGDGILFPGKIDMKSSQCVRLSRAGLNELSGVNLMKENELRLVQLKFYNESLNELQRVAVVRILHGYSRPLPYVLFGPPGTGKTVTLVEAILQVYKNVASSRILVCAPSNSAADLLCLRLDESGVLETGEMVRMNAYRRSILSELSDKEPIPARVLPYCKSVDDLAEVAMYRIIICTCTSSGALYRLGLKTGHITHVFVDEAGQASEPEIMISL-GFTNRCN---GQIILAGDPMQLGPVIRSPYAQQ--LQESYLHRLLLTCDLYKKQKEICAGSTTHFNPLIVTQLLQNYRAHPALLKLPSDMFYEGTLIPCVVK---NRFINWKWLPNPEVPLVFQGVRGKELRNPRNPSTYNPSEAVMVVRWIGRLLQDTDNIGKLKDKNISVITPYRAQVDCIRKLISSCLDNVNLAKLKVASVEEFQGQENEVVIISTVRSSLDESGNNGVHESFAILNMVGS-RLGFLSNKRRFNVSITRACSLLIVIGDPGLLKYDECWSSLMKYAKTNNAFIGSE 3441
            V F+ +R P + MH  +EL C  +        K+   S      +   L  L   + +K    RL  +K  +   N+ QR AVV I+ G SRP PY++FGPPGTGKT+T+VE+I QV     +S++L CAPSNSAADL+  R+ +  V+   +M+R+NA+ RS  S LSD   + + +           E+   R+++CT  ++G L    +   H THVF+DE+GQA EPE M+ L G  N  N   GQ++LAGDP QLGPV+RSP A +  L+ S L RL+     Y +  E        + P ++T+LL+NYR+HPA+L+LP+ MFY+  L  C  K       NW  LP    P++F GV GK+LR  ++PS +NP EA  VV+ I + L+D+  +  L    I VI+PYR QV  IR+L    L   N+  +KV SVEEFQG E  V+IISTVRSS +             L M    +LGFL+N++RFNV+ITRA +LLIV+G+P +L  D  W   + Y   N  + G +
Sbjct:    5 VRFTFTRTPLKLMHRALELPCDVI--------KMRQLSDNQQGAAIHHLPPLCDDDKVK----RLFDVKLED---NQEQRQAVVSIVKGTSRPHPYLIFGPPGTGKTITVVESIKQVLHVFPNSKVLACAPSNSAADLILERVMKHNVIPKMKMLRLNAFGRSYAS-LSDSIKVVSCIHDGDFFFPGKEEIMNKRLVVCTLVTAGRLVSADIPDTHFTHVFIDESGQALEPECMVPLAGLLNPENPGGGQLVLAGDPQQLGPVLRSPLAIKYGLRMSLLERLMTRVAAYGRITEDEEDELGEYEPAMLTKLLKNYRSHPAILELPNGMFYDDELETCADKLKRESLCNWSKLPTKGFPILFDGVLGKDLREGKSPSFFNPEEAATVVKHI-KDLRDSRGVRVLM-AEIGVISPYRQQVSKIRQL----LHKNNITGIKVGSVEEFQGDERRVIIISTVRSSQE------------FLKMDAQFKLGFLNNRKRFNVAITRAQALLIVVGNPHVLCKDSHWGRFIHYCVKNKGYRGCD 507          
BLAST of Mov10 like RISC complex RNA helicase 1 vs. Ensembl Nematostella
Match: EDO27306 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T9L8])

HSP 1 Score: 181.415 bits (459), Expect = 8.351e-52
Identity = 103/230 (44.78%), Postives = 143/230 (62.17%), Query Frame = 1
Query: 2533 AGQASEPEIMISLGFTNRCNGQIILAGDPMQLGPVIRSPYA--QQLQESYLHRLLLTCDLYKKQKEICAGSTTHFNPLIVTQLLQNYRAHPALLKLPSDMFYEGTLIPC---VVKNRFINWKWLPNPEVPLVFQGVRGKELRNPRNPSTYNPSEAVMVVRWIGRLLQDTDNIGKLKDKNISVITPYRAQVDCIRKLISSCLDNVNLAKLKVASVEEFQGQENEVVIISTV 3207
            AGQA+EPE +I +G     +GQIILAGDP QLGPV+RSP A    L  S L RL+    L   + E        ++PL+VT+L+ NYR+HP+LL+LPS +FY   L  C    ++ +   W+ LP    PLVF G++G+++R   +PS +NP EAV VVR++  L      +  +K  ++ VITPY+ QV+ IR L+S     V + ++KV SVEEFQGQE   +IISTV
Sbjct:    2 AGQATEPECLIPIGLAAGEDGQIILAGDPFQLGPVLRSPVAISYGLNVSLLERLM--SGLLYARDETRFADHGCYDPLLVTKLVNNYRSHPSLLRLPSALFYHSELRVCAERTMREQLSQWEMLPTQGTPLVFHGLKGEDMREGNSPSWFNPVEAVQVVRYVQAL--KNSAMCPIKLADLGVITPYKKQVEKIRLLLS----RVGIDEVKVGSVEEFQGQERPAIIISTV 223          
BLAST of Mov10 like RISC complex RNA helicase 1 vs. Ensembl Nematostella
Match: EDO45137 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTS2])

HSP 1 Score: 182.956 bits (463), Expect = 1.673e-46
Identity = 153/472 (32.42%), Postives = 231/472 (48.94%), Query Frame = 1
Query: 2083 LNELQRVAVVRILHGYSRPLPYVLFGPPGTGKTVTLVEAI-----LQVYKNVASSRILVCAPSNSAADLLCLRLDESGVLETGEMVRMNAYRRSILSELSDKEPIPARVLPYCK--------SVDDLAEVAMYRIIICTCTSSGALYRLGLKTGHITHVFVDEAGQASEPEIMISLGFTNRCNGQIILAGDPMQLGPVIRSPYAQQ--LQESYLHRLLLTCDLYKKQKEICAGSTTHFNPLIVTQLLQNYRAHPALLKLPSDMFYEGTLIPCVVKNRFINWKWLPNPEVPLVFQGVRGKELRNPRNPSTYNPSEAVMVVRWIGRLLQD--TDNIGKLKDKNISVITPYRAQVDCIRKLISSCLDNVNLAKLKVASVEEFQGQENEVVIISTVRSSLDESGNNGVHESFAILN--MVGSRLGFLSNKRRFNVSITRACSLLIVIGDPGLL----KYDECWSSLMKYAKTNNAF 3429
            LN+ Q  A+  IL    RP P ++FGP GTGKT T+ EA+     L      A+ RIL+C  SNSAAD   +      V  + E+         I  E      +   VL YC         ++    ++    +I+ T  ++  L ++GL +G+ +HVF+DEA QA E E +I L  T + + +I+LAGD +Q+G  + SP A++  L  S L RL    +LY ++ +         + L+   LL+NYRA+  ++++PS +FYEGTLI    K+R          E P+ F GV G+E R     S YN +EA  V   +  L++    ++   ++ + I V+TPY AQV  IR+L    L    L +++V SV   QG E + + IST            VH +F +    +    LGFLS+ R  N ++TRA   L ++GDP  L    K   CW  +      +  F
Sbjct:  449 LNKPQATALSHILDPRPRP-PLLIFGPFGTGKTRTIAEAVKELCRLHAGNTAANLRILICTHSNSAADHYIVDYLHPFVT-SSEIGPFLCRPLRICWEHRFFSSVSHTVLKYCLIDRETGRFAIPSRQDIDCVSVIVTTLVTADVLVKMGLPSGYFSHVFIDEAAQAMEAETLIPLCLTQQ-STRIVLAGDHLQMGAHVFSPVARRLCLDRSLLVRLY---ELYPRESD---------SKLL---LLENYRAYNDIVEIPSKLFYEGTLI--AHKHR------PEGSEYPIRFHGVLGREERAVDRASYYNMAEAAEVSERVEELVKQWRGEDAEDVELRRICVLTPYTAQVREIRQL----LRRSQLGEVRVESVNNVQGLEFDALFIST------------VHTAFGLTPEMLDNHHLGFLSDPRLLNTAVTRAKYHLTIVGDPNALCGAGKCKACWKIIFSKCSEHGTF 878          

HSP 2 Score: 67.781 bits (164), Expect = 2.542e-11
Identity = 90/330 (27.27%), Postives = 148/330 (44.85%), Query Frame = 1
Query: 2446 IIICTCTSSGALYRLGLKT-GHITHVFVDEAGQASEPEIMI-SLGFTNRCNGQIILAGDPMQLGPVIRSPYAQQLQESYLHRLLLTCDLYKKQKEICAGSTTHFNPLIVTQLLQNYRAHPALLKLPSDMFYEGTLIPCVVKN---RFINWKWLPNPEVPLVFQGVRGKELRNPRNPSTY------NPSEAVMVVRWIGRLLQDTDNIGKLKDKNISVITPYRAQVDCIRKLISSCLDNVNLAKLKVASVEEFQGQENEVVIISTVRSSLDESGNNGVHESFAILNMVGSRLGFLSNKRRFNVSITRACSLLIVIGDPGLLKYDECWSSLM 3402
            IIICTC  +G+     ++T  +I    VDE+    EPE+++ ++    RC+ + +L GD  QL PV++S  A +L    L R L   DL++  +E  +   T         L   +R HP+L K  S  FY        V N   R +   W    ++  VF  V  +    P +   Y      N +E   VV  +  L+  +  +   K   I +++P+  Q   I   + S L   +   +++ S EE QG + +V+++STVR    +    G H  F          G L +K + NV +TRA   L+++G+   L  +  W+ L+
Sbjct: 2531 IIICTCAEAGSQR---MRTHANIAQCIVDESNYCLEPEVLVPAVTAGPRCS-RFVLVGDHKQLVPVLQSKEAWKLG---LGRSLFE-DLWEAHREGSSACCT---------LNTQHRMHPSLGKFSSSFFYNVQQSRENVSNACARELEGFWPAGRDLYHVFCHVEDE----PESDCDYIEGGMSNDAEVQKVVEVVESLM--SRGVQPFK---IWIVSPFLRQRHSILHALDSTLG--SQLDIRLTSPEECQGAQCDVLVLSTVRGRPRDQ-LTGPHGGF----------GCLGDKHQMNVVLTRARKGLVIVGNRYYLSGNPMWNRLL 2821          
BLAST of Mov10 like RISC complex RNA helicase 1 vs. Ensembl Nematostella
Match: EDO31025 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZ42])

HSP 1 Score: 100.523 bits (249), Expect = 6.756e-23
Identity = 96/344 (27.91%), Postives = 160/344 (46.51%), Query Frame = 1
Query: 2443 RIIICTCTSSGALYRLGLKTGHITHVFVDEAGQASEPEIMISLGFTNRCNGQIILAGDPMQLGPVIRSPYAQQLQESYLHRLLLTCDLYKKQKEICAGSTTHFNPLIVTQLLQNYRAHPALLKLPSDMFYEGTLI-PCVVKNR------FINWKWLPNPEVPLVFQGVRGKE------LRNPRNPSTYNPSEAVMVVRWIGRLLQDTDNIGKLKDKNISVITPYRAQVDCIRKLISSCLDNVNLAKLKVASVEEFQGQENEVVIISTVRS-SLDESGNNGVHESFAILNMVGSRLGFLSNKRRFNVSITRACSLLIVIGDPGLLKYDECWSSLMKYAKTNNAFI 3432
             II+CTC++SGA   + L   +I  V VDE G   EPE ++ +  T     Q++L GD  QL P+I+   A+        RL L   ++++  +                L + YR H  +   PS+ FY+  L+    V  R      F   + L   +VP VF  V G E       +   + S  N  EA   V  + ++L    N   +   ++ ++TPYR Q   I++ + +  D++     +V+++ + QG E + VI+S VRS   DE       E+      +G  LGFL ++ + NV++TRA   L +IG+  L++ D  WS+L+ + +     +
Sbjct:    1 EIILCTCSASGADRIVDL-CDNIQQVIVDECGMCFEPETLVPI--TCARAKQVVLIGDHKQLQPIIKDNDAK--------RLGLEISMFERYAKK------------AIMLKEQYRMHAEICHFPSEQFYDKLLLTSATVALRTPSPVDFWPAQVLHRKDVPRVFCHVEGCEKSSVIKTQYSNHGSKSNEKEANKAVH-VAKVLV---NKYAVNHGDVVILTPYRQQQVLIKEGLHAPYDDI-----QVSTIIKSQGSEWDYVILSLVRSLPKDEI------EAEPSSKWLGDNLGFLRDEHQINVALTRARRGLCIIGNKNLVELDPTWSALLSHYEQGETIV 306          
BLAST of Mov10 like RISC complex RNA helicase 1 vs. Ensembl Medaka
Match: ENSORLT00000003680.2 (Mov10 like RISC complex RNA helicase 1 [Source:NCBI gene;Acc:101169938])

HSP 1 Score: 446.817 bits (1148), Expect = 5.279e-137
Identity = 275/718 (38.30%), Postives = 402/718 (55.99%), Query Frame = 1
Query: 1399 LSAAAPVKLRSVLTKVYPHKLKLYPIPEQLEQRVVNKEDIMGLYAVLKEKLGPGNYSKKMDLLVHLEEVNAKEEMKELVLENVRLMRRRDTFGIEVPGLSEGRPSLMXXXXXXXXXXXXXXXT--FSGSIEDILCEVIFVKFHATLESSYRNEECTVSFSHSRLPFRRMHLGIELACGTLGDGILFPGKIDMKSSQCVRLSRAGLNELSGV--------------NLMKENELRLVQLK----------------FYNESLNELQRVAVVRILHGYSRPLPYVLFGPPGTGKTVTLVEAILQVYKNVASSRILVCAPSNSAADLLCLRLDESGVLETGEMVRMNAYRRSILSELSDKEPIPARVLPYCKSVDDLAEVAMYRIIICTCTSSGALYRLGLKTGHITHVFVDEAGQASEPEIMISLGFTNRCNGQIILAGDPMQLGPVIRSPYAQ--QLQESYLHRLLLTCDLYKKQKEICAGSTTHFNPLIVTQLLQNYRAHPALLKLPSDMFYEGTL---IPCVVKNRFINWKWLPNPEVPLVFQGVRGKELRNPRNPSTYNPSEAVMVVRWIGRLLQDTDNIGKLKDKNISVITPYRAQVDCIRKLISSCLDNVNLAKLKVASVEEFQGQENEVVIISTVRSSLDESGNNGVHESFAILNMVGSRLGFLSNKRRFNVSITRACSLLIVIGDPGLLKYDECWSSLMKYAKTNNAFIGSE 3441
            ++ +AP   +    +  P+    YP+P+ L   V    D++ +   L E L P N   +   L+ LEE++A++EMKE  +    L +      +EV GLSEGRP L +GDK+ +K    + V   ++  + +I  E + ++ +   + SY  E   V F  +RLP RR H  +E       D +LFP ++ +++ Q        ++++  +                  EN+ +  Q++                F+N  LN  QR AV RIL G  RP+PYVLFGPPGTGKT+TL+E ILQVY  + +SRILVC PSNSAADL+C RL  SG LE G + R+NA+ R       D E +P  + PY K+ +D+   A +RI++ TC+S+G  + +G++ G  +H+F+DEAGQA+EPE MI +   +  +GQI+LAGDP QLGPV++S  A    L  S L R L+T  LY +Q        + ++P +VT+L+ NYR+H  LL LPS +FY G L    P  V +    W  LP    PL+F GVRG E+R   NPS +NP EAV V+ +  +L +       +   +I +I PYR Q + IR L    L  V L  +KV SVEEFQGQE  V+I+STVRS      N  V       N + S LGFLSN +RFNV++TR+ +LL+++G+P +L  D C+ +L++Y  TN A++G +
Sbjct:  486 ITVSAPRDTQRFSKRRLPNFTPAYPVPQALRDCVERSGDVLVIKPCLGEVLSPSNMQSRFSTLLWLEELHAEKEMKEFSIVGALLRKGAVHLHLEVLGLSEGRPHLNIGDKITLKKPQTNGVVIEYTSYVTEIDEEEVSLRVNTDFQRSYLGEPLDVEFCLNRLPMRRCHHALE-QTKHFRD-VLFPSRVTLQTPQWNGQWLKDVDQIKAIKNAESAPTQDGKASTASAENKSKAPQIESTDGAVSMRAIPVSGHFFNPVLNPAQREAVKRILAGECRPIPYVLFGPPGTGKTITLIEVILQVYHFLPNSRILVCTPSNSAADLICTRLHYSGFLENGSLARVNAFSR-------DNESLPEVLRPYAKAGEDIRHAAFHRIVVSTCSSAGMFHNIGIRVGQFSHLFLDEAGQATEPESMIPISLISEKDGQIVLAGDPCQLGPVVKSEVASVFGLGVSLLER-LMTNPLYSRQD-------SGYDPKLVTKLIYNYRSHEVLLSLPSKLFYHGELSFQAPRSVVDSLSEWNSLPKKGFPLLFHGVRGTEMREGSNPSWFNPVEAVQVMMYCCQLAKKL--YKPVNAADIGIIAPYRKQCEKIRVL----LGKVGLQDIKVGSVEEFQGQEYLVIILSTVRS------NESVQS-----NDLQSLLGFLSNPKRFNVAVTRSKALLLIVGNPHMLIRDPCFGALLQYCYTNGAYLGCD 1169          
BLAST of Mov10 like RISC complex RNA helicase 1 vs. Ensembl Medaka
Match: MOV10 (Mov10 RISC complex RNA helicase [Source:NCBI gene;Acc:101175158])

HSP 1 Score: 338.576 bits (867), Expect = 6.861e-99
Identity = 238/711 (33.47%), Postives = 369/711 (51.90%), Query Frame = 1
Query: 1426 RSVLTKVYPHKLKLYPIPEQL--------EQRVVNKEDIMGLYAVLKEKLGPGNYSKKMDLLVHLEEVNAKEEMKELVLENVRLM--------RRRDTFGIEVPGLSEGRPSLMXXXXXXXXXXXXXXXTFSGSIEDILCEVIFVKFHATLESSYRNE---------ECTVSFSHSRLPFRRMHLGIELACGTLGDGILFPGKIDMKSSQCVRLSRAGLNELSGVNLMKENELRLVQLKFYNESL--NELQRVAVVRILHGYSRPLPYVLFGPPGTGKTVTLVEAILQVYKNVASSRILVCAPSNSAADLLCLRLDESGVLETGEMVRMNAYRRS---ILSELSDKEPIPARVLPYCKSVDDLAEVAMYRIIICTCTSSGALYRLGLKTGHITHVFVDEAGQASEPEIMISL-GFTNRCNGQIILAGDPMQLGPVIRSPYAQQ--LQESYLHRLLLTCDLYKKQKEICAGSTTHFNPLIVTQLLQNYRAHPALLKLPSDMFYEGTLIPCVVK---NRFINWKWLPNPEVPLVFQGVRGKELRNPRNPSTYNPSEAVMVVRWIGRLLQDTDNIG--KLKDKNISVITPYRAQVDCIRKLISSCLDN---VNLAKLKVASVEEFQGQENEVVIISTVRSSLDESGNNGVHESFAILNMVGSRLGFLSNKRRFNVSITRACSLLIVIGDPGLLKYDECWSSLMKYAKTNNAFIG 3435
            +SV+   Y  +LK Y +P+ +        E R  +    M    VL+  L   NY +K  L+++LEE+  + +++   + N              +    +E+PG+SE RPS++ GD + V  +G+ +  + G +  +  + + + F +     ++           +  V F  +RL  R  H   ELA       +LFP +      Q                        L +L  ++  L  N  Q  AV +IL G SRP PY++FGPPGTGKTVT+VEAI Q+ K      IL CAPSNSAADLLC ++ E   ++  ++ RM A  R    +   L D     + ++  C        +  Y+I++ T  ++G L    +  GH THVFVDEAG A E E ++ + G  +    Q++LAGDP QLGP++RSP+A +  +  S L RL+    LY+K +         +N   VT+LL+NYR+HPA+LK+P+D+FY+G L PC  +   + +  W+ LP  E P++F GV G + R   +PS +N +E  +++ ++ +LL+     G  K+  K I +I PYR QV  IR+ +     N   +++  LKV SVEEFQGQE  V+++STVRSS   S      + F+        LGF+ N++RFNV++TRA +LLIV+G+P +LK D  W+  ++Y K +    G
Sbjct:  304 QSVMKLNYVVELKPYKVPQHMTHLIGLLKESRFNSDSRKM----VLESPLTWENYKEKFQLMLYLEELQMEVDIRRYNIPNSDKEYAVLSPDPSSKQLLVLELPGVSENRPSVLRGDSLLVYPQGETNKKYRGYVHGVQLDSVKLGFASEFLDRFKRGKDFSLLQGIKFNVEFVINRLTLRLQHRAAELAFTNKLGSVLFPSEPPCSCQQP----------------------DLPKLSLFDRQLEKNPEQYGAVQQILIGSSRPAPYLVFGPPGTGKTVTVVEAIKQIEKFQTCCHILACAPSNSAADLLCTKILEH--VDRHKVYRMYATSRDPKLVPDHLKDV----SNLVGECYEFPSKETLMEYKILVTTLLTAGRLVSGAIPVGHFTHVFVDEAGHAVETECLVPIAGLFDASFCQLVLAGDPKQLGPILRSPFALKYGMGVSLLERLMNNFPLYQKNE-------GDYNKRFVTKLLRNYRSHPAILKIPNDLFYDGELQPCAEEYSCSSYCFWRHLPKMEFPVIFHGVAGLDEREKTSPSFFNVAEIEVLMDYVQKLLEAQGKKGEPKIAPKEIGIIAPYRKQVQKIRRALEKVGQNFRLLDMNALKVGSVEEFQGQERRVILVSTVRSS---SEYMEFDKKFS--------LGFVKNEKRFNVAVTRAKALLIVVGNPVVLKTDPTWARFLQYCKDDGGDTG 964          
BLAST of Mov10 like RISC complex RNA helicase 1 vs. Ensembl Medaka
Match: ENSORLT00000034865.1 (putative helicase mov-10-B.2 [Source:NCBI gene;Acc:101175667])

HSP 1 Score: 283.493 bits (724), Expect = 1.541e-80
Identity = 217/652 (33.28%), Postives = 343/652 (52.61%), Query Frame = 1
Query: 1540 KEKLGPGNYSKKMDLLVHLEEVNAKEEMKELVLENVRLMRRR---DTFGIEVPGLSEGRPSLMXXXXXXXXXXXXXXXTFSGSIEDILCEVIFVKFHATLESSYRNE-ECTVSFSHSRLPFRRMHLGIELACGTLGDGILFPGKIDMKSSQCVRLSRAGLNELSGVNLMKENELRLVQLKFYNESLNELQRVAVVRILHGYSRPLPYVLFGPPGTGKTVTLVEAILQVYKNVASSRILVCAPSNSAADLLCLRLDESGVLETGEMVRMNAYRRSILSELSDKEPIPARVLPYCK--------SVDDLAEVAMYRIIICTCTSSGALYRLGLKTGHITHVFVDEAGQASEPEIMISL-GFTNRCNGQIILAGDPMQLGPVIRSPYAQQ--LQESYLHRLLLTCDLYKKQKEICAGSTTHFNPLIVTQLLQNYRAHPALLKLPSDMFYEGTLIPCVVKNRFIN-WKWLPNPEVPLVFQGVRGKELRNPRNPSTYNPSEAVMVVRWIGRLLQ--DTDNIGKLKDKNISVITPYRAQVDCIRKLI--SSCLDNVNLAKLKVASVEEFQGQENEVVIISTVRSSLDESGNNGVHESFAILNMVGSRLGFLSNKRRFNVSITRACSLLIVIGDPGLLKYDECWSSLMKYAKTNNAFIG 3435
            ++ L   NY+++  +L+HLEE++ +E + +   ENV +   +   +TF +++ G S     ++    V +     D+  + G + DI  + IF+KF    E   R    C V+F  +R+  R  H    +A       +LFP +         RL R     L  +N       R  + +F     N  Q+ AV  IL   ++P  Y+L GPPGTGKT+TLV+AI+++ K      ILVCAPSNSA+D +C ++ + G+++T ++ R+     SI         IP  +   C          + +   +   +I++ T  ++G L   G+   H T++FVDEAGQA+E E MI + G  +R   Q++LAGDP QLGPV+ S  A+   L  S L RL+   DLYK  ++        F+   +T+LL+NYR+HPA+LK+P+D+FY G L PC   ++  N  + LP    P+VF GV G   +     S YN +E  ++  ++  L+Q    +N+  +    I +I+PYR QV+ I+K I   + L   NL  ++V +V++FQG+E  V+++STVR           H+   I       LGF+ + RRFNV++TRA SLL+V+GDP LL  D+ W++ + Y     A+ G
Sbjct:  237 QKPLNSENYARRFHMLLHLEELHLQESLDKYNQENVLVTAHKSNSETFTLKITGPSYNSSVVLSCCFVTLVPSDVDNKVYEGIVHDIREDRIFIKFLN--EVPDRGVLRCGVTFKLNRMCLRMQHRAAAMAAERGPMDLLFPTR---------RLPR-----LLALN-------RPPRFEF-----NPEQQKAVTHILRRTAKPAAYLLCGPPGTGKTLTLVKAIMEIVK-AQDINILVCAPSNSASDDICEKILK-GLVDTDKVYRLYPLLHSIAK-------IPEILKKNCNLDQKKGTIKIPNKKSIMSRKILVTTLQTAGRLVTGGIPPKHYTYIFVDEAGQATETESMIPIAGLCDRSTCQVVLAGDPKQLGPVVISKTAEYHGLGVSLLERLMRDNDLYKPHEDFG------FDSNFITKLLKNYRSHPAILKVPNDLFYGGELQPCARLSKLYNQLELLPKEGFPVVFHGVAGISQQEKGFSSFYNMAEIEVIKEYLKSLIQHLHRNNVSHVPPGEIGIISPYRKQVEKIQKAIQWDADLSKENLENVEVGTVDKFQGKEFSVILMSTVRCFPKLK-----HKQNFI-------LGFIRDDRRFNVAMTRARSLLVVVGDPRLLATDKNWNTFIHYCLKAGAYRG 833          
BLAST of Mov10 like RISC complex RNA helicase 1 vs. Ensembl Medaka
Match: UPF1 (UPF1 RNA helicase and ATPase [Source:NCBI gene;Acc:101168695])

HSP 1 Score: 159.458 bits (402), Expect = 3.435e-39
Identity = 138/495 (27.88%), Postives = 231/495 (46.67%), Query Frame = 1
Query: 2065 KFYNESLNELQRVAVVRILHGYSRPLPYVLFGPPGTGKTVTLVEAILQVYKNVASSRILVCAPSNSAADLLCLRLDESGVLETGEMVRMNAYRRSIL----------SELSDKEPIPA-RVLPYCK-------SVDDLAEVAMYR-----------IIICTCTSSGA--LYRLGLKTGHITHVFVDEAGQASEPEIMISLGFTNRCNGQIILAGDPMQLGPVIRSPYAQQ--LQESYLHRLLLTCDLYKKQKEICAGSTTHFNPLIVTQLLQNYRAHPALLKLPSDMFYEGTLIPCVVK----NRFINWKWLPNPEVPLVFQGVRGKELRNPRNPSTYNPSEAVMVVRWIGRLLQDTDNIGKLKDKNISVITPYRAQVDCIRKLI--SSCLDNVNLAKLKVASVEEFQGQENEVVIISTVRSSLDESGNNGVHESFAILNMVGSRLGFLSNKRRFNVSITRACSLLIVIGDPGLLKYDECWSSLMKYAKTNNAFI 3432
            +F  + L +L    V  +     RPL  ++ GPPGTGKTVT    +  + +   +  +LVCAPSN A D L  ++D++G+    ++VR+ A  R  +          +++S+ + +P  + L   K       S D+    A+ R           +I CTC  +G   L ++  ++     + +DE+ QA+EPE M+ +    +   Q+IL GD  QLGPV+    A +  L +S   RL++                    P+   +L   YR HPAL   PS++FYEG+L   V       +  +++W P P+ P+ F   +G+E       S  N +EA  V +   RLL+        K   I +ITPY  Q   + + +  S  L      ++++ASV+ FQG+E + +I+S VR++  +                   +GFL++ RR NV++TRA   +I++G+P  L     W++L+   K     +
Sbjct:  443 RFTAQGLPDLNHSQVYAVKTVLQRPLS-LIQGPPGTGKTVTSATIVYHLSRQ-GNGPVLVCAPSNIAVDQLTEKIDKTGL----KVVRLCAKSREAIESPVSFLALHNQISNMDSMPELQKLQQLKDETGELSSADEKRYRALKRTAERELLMNADVICCTCVGAGDPRLAKMQFRS-----ILIDESTQATEPECMVPVVLGAK---QLILVGDHCQLGPVVMCKKAAKAGLSQSLFERLVVL----------------GIRPI---RLQVQYRMHPALSAFPSNIFYEGSLQNGVTAADRIKKGFDFQW-PQPDKPMFFYVTQGQEEIASSGTSYLNRTEAANVEKITTRLLK-----AGAKPDQIGIITPYEGQRSYLVQYMQFSGSLHTKLYQQVEIASVDAFQGREKDFIILSCVRANEHQG------------------IGFLNDPRRLNVALTRAKYGVIIVGNPKALSKQPLWNNLLNNYKEQKVLV 880          
BLAST of Mov10 like RISC complex RNA helicase 1 vs. Ensembl Medaka
Match: helz (helicase with zinc finger [Source:NCBI gene;Acc:101160963])

HSP 1 Score: 150.599 bits (379), Expect = 3.816e-36
Identity = 134/444 (30.18%), Postives = 219/444 (49.32%), Query Frame = 1
Query: 2083 LNELQRVAVVRILHGYSRPLPYVLF-GPPGTGKTVTLVEAILQVYKNVASSRILVCAPSNSAADLLCLRLDESGVLETGEMVRMNAYRRSILSELSDK--EPIPARVLPYC--------KSVDDLAEVAMYRIIICTCTSSGALYRLGLKTGHITHVFVDEAGQASEPEIMISLGFTNRCNGQIILAGDPMQLGPVIRSPYAQQLQESYLHRLLLTCDLYKKQKEICAGSTTHFNPLIVTQLL--QNYRAHPALLKLPSDMFYEGTLIPCVVKNRFINWKWLPNPEVPLVFQGVRGKELRNPRNPSTYNPSEAVMVVRWIGRLLQDTD-NIGKLKDKNISVITPYRAQVDCIRKLISSCLDNVNLAKLKVASVEEFQGQENEVVIISTVRSSLD-ESGNNGVHESFAILNMVGSRL--GFLSNKRRFNVSITRACSLLIVIGDP 3363
            LN  Q+ A++ I    S  LP +L  GP GTGKT TL +A+  + +   +SR+L+C  SNSAADL  ++      +E G     NA+ R +     ++  + +   V  YC          +    ++  +RI++ T ++S  L +L L  G  TH+ +DEA QA E E ++     ++   +I+LAGD MQL P + S +A   +E  LH  LL   LY+           H+      ++L  +NYR+H A++   S++FY+G L+    +    ++        PL F   RG++++   + + YN +E   +V  +  L +      GKL D +I V++PY  QV  IR    + L    + ++ V  V   QG++  V+ +STVR+    +     +     ++      L  GFLSN +  N +ITRA SL+ V+GDP
Sbjct:  626 LNAKQKEAILAITTPISISLPPILIIGPYGTGKTFTLAQAVKHILRQ-DNSRVLICTHSNSAADLY-IKDYLHPYVEAG-----NAHARPLRVYFRNRWVKTVHPLVQQYCLISSTQVTFQMPTREDILRHRIVVVTLSTSQYLCQLDLDPGLFTHILLDEAAQAMECETIMPFALASKST-RIVLAGDHMQLSPFVYSEFA---RERNLHVSLLD-RLYE-----------HYPSEYPCRILLCENYRSHEAIINYTSELFYDGKLMASGKQPSHKDF-------YPLTFFTARGEDVQEKNSTAYYNNAEVFEIVERVEELRKKWPVAWGKLDDGSIGVVSPYADQVFRIR----AELRKKRMHEVSVERVLNVQGKQFRVLFLSTVRTRHTCKHKQTAIKRKEQLVEDSTEDLDYGFLSNYKLLNTAITRAQSLVAVVGDP 1035          
BLAST of Mov10 like RISC complex RNA helicase 1 vs. Planmine SMEST
Match: SMESG000069862.1 (SMESG000069862.1)

HSP 1 Score: 2189.85 bits (5673), Expect = 0.000e+0
Identity = 1094/1127 (97.07%), Postives = 1111/1127 (98.58%), Query Frame = 1
Query:   67 MSLFSQILDGITNYLKPTSFNSDREEYGERFYTGGYDDVQKDIKRESVKGLVTYLDGNKNGRIDGYVNFDSSSVIIFQCEEKNLSIGSEVFMDIIRNSKTSPWFASKIEVLSCHNKGNIEDWDDDNNLDVIKNNNKIEQLPQKQVGMITYACNDNLTFNNEIKFHQRDCGPNSFRPSKGDWVVVQYDHSVDYYSIIGLSPLRYLDFEGVISSFDGNIGYVDREIFFNKSITKGVRLSRGVYVYGTAIESVQNRRCNFRALTIFCKMSSNVNKGLQMRLKTMNKIENGIKTPHNLGLRLNPKAVEFGEQNINETRSKEVTITNENDFPMTLTGIALLSETNNQFVIENCGKEMKISGNSSLKVSVKCVPQFPGFDTQKLFIEGLNKDSTESTESWKLMLDVSVYVFDPVLSSISLEGTEKEPGDKXXXXXXXXXXXXXXMGGVHHLSAAAPVKLRSVLTKVYPHKLKLYPIPEQLEQRVVNKEDIMGLYAVLKEKLGPGNYSKKMDLLVHLEEVNAKEEMKELVLENVRLMRRRDTFGIEVPGLSEGRPSLMXXXXXXXXXXXXXXXTFSGSIEDILCEVIFVKFHATLESSYRNEECTVSFSHSRLPFRRMHLGIELACGTLGDGILFPGKIDMKSSQCVRLSRAGLNELSGVNLMKENELRLVQLKFYNESLNELQRVAVVRILHGYSRPLPYVLFGPPGTGKTVTLVEAILQVYKNVASSRILVCAPSNSAADLLCLRLDESGVLETGEMVRMNAYRRSILSELSDKEPIPARVLPYCKSVDDLAEVAMYRIIICTCTSSGALYRLGLKTGHITHVFVDEAGQASEPEIMISLGFTNRCNGQIILAGDPMQLGPVIRSPYAQQLQESYLHRLLLTCDLYKKQKEICAGSTTHFNPLIVTQLLQNYRAHPALLKLPSDMFYEGTLIPCVVKNRFINWKWLPNPEVPLVFQGVRGKELRNPRNPSTYNPSEAVMVVRWIGRLLQDTDNIGKLKDKNISVITPYRAQVDCIRKLISSCLDNVNLAKLKVASVEEFQGQENEVVIISTVRSSLDESGNNGVHESFAILNMVGSRLGFLSNKRRFNVSITRACSLLIVIGDPGLLKYDECWSSLMKYAKTNNAFIGSESY 3447
            MSLFSQILDGITNYLKPTSFNSDREEYGERFYTGGYDDVQKDIKRESVKGLVTYLDGNKNGRIDGYVNFDSSSVIIFQC+EKNLSIGSEVFMDIIRNSKTSPWFASKIEVLSC NKG +EDWDDDNNLDVIK NNKIEQLPQKQVGMITYACNDNLTFNNEIKFHQRDCGPNSFRPSKGDWVVVQYDHSVDYYSIIGLSPLRYLDFEGVISSFDGNIGYVDREIFFNKSITKGVRLSRGVYVYGTAIESVQNRRCNFRALTIFCKMSSNVNKGLQMRLKTMNKIENGIKTPHNLGLRLNPKAVEFGEQNINET SKEVTITNENDFPMTLTGIALLSETNNQFVIENCGKEMKISGNSSLKVSVKCVPQFPGFDTQKLFIEGLNKDSTESTESWKLMLDVSVYVFDPVLSSIS++GTEKEPGDKSALNLESLLSSSDLMGGVHHLSAAAPVKLRSVLTKVYPHKLKLYPIPEQLEQRVVNKEDIMGLYAVLKEKLGPGNYSKKMDLLVHLEEVNAKEEMKELVLENVRLMRRRDTFGIEVPGLSEGRPSLMVGDKVNVKVKGDDSVTFSGSIEDILCEVIFVKFHATLESSYRNEECTVSFSHSRLPFRRMHLGIELACGTLGDGILFPGKIDMKSSQCVRLSRAGLNELSGVNLMKENELRLVQLKFYNESLNELQRVAVVRILHGYSRPLPYVLFGPPGTGKTVTLVEAILQVYKNVASSRILVCAPSNSAADLLCLRLDESGVLETGEMVRMNAYRRSILSELSDKEPIPARVLPYCKSVDDLAE+AM+RII+CTC SSG++YRLGLK+GHI+HVFVDEAGQASEPEIM++LG  +   GQII+AGDPMQLGPVIRSPYAQQLQESYLHRLLLTCDLYKKQKEICAGSTTHFNPLIVTQLLQNYRAHPALLKLPSDMFYEGTLIPCVVKNRFINWKWLPNPEVPLVFQGVRGKELRNPRNPSTYNPSEAVMVVRWIGRLLQD     +LKD+NISVITPYRAQVDCIRKLISSCLDNVNLAKLKVASVEEFQGQENEVVIISTVRSSLDESGNNGVHESFAILN VGSRLGFLSNKRRFNVSITRACSLLIVIGDPGLLKYDECWSSLMKYAKTNNAFIGSESY
Sbjct:    1 MSLFSQILDGITNYLKPTSFNSDREEYGERFYTGGYDDVQKDIKRESVKGLVTYLDGNKNGRIDGYVNFDSSSVIIFQCQEKNLSIGSEVFMDIIRNSKTSPWFASKIEVLSCPNKGILEDWDDDNNLDVIKKNNKIEQLPQKQVGMITYACNDNLTFNNEIKFHQRDCGPNSFRPSKGDWVVVQYDHSVDYYSIIGLSPLRYLDFEGVISSFDGNIGYVDREIFFNKSITKGVRLSRGVYVYGTAIESVQNRRCNFRALTIFCKMSSNVNKGLQMRLKTMNKIENGIKTPHNLGLRLNPKAVEFGEQNINETHSKEVTITNENDFPMTLTGIALLSETNNQFVIENCGKEMKISGNSSLKVSVKCVPQFPGFDTQKLFIEGLNKDSTESTESWKLMLDVSVYVFDPVLSSISMKGTEKEPGDKSALNLESLLSSSDLMGGVHHLSAAAPVKLRSVLTKVYPHKLKLYPIPEQLEQRVVNKEDIMGLYAVLKEKLGPGNYSKKMDLLVHLEEVNAKEEMKELVLENVRLMRRRDTFGIEVPGLSEGRPSLMVGDKVNVKVKGDDSVTFSGSIEDILCEVIFVKFHATLESSYRNEECTVSFSHSRLPFRRMHLGIELACGTLGDGILFPGKIDMKSSQCVRLSRAGLNELSGVNLMKENELRLVQLKFYNESLNELQRVAVVRILHGYSRPLPYVLFGPPGTGKTVTLVEAILQVYKNVASSRILVCAPSNSAADLLCLRLDESGVLETGEMVRMNAYRRSILSELSDKEPIPARVLPYCKSVDDLAEIAMHRIIVCTCISSGSIYRLGLKSGHISHVFVDEAGQASEPEIMVALGMVSLQKGQIIIAGDPMQLGPVIRSPYAQQLQESYLHRLLLTCDLYKKQKEICAGSTTHFNPLIVTQLLQNYRAHPALLKLPSDMFYEGTLIPCVVKNRFINWKWLPNPEVPLVFQGVRGKELRNPRNPSTYNPSEAVMVVRWIGRLLQDLSAEYQLKDENISVITPYRAQVDCIRKLISSCLDNVNLAKLKVASVEEFQGQENEVVIISTVRSSLDESGNNGVHESFAILNTVGSRLGFLSNKRRFNVSITRACSLLIVIGDPGLLKYDECWSSLMKYAKTNNAFIGSESY 1127          
BLAST of Mov10 like RISC complex RNA helicase 1 vs. Planmine SMEST
Match: SMESG000069873.1 (SMESG000069873.1)

HSP 1 Score: 1975.67 bits (5117), Expect = 0.000e+0
Identity = 996/1127 (88.38%), Postives = 1052/1127 (93.35%), Query Frame = 1
Query:   73 LFSQILDGITNYLKPTSFNSDREEYGERFYTGGYDDVQKDIKRESVKGLVTYLDGNKNGRIDGYVNFDSSSVIIFQCEEKNLSIGSEVFMDIIRNSKTSPWFASKIEVLSCHNKGNIEDWDDDNNL--DVIKNNNKIEQLPQKQVGMITYACNDNLTFNNEIKFHQRDCGPNSFRPSKGDWVVVQYDHSVDYYSIIGLSPLRYLDFEGVISSFDGNIGYVDREIFFNKSITKGVRLSRGVYVYGTAIESVQNRRCNFRALTIFCKMSSNVNKGLQMRLKTMNKIENGIKTPHNLGLRLNPKAVEFGEQNINETRSKEVTITNENDFPMTLTGIALLSETNNQFVIENCGKEMKISGNSSLKVSVKCVPQFPGFDTQKLFIEGLNKDSTESTESWKLMLDVSVYVFDPVLSSISLEGTEKEPGDKXXXXXXXXXXXXXXMGGVHHLSAAAPVKLRSVLTKVYPHKLKLYPIPEQLEQRVVNKEDIMGLYAVLKEKLGPGNYSKKMDLLVHLEEVNAKEEMKELVLENVRLMRRRDTFGIEVPGLSEGRPSLMXXXXXXXXXXXXXXXTFSGSIEDILCEVIFVKFHATLESSYRNEECTVSFSHSRLPFRRMHLGIELACGTLGDGILFPGKIDMKSSQCVRLSRAGLNELSGVNLMKENELRLVQLKFYNESLNELQRVAVVRILHGYSRPLPYVLFGPPGTGKTVTLVEAILQVYKNVASSRILVCAPSNSAADLLCLRLDESGVLETGEMVRMNAYRRSILSELSDKEPIPARVLPYCKSVDDLAEVAMYRIIICTCTSSGALYRLGLKTGHITHVFVDEAGQASEPEIMISLGFTNRCNGQIILAGDPMQLGPVIRSPYAQQLQESYLHRLLLTCDLYKKQKEICAGSTTHFNPLIVTQLLQNYRAHPALLKLPSDMFYEGTLIPCVVKNRFINWKWLPNPEVPLVFQGVRGKELRNPRNPSTYNPSEAVMVVRWIGRLLQDTDNIGKLKDKNISVITPYRAQVDCIRKLISSCLDNVNLAKLKVASVEEFQGQENEVVIISTVRSSLDESGNNGVHESFAILNMVGSRLGFLSNKRRFNVSITRACSLLIVIGDPGLLKYDECWSSLMKYAKTNNAFIGSESY 3447
              ++I D   N +  +S  ++   + E F++G  D  QK IK+  +KG++T+ D N  GRIDG + FD  S I+++ ++K + +GSEV MDI+RNSKTSPW A+KIEVL+C    +++D+  + N+  + +K+N   E+   K VGMITY+ ND LT NN I FHQ+DCGPNSFRP  GDWV++ +DH++    +IG+SPLRYLD+EG+ISSF+GN GY+D+EIFF+K I KG  L+RG  VYGTAIESVQNRRCNFRALTIFCKMSSNVNKGLQ+RLKTMNKIENGIKTPHNLGLRLNPKAVEFGEQNINETRSKEVTITNENDFPMTLTGIALLSETNNQFVIENCGKEMKISGNSSLKVSVKCVPQFPGFDTQKLFIEGLNKDSTESTESWKLMLDVSVYVFDPVLSSIS+EGTEKEPGDKSALNL+SLLSSSDLMGGVHHLSAAAPVKLRSVLTK YPHKLKLYPIPEQLEQRVVNKEDIMGLYAVLKEKLGPGNYSKKMDLLVHLEEVNAKEEMKELVLENVRLMRRRDTFGIEVPGLSEGRPSLMVGDKVNVKVKGDDSVTFSGSIEDILCEVIFVKFHATLESSYRNEECTVSFSHSRLPFRRMHLGIELACGTLGDGILFPGKIDMKSSQCVRLSRAGLNELSGVNLMKENELRLVQLKFYNESLNELQRVAVVRILHGYSRPLPYVLFGPPGTGKTVTLVEAILQVYKNVASSRILVCAPSNSAADLLCLRLDESGVLETGEMVRMNAYRRSILSELSDKEPIPARVLPYCKSVDDLAEVAMYRIIICTCTSSGALYRLGLKTGHITHVFVDEAGQASEPEIMISLGFTNRCNGQIILAGDPMQLGPVIRSPYAQQLQESYLHRLLLTCDLYKKQKEICAGSTTHFNPL+VTQLLQNYRAHPALLKLPSDMFYEGTLIPCVVKNRFINWKWLPNPEVPLVFQGVRGKELRNPRNPSTYNPSEAVMVVRWIGRLLQDTDNIGKLKDKNISVITPYRAQVDCIRKLISSCLDNVNLAKLKVASVEEFQGQENEVVIISTVRSSLDESGNNGVHESFAILN VGSRLGFLSNKRRFNVSITRACSLLIVIGDPGLLKYDECWSSL+KYAKTNNAFIGSESY
Sbjct:    2 FLNKIKDFFYNLIVSSSIYNEPRSHPESFFSGTNDHDQKIIKQNGIKGIITFFD-NDVGRIDGIITFDKLSNIVYKDDKKIIKVGSEVLMDIVRNSKTSPWIATKIEVLNCPELKDLDDFKFNKNICDNTLKSNILTEKPQNKLVGMITYSYNDKLTVNNNINFHQKDCGPNSFRPISGDWVILTFDHTILENKVIGISPLRYLDYEGMISSFNGNSGYIDKEIFFSKYILKGQLLNRGFRVYGTAIESVQNRRCNFRALTIFCKMSSNVNKGLQIRLKTMNKIENGIKTPHNLGLRLNPKAVEFGEQNINETRSKEVTITNENDFPMTLTGIALLSETNNQFVIENCGKEMKISGNSSLKVSVKCVPQFPGFDTQKLFIEGLNKDSTESTESWKLMLDVSVYVFDPVLSSISMEGTEKEPGDKSALNLKSLLSSSDLMGGVHHLSAAAPVKLRSVLTKFYPHKLKLYPIPEQLEQRVVNKEDIMGLYAVLKEKLGPGNYSKKMDLLVHLEEVNAKEEMKELVLENVRLMRRRDTFGIEVPGLSEGRPSLMVGDKVNVKVKGDDSVTFSGSIEDILCEVIFVKFHATLESSYRNEECTVSFSHSRLPFRRMHLGIELACGTLGDGILFPGKIDMKSSQCVRLSRAGLNELSGVNLMKENELRLVQLKFYNESLNELQRVAVVRILHGYSRPLPYVLFGPPGTGKTVTLVEAILQVYKNVASSRILVCAPSNSAADLLCLRLDESGVLETGEMVRMNAYRRSILSELSDKEPIPARVLPYCKSVDDLAEVAMYRIIICTCTSSGALYRLGLKTGHITHVFVDEAGQASEPEIMISLGFTNRCNGQIILAGDPMQLGPVIRSPYAQQLQESYLHRLLLTCDLYKKQKEICAGSTTHFNPLVVTQLLQNYRAHPALLKLPSDMFYEGTLIPCVVKNRFINWKWLPNPEVPLVFQGVRGKELRNPRNPSTYNPSEAVMVVRWIGRLLQDTDNIGKLKDKNISVITPYRAQVDCIRKLISSCLDNVNLAKLKVASVEEFQGQENEVVIISTVRSSLDESGNNGVHESFAILNTVGSRLGFLSNKRRFNVSITRACSLLIVIGDPGLLKYDECWSSLVKYAKTNNAFIGSESY 1127          
BLAST of Mov10 like RISC complex RNA helicase 1 vs. Planmine SMEST
Match: SMESG000069873.1 (SMESG000069873.1)

HSP 1 Score: 1953.33 bits (5059), Expect = 0.000e+0
Identity = 986/1127 (87.49%), Postives = 1043/1127 (92.55%), Query Frame = 1
Query:   73 LFSQILDGITNYLKPTSFNSDREEYGERFYTGGYDDVQKDIKRESVKGLVTYLDGNKNGRIDGYVNFDSSSVIIFQCEEKNLSIGSEVFMDIIRNSKTSPWFASKIEVLSCHNKGNIEDWDDDNNL--DVIKNNNKIEQLPQKQVGMITYACNDNLTFNNEIKFHQRDCGPNSFRPSKGDWVVVQYDHSVDYYSIIGLSPLRYLDFEGVISSFDGNIGYVDREIFFNKSITKGVRLSRGVYVYGTAIESVQNRRCNFRALTIFCKMSSNVNKGLQMRLKTMNKIENGIKTPHNLGLRLNPKAVEFGEQNINETRSKEVTITNENDFPMTLTGIALLSETNNQFVIENCGKEMKISGNSSLKVSVKCVPQFPGFDTQKLFIEGLNKDSTESTESWKLMLDVSVYVFDPVLSSISLEGTEKEPGDKXXXXXXXXXXXXXXMGGVHHLSAAAPVKLRSVLTKVYPHKLKLYPIPEQLEQRVVNKEDIMGLYAVLKEKLGPGNYSKKMDLLVHLEEVNAKEEMKELVLENVRLMRRRDTFGIEVPGLSEGRPSLMXXXXXXXXXXXXXXXTFSGSIEDILCEVIFVKFHATLESSYRNEECTVSFSHSRLPFRRMHLGIELACGTLGDGILFPGKIDMKSSQCVRLSRAGLNELSGVNLMKENELRLVQLKFYNESLNELQRVAVVRILHGYSRPLPYVLFGPPGTGKTVTLVEAILQVYKNVASSRILVCAPSNSAADLLCLRLDESGVLETGEMVRMNAYRRSILSELSDKEPIPARVLPYCKSVDDLAEVAMYRIIICTCTSSGALYRLGLKTGHITHVFVDEAGQASEPEIMISLGFTNRCNGQIILAGDPMQLGPVIRSPYAQQLQESYLHRLLLTCDLYKKQKEICAGSTTHFNPLIVTQLLQNYRAHPALLKLPSDMFYEGTLIPCVVKNRFINWKWLPNPEVPLVFQGVRGKELRNPRNPSTYNPSEAVMVVRWIGRLLQDTDNIGKLKDKNISVITPYRAQVDCIRKLISSCLDNVNLAKLKVASVEEFQGQENEVVIISTVRSSLDESGNNGVHESFAILNMVGSRLGFLSNKRRFNVSITRACSLLIVIGDPGLLKYDECWSSLMKYAKTNNAFIGSESY 3447
              ++I D   N +  +S  ++   + E F++G  D  QK IK+  +KG++T+ D +                ++++ ++K + +GSEV MDI+RNSKTSPW A+KIEVL+C    +++D+  + N+  + +K+N   E+   K VGMITY+ ND LT NN I FHQ+DCGPNSFRP  GDWV++ +DH++    +IG+SPLRYLD+EG+ISSF+GN GY+D+EIFF+K I KG  L+RG  VYGTAIESVQNRRCNFRALTIFCKMSSNVNKGLQ+RLKTMNKIENGIKTPHNLGLRLNPKAVEFGEQNINETRSKEVTITNENDFPMTLTGIALLSETNNQFVIENCGKEMKISGNSSLKVSVKCVPQFPGFDTQKLFIEGLNKDSTESTESWKLMLDVSVYVFDPVLSSIS+EGTEKEPGDKSALNL+SLLSSSDLMGGVHHLSAAAPVKLRSVLTK YPHKLKLYPIPEQLEQRVVNKEDIMGLYAVLKEKLGPGNYSKKMDLLVHLEEVNAKEEMKELVLENVRLMRRRDTFGIEVPGLSEGRPSLMVGDKVNVKVKGDDSVTFSGSIEDILCEVIFVKFHATLESSYRNEECTVSFSHSRLPFRRMHLGIELACGTLGDGILFPGKIDMKSSQCVRLSRAGLNELSGVNLMKENELRLVQLKFYNESLNELQRVAVVRILHGYSRPLPYVLFGPPGTGKTVTLVEAILQVYKNVASSRILVCAPSNSAADLLCLRLDESGVLETGEMVRMNAYRRSILSELSDKEPIPARVLPYCKSVDDLAEVAMYRIIICTCTSSGALYRLGLKTGHITHVFVDEAGQASEPEIMISLGFTNRCNGQIILAGDPMQLGPVIRSPYAQQLQESYLHRLLLTCDLYKKQKEICAGSTTHFNPL+VTQLLQNYRAHPALLKLPSDMFYEGTLIPCVVKNRFINWKWLPNPEVPLVFQGVRGKELRNPRNPSTYNPSEAVMVVRWIGRLLQDTDNIGKLKDKNISVITPYRAQVDCIRKLISSCLDNVNLAKLKVASVEEFQGQENEVVIISTVRSSLDESGNNGVHESFAILN VGSRLGFLSNKRRFNVSITRACSLLIVIGDPGLLKYDECWSSL+KYAKTNNAFIGSESY
Sbjct:    2 FLNKIKDFFYNLIVSSSIYNEPRSHPESFFSGTNDHDQKIIKQNGIKGIITFFDND----------------VVYKDDKKIIKVGSEVLMDIVRNSKTSPWIATKIEVLNCPELKDLDDFKFNKNICDNTLKSNILTEKPQNKLVGMITYSYNDKLTVNNNINFHQKDCGPNSFRPISGDWVILTFDHTILENKVIGISPLRYLDYEGMISSFNGNSGYIDKEIFFSKYILKGQLLNRGFRVYGTAIESVQNRRCNFRALTIFCKMSSNVNKGLQIRLKTMNKIENGIKTPHNLGLRLNPKAVEFGEQNINETRSKEVTITNENDFPMTLTGIALLSETNNQFVIENCGKEMKISGNSSLKVSVKCVPQFPGFDTQKLFIEGLNKDSTESTESWKLMLDVSVYVFDPVLSSISMEGTEKEPGDKSALNLKSLLSSSDLMGGVHHLSAAAPVKLRSVLTKFYPHKLKLYPIPEQLEQRVVNKEDIMGLYAVLKEKLGPGNYSKKMDLLVHLEEVNAKEEMKELVLENVRLMRRRDTFGIEVPGLSEGRPSLMVGDKVNVKVKGDDSVTFSGSIEDILCEVIFVKFHATLESSYRNEECTVSFSHSRLPFRRMHLGIELACGTLGDGILFPGKIDMKSSQCVRLSRAGLNELSGVNLMKENELRLVQLKFYNESLNELQRVAVVRILHGYSRPLPYVLFGPPGTGKTVTLVEAILQVYKNVASSRILVCAPSNSAADLLCLRLDESGVLETGEMVRMNAYRRSILSELSDKEPIPARVLPYCKSVDDLAEVAMYRIIICTCTSSGALYRLGLKTGHITHVFVDEAGQASEPEIMISLGFTNRCNGQIILAGDPMQLGPVIRSPYAQQLQESYLHRLLLTCDLYKKQKEICAGSTTHFNPLVVTQLLQNYRAHPALLKLPSDMFYEGTLIPCVVKNRFINWKWLPNPEVPLVFQGVRGKELRNPRNPSTYNPSEAVMVVRWIGRLLQDTDNIGKLKDKNISVITPYRAQVDCIRKLISSCLDNVNLAKLKVASVEEFQGQENEVVIISTVRSSLDESGNNGVHESFAILNTVGSRLGFLSNKRRFNVSITRACSLLIVIGDPGLLKYDECWSSLVKYAKTNNAFIGSESY 1112          
BLAST of Mov10 like RISC complex RNA helicase 1 vs. Planmine SMEST
Match: SMESG000069873.1 (SMESG000069873.1)

HSP 1 Score: 1919.44 bits (4971), Expect = 0.000e+0
Identity = 965/1038 (92.97%), Postives = 999/1038 (96.24%), Query Frame = 1
Query:  340 MDIIRNSKTSPWFASKIEVLSCHNKGNIEDWDDDNNL--DVIKNNNKIEQLPQKQVGMITYACNDNLTFNNEIKFHQRDCGPNSFRPSKGDWVVVQYDHSVDYYSIIGLSPLRYLDFEGVISSFDGNIGYVDREIFFNKSITKGVRLSRGVYVYGTAIESVQNRRCNFRALTIFCKMSSNVNKGLQMRLKTMNKIENGIKTPHNLGLRLNPKAVEFGEQNINETRSKEVTITNENDFPMTLTGIALLSETNNQFVIENCGKEMKISGNSSLKVSVKCVPQFPGFDTQKLFIEGLNKDSTESTESWKLMLDVSVYVFDPVLSSISLEGTEKEPGDKXXXXXXXXXXXXXXMGGVHHLSAAAPVKLRSVLTKVYPHKLKLYPIPEQLEQRVVNKEDIMGLYAVLKEKLGPGNYSKKMDLLVHLEEVNAKEEMKELVLENVRLMRRRDTFGIEVPGLSEGRPSLMXXXXXXXXXXXXXXXTFSGSIEDILCEVIFVKFHATLESSYRNEECTVSFSHSRLPFRRMHLGIELACGTLGDGILFPGKIDMKSSQCVRLSRAGLNELSGVNLMKENELRLVQLKFYNESLNELQRVAVVRILHGYSRPLPYVLFGPPGTGKTVTLVEAILQVYKNVASSRILVCAPSNSAADLLCLRLDESGVLETGEMVRMNAYRRSILSELSDKEPIPARVLPYCKSVDDLAEVAMYRIIICTCTSSGALYRLGLKTGHITHVFVDEAGQASEPEIMISLGFTNRCNGQIILAGDPMQLGPVIRSPYAQQLQESYLHRLLLTCDLYKKQKEICAGSTTHFNPLIVTQLLQNYRAHPALLKLPSDMFYEGTLIPCVVKNRFINWKWLPNPEVPLVFQGVRGKELRNPRNPSTYNPSEAVMVVRWIGRLLQDTDNIGKLKDKNISVITPYRAQVDCIRKLISSCLDNVNLAKLKVASVEEFQGQENEVVIISTVRSSLDESGNNGVHESFAILNMVGSRLGFLSNKRRFNVSITRACSLLIVIGDPGLLKYDECWSSLMKYAKTNNAFIGSESY 3447
            MDI+RNSKTSPW A+KIEVL+C    +++D+  + N+  + +K+N   E+   K VGMITY+ ND LT NN I FHQ+DCGPNSFRP  GDWV++ +DH++    +IG+SPLRYLD+EG+ISSF+GN GY+D+EIFF+K I KG  L+RG  VYGTAIESVQNRRCNFRALTIFCKMSSNVNKGLQ+RLKTMNKIENGIKTPHNLGLRLNPKAVEFGEQNINETRSKEVTITNENDFPMTLTGIALLSETNNQFVIENCGKEMKISGNSSLKVSVKCVPQFPGFDTQKLFIEGLNKDSTESTESWKLMLDVSVYVFDPVLSSIS+EGTEKEPGDKSALNL+SLLSSSDLMGGVHHLSAAAPVKLRSVLTK YPHKLKLYPIPEQLEQRVVNKEDIMGLYAVLKEKLGPGNYSKKMDLLVHLEEVNAKEEMKELVLENVRLMRRRDTFGIEVPGLSEGRPSLMVGDKVNVKVKGDDSVTFSGSIEDILCEVIFVKFHATLESSYRNEECTVSFSHSRLPFRRMHLGIELACGTLGDGILFPGKIDMKSSQCVRLSRAGLNELSGVNLMKENELRLVQLKFYNESLNELQRVAVVRILHGYSRPLPYVLFGPPGTGKTVTLVEAILQVYKNVASSRILVCAPSNSAADLLCLRLDESGVLETGEMVRMNAYRRSILSELSDKEPIPARVLPYCKSVDDLAEVAMYRIIICTCTSSGALYRLGLKTGHITHVFVDEAGQASEPEIMISLGFTNRCNGQIILAGDPMQLGPVIRSPYAQQLQESYLHRLLLTCDLYKKQKEICAGSTTHFNPL+VTQLLQNYRAHPALLKLPSDMFYEGTLIPCVVKNRFINWKWLPNPEVPLVFQGVRGKELRNPRNPSTYNPSEAVMVVRWIGRLLQDTDNIGKLKDKNISVITPYRAQVDCIRKLISSCLDNVNLAKLKVASVEEFQGQENEVVIISTVRSSLDESGNNGVHESFAILN VGSRLGFLSNKRRFNVSITRACSLLIVIGDPGLLKYDECWSSL+KYAKTNNAFIGSESY
Sbjct:    1 MDIVRNSKTSPWIATKIEVLNCPELKDLDDFKFNKNICDNTLKSNILTEKPQNKLVGMITYSYNDKLTVNNNINFHQKDCGPNSFRPISGDWVILTFDHTILENKVIGISPLRYLDYEGMISSFNGNSGYIDKEIFFSKYILKGQLLNRGFRVYGTAIESVQNRRCNFRALTIFCKMSSNVNKGLQIRLKTMNKIENGIKTPHNLGLRLNPKAVEFGEQNINETRSKEVTITNENDFPMTLTGIALLSETNNQFVIENCGKEMKISGNSSLKVSVKCVPQFPGFDTQKLFIEGLNKDSTESTESWKLMLDVSVYVFDPVLSSISMEGTEKEPGDKSALNLKSLLSSSDLMGGVHHLSAAAPVKLRSVLTKFYPHKLKLYPIPEQLEQRVVNKEDIMGLYAVLKEKLGPGNYSKKMDLLVHLEEVNAKEEMKELVLENVRLMRRRDTFGIEVPGLSEGRPSLMVGDKVNVKVKGDDSVTFSGSIEDILCEVIFVKFHATLESSYRNEECTVSFSHSRLPFRRMHLGIELACGTLGDGILFPGKIDMKSSQCVRLSRAGLNELSGVNLMKENELRLVQLKFYNESLNELQRVAVVRILHGYSRPLPYVLFGPPGTGKTVTLVEAILQVYKNVASSRILVCAPSNSAADLLCLRLDESGVLETGEMVRMNAYRRSILSELSDKEPIPARVLPYCKSVDDLAEVAMYRIIICTCTSSGALYRLGLKTGHITHVFVDEAGQASEPEIMISLGFTNRCNGQIILAGDPMQLGPVIRSPYAQQLQESYLHRLLLTCDLYKKQKEICAGSTTHFNPLVVTQLLQNYRAHPALLKLPSDMFYEGTLIPCVVKNRFINWKWLPNPEVPLVFQGVRGKELRNPRNPSTYNPSEAVMVVRWIGRLLQDTDNIGKLKDKNISVITPYRAQVDCIRKLISSCLDNVNLAKLKVASVEEFQGQENEVVIISTVRSSLDESGNNGVHESFAILNTVGSRLGFLSNKRRFNVSITRACSLLIVIGDPGLLKYDECWSSLVKYAKTNNAFIGSESY 1038          
BLAST of Mov10 like RISC complex RNA helicase 1 vs. Planmine SMEST
Match: SMESG000069873.1 (SMESG000069873.1)

HSP 1 Score: 1394.79 bits (3609), Expect = 0.000e+0
Identity = 716/845 (84.73%), Postives = 771/845 (91.24%), Query Frame = 1
Query:   73 LFSQILDGITNYLKPTSFNSDREEYGERFYTGGYDDVQKDIKRESVKGLVTYLDGNKNGRIDGYVNFDSSSVIIFQCEEKNLSIGSEVFMDIIRNSKTSPWFASKIEVLSCHNKGNIEDWDDDNNL--DVIKNNNKIEQLPQKQVGMITYACNDNLTFNNEIKFHQRDCGPNSFRPSKGDWVVVQYDHSVDYYSIIGLSPLRYLDFEGVISSFDGNIGYVDREIFFNKSITKGVRLSRGVYVYGTAIESVQNRRCNFRALTIFCKMSSNVNKGLQMRLKTMNKIENGIKTPHNLGLRLNPKAVEFGEQNINETRSKEVTITNENDFPMTLTGIALLSETNNQFVIENCGKEMKISGNSSLKVSVKCVPQFPGFDTQKLFIEGLNKDSTESTESWKLMLDVSVYVFDPVLSSISLEGTEKEPGDKXXXXXXXXXXXXXXMGGVHHLSAAAPVKLRSVLTKVYPHKLKLYPIPEQLEQRVVNKEDIMGLYAVLKEKLGPGNYSKKMDLLVHLEEVNAKEEMKELVLENVRLMRRRDTFGIEVPGLSEGRPSLMXXXXXXXXXXXXXXXTFSGSIEDILCEVIFVKFHATLESSYRNEECTVSFSHSRLPFRRMHLGIELACGTLGDGILFPGKIDMKSSQCVRLSRAGLNELSGVNLMKENELRLVQLKFYNESLNELQRVAVVRILHGYSRPLPYVLFGPPGTGKTVTLVEAILQVYKNVASSRILVCAPSNSAADLLCLRLDESGVLETGEMVRMNAYRRSILSELSDKEPIPARVLPYCKSVDDLAEVAMYRIIICTCTSSGALYRLGLKTGHITHVFVDEAGQASEPEIMISLGFTNRCNGQI 2601
              ++I D   N +  +S  ++   + E F++G  D  QK IK+  +KG++T+ D N  GRIDG + FD  S I+++ ++K + +GSEV MDI+RNSKTSPW A+KIEVL+C    +++D+  + N+  + +K+N   E+   K VGMITY+ ND LT NN I FHQ+DCGPNSFRP  GDWV++ +DH++    +IG+SPLRYLD+EG+ISSF+GN GY+D+EIFF+K I KG  L+RG  VYGTAIESVQNRRCNFRALTIFCKMSSNVNKGLQ+RLKTMNKIENGIKTPHNLGLRLNPKAVEFGEQNINETRSKEVTITNENDFPMTLTGIALLSETNNQFVIENCGKEMKISGNSSLKVSVKCVPQFPGFDTQKLFIEGLNKDSTESTESWKLMLDVSVYVFDPVLSSIS+EGTEKEPGDKSALNL+SLLSSSDLMGGVHHLSAAAPVKLRSVLTK YPHKLKLYPIPEQLEQRVVNKEDIMGLYAVLKEKLGPGNYSKKMDLLVHLEEVNAKEEMKELVLENVRLMRRRDTFGIEVPGLSEGRPSLMVGDKVNVKVKGDDSVTFSGSIEDILCEVIFVKFHATLESSYRNEECTVSFSHSRLPFRRMHLGIELACGTLGDGILFPGKIDMKSSQCVRLSRAGLNELSGVNLMKENELRLVQLKFYNESLNELQRVAVVRILHGYSRPLPYVLFGPPGTGKTVTLVEAILQVYKNVASSRILVCAPSNSAADLLCLRLDESGVLETGEMVRMNAYRRSILSELSDKEPIPARVLPYCKSVDDLAEVAMYRIIICTCTSSGALYRLGLKTGHITHVFVDEAGQASEPEIMISLGFTNRCNGQ+
Sbjct:    2 FLNKIKDFFYNLIVSSSIYNEPRSHPESFFSGTNDHDQKIIKQNGIKGIITFFD-NDVGRIDGIITFDKLSNIVYKDDKKIIKVGSEVLMDIVRNSKTSPWIATKIEVLNCPELKDLDDFKFNKNICDNTLKSNILTEKPQNKLVGMITYSYNDKLTVNNNINFHQKDCGPNSFRPISGDWVILTFDHTILENKVIGISPLRYLDYEGMISSFNGNSGYIDKEIFFSKYILKGQLLNRGFRVYGTAIESVQNRRCNFRALTIFCKMSSNVNKGLQIRLKTMNKIENGIKTPHNLGLRLNPKAVEFGEQNINETRSKEVTITNENDFPMTLTGIALLSETNNQFVIENCGKEMKISGNSSLKVSVKCVPQFPGFDTQKLFIEGLNKDSTESTESWKLMLDVSVYVFDPVLSSISMEGTEKEPGDKSALNLKSLLSSSDLMGGVHHLSAAAPVKLRSVLTKFYPHKLKLYPIPEQLEQRVVNKEDIMGLYAVLKEKLGPGNYSKKMDLLVHLEEVNAKEEMKELVLENVRLMRRRDTFGIEVPGLSEGRPSLMVGDKVNVKVKGDDSVTFSGSIEDILCEVIFVKFHATLESSYRNEECTVSFSHSRLPFRRMHLGIELACGTLGDGILFPGKIDMKSSQCVRLSRAGLNELSGVNLMKENELRLVQLKFYNESLNELQRVAVVRILHGYSRPLPYVLFGPPGTGKTVTLVEAILQVYKNVASSRILVCAPSNSAADLLCLRLDESGVLETGEMVRMNAYRRSILSELSDKEPIPARVLPYCKSVDDLAEVAMYRIIICTCTSSGALYRLGLKTGHITHVFVDEAGQASEPEIMISLGFTNRCNGQV 845          
The following BLAST results are available for this feature:
BLAST of Mov10 like RISC complex RNA helicase 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MOV10L13.313e-15142.42Mov10 like RISC complex RNA helicase 1 [Source:HGN... [more]
MOV10L13.313e-15142.42Mov10 like RISC complex RNA helicase 1 [Source:HGN... [more]
MOV10L19.413e-14542.82Mov10 like RISC complex RNA helicase 1 [Source:HGN... [more]
MOV10L13.235e-13242.46Mov10 like RISC complex RNA helicase 1 [Source:HGN... [more]
MOV102.289e-10335.34Mov10 RISC complex RNA helicase [Source:HGNC Symbo... [more]
back to top
BLAST of Mov10 like RISC complex RNA helicase 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
smg-29.758e-3928.40Regulator of nonsense transcripts 1 [Source:UniPr... [more]
smg-29.758e-3928.40Regulator of nonsense transcripts 1 [Source:UniPr... [more]
smg-29.758e-3928.40Regulator of nonsense transcripts 1 [Source:UniPr... [more]
Y106G6D.56.398e-2124.49pep chromosome:WBcel235:I:10119209:10121815:-1 gen... [more]
Y106G6D.58.434e-2124.29pep chromosome:WBcel235:I:10119209:10122171:-1 gen... [more]
back to top
BLAST of Mov10 like RISC complex RNA helicase 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
armi8.746e-10431.79gene:FBgn0041164 transcript:FBtr0309840[more]
armi1.420e-10331.79gene:FBgn0041164 transcript:FBtr0100641[more]
armi1.420e-10331.79gene:FBgn0041164 transcript:FBtr0309841[more]
CG67011.225e-5532.77gene:FBgn0033889 transcript:FBtr0303989[more]
CG67011.225e-5532.77gene:FBgn0033889 transcript:FBtr0339957[more]
back to top
BLAST of Mov10 like RISC complex RNA helicase 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mov10b.18.009e-11336.76Moloney leukemia virus 10b, tandem duplicate 1 [So... [more]
mov10a1.175e-11136.38Mov10 RISC complex RNA helicase a [Source:ZFIN;Acc... [more]
mov10b.29.174e-11136.27Moloney leukemia virus 10b, tandem duplicate 2 [So... [more]
mov10b.22.094e-10736.05Moloney leukemia virus 10b, tandem duplicate 2 [So... [more]
mov10b.25.453e-10735.93Moloney leukemia virus 10b, tandem duplicate 2 [So... [more]
back to top
BLAST of Mov10 like RISC complex RNA helicase 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rhebl15.541e-15442.59RHEB like 1 [Source:Xenbase;Acc:XB-GENE-493839][more]
rhebl12.362e-15342.59RHEB like 1 [Source:Xenbase;Acc:XB-GENE-493839][more]
rhebl12.399e-14943.63RHEB like 1 [Source:Xenbase;Acc:XB-GENE-493839][more]
rhebl18.919e-14943.63RHEB like 1 [Source:Xenbase;Acc:XB-GENE-493839][more]
rhebl15.629e-12640.00RHEB like 1 [Source:Xenbase;Acc:XB-GENE-493839][more]
back to top
BLAST of Mov10 like RISC complex RNA helicase 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mov10l12.591e-12548.49Mov10 like RISC complex RNA helicase 1 [Source:MGI... [more]
Mov10l15.189e-12548.49Mov10 like RISC complex RNA helicase 1 [Source:MGI... [more]
Mov106.577e-10436.89Mov10 RISC complex RNA helicase [Source:MGI Symbol... [more]
Mov106.985e-10436.89Mov10 RISC complex RNA helicase [Source:MGI Symbol... [more]
Mov102.680e-10336.89Mov10 RISC complex RNA helicase [Source:MGI Symbol... [more]
back to top
BLAST of Mov10 like RISC complex RNA helicase 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9BXT6|M10L1_HUMAN1.591e-15042.42RNA helicase Mov10l1 OS=Homo sapiens OX=9606 GN=MO... [more]
sp|Q99MV5|M10L1_MOUSE1.224e-12348.28RNA helicase Mov10l1 OS=Mus musculus OX=10090 GN=M... [more]
sp|Q5ZKD7|MOV10_CHICK8.424e-11335.94Putative helicase MOV-10 OS=Gallus gallus OX=9031 ... [more]
sp|Q1LXK4|M10B1_DANRE6.046e-11236.76Putative helicase mov-10-B.1 OS=Danio rerio OX=795... [more]
sp|Q1LXK5|M10B2_DANRE4.117e-10635.93Putative helicase mov-10-B.2 OS=Danio rerio OX=795... [more]
back to top
BLAST of Mov10 like RISC complex RNA helicase 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0M3RSS32.223e-17834.14Moloney leukemia virus 10-like 1-like protein OS=M... [more]
A0A267GAQ52.560e-17834.23Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A0L8FVI32.463e-17234.37Uncharacterized protein OS=Octopus bimaculoides OX... [more]
A0A1S3HIP48.821e-16834.57RNA helicase Mov10l1 OS=Lingula unguis OX=7574 GN=... [more]
A0A210QJ863.421e-16233.09Helicase Mov10l1 OS=Mizuhopecten yessoensis OX=657... [more]
back to top
BLAST of Mov10 like RISC complex RNA helicase 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000014945.28.426e-13939.72Mov10 like RISC complex RNA helicase 1 [Source:NCB... [more]
mov10b.11.575e-11237.95Moloney leukemia virus 10b, tandem duplicate 1 [So... [more]
mov10a9.447e-10434.70putative helicase mov-10-B.1 [Source:NCBI gene;Acc... [more]
upf11.817e-3827.68UPF1 RNA helicase and ATPase [Source:NCBI gene;Acc... [more]
helz1.388e-3629.81helicase with zinc finger [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Mov10 like RISC complex RNA helicase 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
upf12.575e-3729.18UPF1 RNA helicase and ATPase [Source:ZFIN;Acc:ZDB-... [more]
ENSPMAT00000006694.11.365e-3428.63pep scaffold:Pmarinus_7.0:GL476853:158045:174859:1... [more]
ighmbp26.242e-2828.60immunoglobulin mu DNA binding protein 2 [Source:ZF... [more]
ENSPMAT00000008666.13.087e-2525.51pep scaffold:Pmarinus_7.0:GL478401:184246:194592:-... [more]
ENSPMAT00000008661.17.349e-2327.64pep scaffold:Pmarinus_7.0:GL478401:184160:191851:-... [more]
back to top
BLAST of Mov10 like RISC complex RNA helicase 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
NAM71.538e-3931.37ATP-dependent RNA helicase of the SFI superfamily;... [more]
HCS11.012e-3226.82Hexameric DNA polymerase alpha-associated DNA heli... [more]
SEN11.159e-2127.79ATP-dependent 5' to 3' RNA/DNA and DNA helicase; s... [more]
ECM325.549e-2126.59DNA dependent ATPase/DNA helicase; helicase belong... [more]
DNA23.120e-1423.89Tripartite DNA replication factor; single-stranded... [more]
back to top
BLAST of Mov10 like RISC complex RNA helicase 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO451067.986e-13548.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO344963.930e-10740.60Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO273068.351e-5244.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO451371.673e-4632.42Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO310256.756e-2327.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Mov10 like RISC complex RNA helicase 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000003680.25.279e-13738.30Mov10 like RISC complex RNA helicase 1 [Source:NCB... [more]
MOV106.861e-9933.47Mov10 RISC complex RNA helicase [Source:NCBI gene;... [more]
ENSORLT00000034865.11.541e-8033.28putative helicase mov-10-B.2 [Source:NCBI gene;Acc... [more]
UPF13.435e-3927.88UPF1 RNA helicase and ATPase [Source:NCBI gene;Acc... [more]
helz3.816e-3630.18helicase with zinc finger [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Mov10 like RISC complex RNA helicase 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000069862.10.000e+097.07SMESG000069862.1[more]
SMESG000069873.10.000e+088.38SMESG000069873.1[more]
SMESG000069873.10.000e+087.49SMESG000069873.1[more]
SMESG000069873.10.000e+092.97SMESG000069873.1[more]
SMESG000069873.10.000e+084.73SMESG000069873.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027909 ID=SMED30027909|Name=Mov10 like RISC complex RNA helicase 1|organism=Schmidtea mediterranea sexual|type=transcript|length=3497bp
ATTTAATTGAGTTTATTGCTAACTATTTAATTTAATTACTGAATTGGTCA
AGTTTTGAATTATAAAATGTCATTATTTTCTCAAATTTTGGATGGTATCA
CAAATTATTTAAAACCAACTTCTTTTAATTCAGACAGAGAAGAATATGGT
GAACGATTTTACACAGGGGGATATGACGATGTTCAGAAAGATATTAAACG
AGAATCAGTTAAAGGACTTGTAACATATCTAGATGGCAATAAAAATGGAA
GAATTGACGGATATGTAAACTTTGATAGTTCATCAGTAATTATTTTTCAA
TGTGAAGAAAAGAATTTATCAATCGGCAGTGAAGTTTTCATGGATATAAT
AAGAAATTCTAAAACTTCACCGTGGTTCGCCTCAAAAATCGAAGTGTTGA
GTTGTCATAATAAAGGTAATATCGAAGACTGGGATGATGATAACAATTTG
GATGTGATTAAAAATAATAATAAAATTGAACAACTACCTCAAAAACAAGT
CGGTATGATTACATATGCATGTAATGACAATCTTACTTTTAATAACGAAA
TAAAATTTCATCAAAGAGATTGCGGTCCCAATAGCTTCCGTCCTAGTAAA
GGAGACTGGGTTGTTGTTCAATATGACCATTCGGTAGATTATTACAGTAT
TATTGGTTTATCGCCTTTACGTTACCTTGATTTTGAAGGAGTAATAAGTT
CGTTTGACGGCAATATTGGTTATGTTGATAGAGAAATATTCTTTAATAAA
TCTATCACCAAAGGTGTACGATTAAGTCGAGGAGTCTATGTTTACGGTAC
GGCAATAGAATCAGTTCAGAACAGAAGATGCAATTTCCGAGCATTGACAA
TTTTCTGTAAAATGTCTTCCAATGTAAATAAAGGATTGCAAATGCGATTG
AAAACAATGAATAAAATTGAAAATGGAATTAAAACTCCTCATAATTTAGG
ACTTCGATTAAACCCGAAAGCGGTGGAATTCGGCGAGCAAAACATCAATG
AAACCCGCTCTAAAGAAGTGACAATAACGAATGAGAATGATTTCCCAATG
ACATTGACTGGGATCGCGTTATTGTCAGAGACAAACAATCAATTTGTGAT
TGAAAATTGTGGGAAAGAAATGAAAATCTCGGGGAACTCTTCATTGAAAG
TGTCTGTGAAATGCGTTCCGCAATTTCCTGGATTTGACACGCAGAAATTG
TTCATTGAAGGATTGAATAAGGACTCGACAGAATCGACGGAATCATGGAA
ATTAATGCTCGATGTATCGGTGTATGTATTCGATCCGGTTTTGTCGAGTA
TCTCACTGGAGGGAACCGAAAAGGAACCGGGCGACAAATCGGCATTGAAT
CTGGAATCATTATTATCGTCTAGCGATTTGATGGGCGGAGTTCACCATTT
GTCAGCAGCTGCTCCGGTAAAACTGAGATCGGTCCTAACTAAAGTTTATC
CCCACAAATTGAAATTGTATCCGATTCCGGAACAGCTGGAACAACGAGTG
GTCAACAAAGAAGACATAATGGGATTGTATGCGGTGCTGAAGGAGAAATT
GGGACCGGGGAATTACAGCAAGAAAATGGATTTGCTGGTGCATTTGGAGG
AGGTGAATGCAAAGGAGGAAATGAAGGAATTGGTGCTGGAGAACGTGCGG
CTGATGCGGCGGCGTGACACATTCGGGATTGAAGTTCCGGGTCTGAGTGA
AGGCAGGCCGTCATTGATGGTCGGTGACAAGGTGAATGTGAAAGTGAAGG
GCGACGATTCGGTGACATTTTCCGGCAGCATCGAGGACATTCTATGCGAG
GTAATTTTCGTGAAGTTCCACGCGACTCTGGAGTCGAGTTATCGGAATGA
AGAGTGCACAGTGTCGTTCTCGCATAGTCGGTTGCCGTTCCGCCGAATGC
ATTTGGGAATCGAGCTGGCCTGTGGAACATTGGGGGACGGGATTCTGTTC
CCGGGGAAAATCGATATGAAATCGTCTCAGTGCGTGCGGCTGTCGAGGGC
GGGCCTGAATGAGTTGTCTGGGGTGAATCTGATGAAGGAGAACGAGTTGA
GATTGGTGCAGTTGAAATTCTACAATGAATCACTGAATGAGCTGCAACGG
GTTGCTGTGGTGAGGATACTCCATGGTTACTCGCGACCGTTGCCGTATGT
GTTGTTTGGGCCGCCCGGAACCGGGAAAACTGTGACATTGGTCGAGGCGA
TTCTGCAAGTGTACAAAAACGTAGCGTCGAGCAGAATTCTGGTTTGCGCG
CCGTCAAATAGTGCTGCAGATCTTCTGTGCTTGCGATTGGATGAATCTGG
CGTGCTGGAAACAGGAGAAATGGTGAGGATGAATGCTTATCGGCGCTCGA
TTCTGTCTGAGTTATCAGATAAGGAGCCGATTCCAGCTCGAGTGCTGCCG
TATTGCAAGAGCGTGGATGATCTAGCCGAAGTTGCTATGTATCGAATCAT
AATATGCACTTGCACGTCAAGCGGTGCACTTTATCGACTGGGTTTAAAAA
CAGGCCATATTACTCATGTTTTTGTCGATGAAGCTGGCCAAGCATCAGAA
CCGGAAATTATGATTTCATTAGGATTTACAAATCGTTGCAATGGCCAGAT
AATATTAGCCGGTGATCCCATGCAATTGGGCCCGGTCATTCGGTCCCCTT
ACGCGCAGCAATTACAAGAATCGTACCTCCATAGGCTGTTACTGACCTGT
GACCTATATAAGAAACAGAAAGAAATATGCGCCGGGTCGACAACACATTT
CAATCCACTCATTGTCACACAATTGCTACAAAATTATCGTGCTCATCCTG
CACTGTTGAAATTACCATCGGATATGTTTTATGAAGGAACCCTGATTCCA
TGTGTTGTGAAAAATCGATTTATCAACTGGAAATGGCTTCCGAATCCAGA
AGTTCCTCTGGTATTCCAAGGAGTTCGTGGTAAAGAATTACGAAATCCAC
GAAATCCGTCGACTTATAATCCATCGGAAGCTGTAATGGTTGTCAGGTGG
ATCGGTAGATTGTTGCAGGACACGGACAACATCGGGAAATTAAAGGATAA
AAATATCAGCGTCATCACTCCGTATCGCGCTCAAGTCGACTGCATTCGGA
AGCTCATTTCGAGTTGTCTGGACAATGTGAATCTGGCAAAGTTGAAAGTG
GCATCAGTTGAGGAATTTCAAGGCCAAGAAAACGAGGTGGTGATTATCAG
CACGGTGAGAAGCAGTCTGGACGAATCGGGAAATAATGGTGTCCATGAAT
CGTTTGCTATTTTGAATATGGTCGGCTCGAGATTGGGATTCCTGTCGAAC
AAGAGACGATTCAATGTGTCGATAACACGCGCTTGCTCATTGCTGATAGT
TATCGGTGACCCGGGATTGCTGAAATATGACGAGTGCTGGAGCAGTCTCA
TGAAATACGCCAAAACTAATAACGCTTTTATTGGCTCCGAGTCTTATTGA
TTATTTTTCTAATGAACTGCAATTTGTACAATGCGATTTTATTGAAT
back to top

protein sequence of SMED30027909-orf-1

>SMED30027909-orf-1 ID=SMED30027909-orf-1|Name=SMED30027909-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1128bp
MSLFSQILDGITNYLKPTSFNSDREEYGERFYTGGYDDVQKDIKRESVKG
LVTYLDGNKNGRIDGYVNFDSSSVIIFQCEEKNLSIGSEVFMDIIRNSKT
SPWFASKIEVLSCHNKGNIEDWDDDNNLDVIKNNNKIEQLPQKQVGMITY
ACNDNLTFNNEIKFHQRDCGPNSFRPSKGDWVVVQYDHSVDYYSIIGLSP
LRYLDFEGVISSFDGNIGYVDREIFFNKSITKGVRLSRGVYVYGTAIESV
QNRRCNFRALTIFCKMSSNVNKGLQMRLKTMNKIENGIKTPHNLGLRLNP
KAVEFGEQNINETRSKEVTITNENDFPMTLTGIALLSETNNQFVIENCGK
EMKISGNSSLKVSVKCVPQFPGFDTQKLFIEGLNKDSTESTESWKLMLDV
SVYVFDPVLSSISLEGTEKEPGDKSALNLESLLSSSDLMGGVHHLSAAAP
VKLRSVLTKVYPHKLKLYPIPEQLEQRVVNKEDIMGLYAVLKEKLGPGNY
SKKMDLLVHLEEVNAKEEMKELVLENVRLMRRRDTFGIEVPGLSEGRPSL
MVGDKVNVKVKGDDSVTFSGSIEDILCEVIFVKFHATLESSYRNEECTVS
FSHSRLPFRRMHLGIELACGTLGDGILFPGKIDMKSSQCVRLSRAGLNEL
SGVNLMKENELRLVQLKFYNESLNELQRVAVVRILHGYSRPLPYVLFGPP
GTGKTVTLVEAILQVYKNVASSRILVCAPSNSAADLLCLRLDESGVLETG
EMVRMNAYRRSILSELSDKEPIPARVLPYCKSVDDLAEVAMYRIIICTCT
SSGALYRLGLKTGHITHVFVDEAGQASEPEIMISLGFTNRCNGQIILAGD
PMQLGPVIRSPYAQQLQESYLHRLLLTCDLYKKQKEICAGSTTHFNPLIV
TQLLQNYRAHPALLKLPSDMFYEGTLIPCVVKNRFINWKWLPNPEVPLVF
QGVRGKELRNPRNPSTYNPSEAVMVVRWIGRLLQDTDNIGKLKDKNISVI
TPYRAQVDCIRKLISSCLDNVNLAKLKVASVEEFQGQENEVVIISTVRSS
LDESGNNGVHESFAILNMVGSRLGFLSNKRRFNVSITRACSLLIVIGDPG
LLKYDECWSSLMKYAKTNNAFIGSESY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0007281germ cell development
GO:0007283spermatogenesis
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000026gut
PLANA:0000074oocyte
PLANA:0000099neuron
PLANA:0000103central nervous system
PLANA:0000204ovary
PLANA:0000208testis
PLANA:0000231vitelline gland
PLANA:0000422tail stripe
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002142parenchyma
Vocabulary: INTERPRO
TermDefinition
IPR027417P-loop_NTPase
Vocabulary: molecular function
TermDefinition
GO:0004386helicase activity