Queuine tRNA-ribosyltransferase catalytic subunit 1

Overview
NameQueuine tRNA-ribosyltransferase catalytic subunit 1
Smed IDSMED30027908
Length (bp)1525
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Queuine tRNA-ribosyltransferase catalytic subunit 1 (SMED30027908) t-SNE clustered cells

Violin plots show distribution of expression levels for Queuine tRNA-ribosyltransferase catalytic subunit 1 (SMED30027908) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Queuine tRNA-ribosyltransferase catalytic subunit 1 (SMED30027908) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Queuine tRNA-ribosyltransferase catalytic subunit 1 (SMED30027908) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30027908

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30027908h1SMcG0002951 SmedASXL_014166SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30027908h1SMcG0002951 SmedASXL_014166SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30027908h1SMcG0002951 Contig49471uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30027908h1SMcG0002951 Contig49471newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Queuine tRNA-ribosyltransferase catalytic subunit 1 vs. Ensembl Human
Match: QTRT1 (queuine tRNA-ribosyltransferase catalytic subunit 1 [Source:HGNC Symbol;Acc:HGNC:23797])

HSP 1 Score: 471.47 bits (1212), Expect = 5.886e-164
Identity = 231/395 (58.48%), Postives = 285/395 (72.15%), Query Frame = 3
Query:  144 LIAKCSTSRARVNKITLCGQSRNKNQIVDTPVFMPVGTQGTMKGITTEQMKEMFDCRLFLGNTYHLGHRPGPEIMKKAGGLHKFMKWDGGLLTDSGGFQMVSLAKLSYVTEEGVNFTSPHDESQMLLTPEHSMEIQNAIGADIMMQLDDVISSLTAGPRVEEATYRSIRWLDRCIEAHKRPQDQALFAIVQGGLSEDLRTKCLEMMLERQHMVGGFAIGGLSGGEEKASFWRMVNICCKEGGLPVNKPRYVMGVGYSLDILVCVALGADMFDCVYPTRTGRFGCALVPWGSVLLSNASYKFDFNPIDKDCKCIACAKYTRAYLHTINGSPSFASL--ISIHNVAYMLNFMREMRSSIVADKFPEFCRDFFKRQYSKVEDYPQWALEALETVNIVI 1322
            L+A+CS SRAR  ++ L       +  V TPVFMPVGTQ TMKGITTEQ+ +   CR+ LGNTYHLG RPGPE+++KA GLH FM W   LLTDSGGFQMVSL  LS VTEEGV F SP+D ++ LL+PE S++IQNA+G+DI+MQLDDV+SS   GPRVEEA YRSIRWLDRCI AH+RP  Q LFAI+QGGL  DLR  CLE M +R   V GFAIGGLSGGE K+ FWRMV +      LP +KPRY+MGVGY+ D++VCVALG DMFDCV+PTRT RFG ALVP G++ L    ++ DF PID +C C  C K++RA+LH +  S + A+L  +++HN+AY L  M  +R+SIV  +FP+F RDF    Y      P WA +AL +V I +
Sbjct:   19 LVAECSRSRARAGELWL------PHGTVATPVFMPVGTQATMKGITTEQL-DALGCRICLGNTYHLGLRPGPELIQKANGLHGFMNWPHNLLTDSGGFQMVSLVSLSEVTEEGVRFRSPYDGNETLLSPEKSVQIQNALGSDIIMQLDDVVSSTVTGPRVEEAMYRSIRWLDRCIAAHQRPDKQNLFAIIQGGLDADLRATCLEEMTKRD--VPGFAIGGLSGGESKSQFWRMVALSTSR--LPKDKPRYLMGVGYATDLVVCVALGCDMFDCVFPTRTARFGSALVPTGNLQLRKKVFEKDFGPIDPECTCPTCQKHSRAFLHALLHSDNTAALHHLTVHNIAYQLQLMSAVRTSIVEKRFPDFVRDFMGAMYGDPTLCPTWATDALASVGITL 402          
BLAST of Queuine tRNA-ribosyltransferase catalytic subunit 1 vs. Ensembl Human
Match: QTRT1 (queuine tRNA-ribosyltransferase catalytic subunit 1 [Source:HGNC Symbol;Acc:HGNC:23797])

HSP 1 Score: 217.238 bits (552), Expect = 7.115e-68
Identity = 110/187 (58.82%), Postives = 132/187 (70.59%), Query Frame = 3
Query:  144 LIAKCSTSRARVNKITLCGQSRNKNQIVDTPVFMPVGTQGTMKGITTEQMKEMFDCRLFLGNTYHLGHRPGPEIMKKAGGLHKFMKWDGGLLTDSGGFQMVSLAKLSYVTEEGVNFTSPHDESQMLLTPEHSMEIQNAIGADIMMQLDDVISSLTAGPRVEEATYRSIRWLDRCIEAHKRPQDQALF 704
            L+A+CS SRAR  ++ L       +  V TPVFMPVGTQ TMKGITTEQ+ +   CR+ LGNTYHLG RPGPE+++KA GLH FM W   LLT               VTEEGV F SP+D ++ LL+PE S++IQNA+G+DI+MQLDDV+SS   GPRVEEA YRSIRWLDRCI AH+RP  Q LF
Sbjct:   16 LVAECSRSRARAGELWL------PHGTVATPVFMPVGTQATMKGITTEQL-DALGCRICLGNTYHLGLRPGPELIQKANGLHGFMNWPHNLLT---------------VTEEGVRFRSPYDGNETLLSPEKSVQIQNALGSDIIMQLDDVVSSTVTGPRVEEAMYRSIRWLDRCIAAHQRPDKQNLF 180          
BLAST of Queuine tRNA-ribosyltransferase catalytic subunit 1 vs. Ensembl Human
Match: QTRT1 (queuine tRNA-ribosyltransferase catalytic subunit 1 [Source:HGNC Symbol;Acc:HGNC:23797])

HSP 1 Score: 214.542 bits (545), Expect = 3.465e-66
Identity = 106/168 (63.10%), Postives = 128/168 (76.19%), Query Frame = 3
Query:  144 LIAKCSTSRARVNKITLCGQSRNKNQIVDTPVFMPVGTQGTMKGITTEQMKEMFDCRLFLGNTYHLGHRPGPEIMKKAGGLHKFMKWDGGLLTDSGGFQMVSLAKLSYVTEEGVNFTSPHDESQMLLTPEHSMEIQNAIGADIMMQLDDVISSLTAGPRVEEATYRSI 647
            L+A+CS SRAR  ++ L       +  V TPVFMPVGTQ TMKGITTEQ+ +   CR+ LGNTYHLG RPGPE+++KA GLH FM W   LLTDSGGFQMVSL  LS VTEEGV F SP+D ++ LL+PE S++IQNA+G+DI+MQLDDV+SS   GPRVEEA YR +
Sbjct:   19 LVAECSRSRARAGELWL------PHGTVATPVFMPVGTQATMKGITTEQL-DALGCRICLGNTYHLGLRPGPELIQKANGLHGFMNWPHNLLTDSGGFQMVSLVSLSEVTEEGVRFRSPYDGNETLLSPEKSVQIQNALGSDIIMQLDDVVSSTVTGPRVEEAMYRPL 179          
BLAST of Queuine tRNA-ribosyltransferase catalytic subunit 1 vs. Ensembl Human
Match: QTRT1 (queuine tRNA-ribosyltransferase catalytic subunit 1 [Source:HGNC Symbol;Acc:HGNC:23797])

HSP 1 Score: 172.94 bits (437), Expect = 1.474e-50
Identity = 86/140 (61.43%), Postives = 104/140 (74.29%), Query Frame = 3
Query:  144 LIAKCSTSRARVNKITLCGQSRNKNQIVDTPVFMPVGTQGTMKGITTEQMKEMFDCRLFLGNTYHLGHRPGPEIMKKAGGLHKFMKWDGGLLTDSGGFQMVSLAKLSYVTEEGVNFTSPHDESQMLLTPEHSMEIQNAIG 563
            L+A+CS SRAR  ++ L       +  V TPVFMPVGTQ TMKGITTEQ+ +   CR+ LGNTYHLG RPGPE+++KA GLH FM W   LLTDSGGFQMVSL  LS VTEEGV F SP+D ++ LL+PE S++IQNA+ 
Sbjct:   18 LVAECSRSRARAGELWL------PHGTVATPVFMPVGTQATMKGITTEQL-DALGCRICLGNTYHLGLRPGPELIQKANGLHGFMNWPHNLLTDSGGFQMVSLVSLSEVTEEGVRFRSPYDGNETLLSPEKSVQIQNALA 150          
BLAST of Queuine tRNA-ribosyltransferase catalytic subunit 1 vs. Ensembl Human
Match: QTRT1 (queuine tRNA-ribosyltransferase catalytic subunit 1 [Source:HGNC Symbol;Acc:HGNC:23797])

HSP 1 Score: 137.502 bits (345), Expect = 5.122e-38
Identity = 66/137 (48.18%), Postives = 91/137 (66.42%), Query Frame = 3
Query:  918 DILVCVALGADMFDCVYPTRTGRFGCALVPWGSVLLSNASYKFDFNPIDKDCKCIACAKYTRAYLHTINGSPSFASL--ISIHNVAYMLNFMREMRSSIVADKFPEFCRDFFKRQYSKVEDYPQWALEALETVNIVI 1322
            D++VCVALG DMFDCV+PTRT RFG ALVP G++ L    ++ DF PID +C C  C K++RA+LH +  S + A+L  +++HN+AY L  M  +R+SIV  +FP+F RDF    Y      P WA +AL +V I +
Sbjct:    1 DLVVCVALGCDMFDCVFPTRTARFGSALVPTGNLQLRKKVFEKDFGPIDPECTCPTCQKHSRAFLHALLHSDNTAALHHLTVHNIAYQL--MSAVRTSIVEKRFPDFVRDFMGAMYGDPTLCPTWATDALASVGITL 135          
BLAST of Queuine tRNA-ribosyltransferase catalytic subunit 1 vs. Ensembl Celegans
Match: tgt-1 (Queuine tRNA-ribosyltransferase catalytic subunit [Source:UniProtKB/Swiss-Prot;Acc:Q23623])

HSP 1 Score: 408.683 bits (1049), Expect = 1.420e-139
Identity = 207/378 (54.76%), Postives = 260/378 (68.78%), Query Frame = 3
Query:  216 NQIVDTPVFMPVGTQGTMKGITTEQMKEMFDCRLFLGNTYHLGHRPGPEIMKKAGGLHKFMKWDGGLLTDSGGFQMVSLAKLSYVTEEGVNFTSPHDESQMLLTPEHSMEIQNAIGADIMMQLDDVISSLTAGPRVEEATYRSIRWLDRCIEAHKRPQDQALFAIVQGGLSEDLRTKCLEMMLERQHMVGGFAIGGLSGGEEKASFWRMVNICCKEGGLPVNKPRYVMGVGYSLDILVCVALGADMFDCVYPTRTGRFGCALVPWGSVL-LSNASYKFDFNPIDKDCKCIACAKYTRAYLHTINGSPSFA-SLISIHNVAYMLNFMREMRSSIVADKFPEFCRDFF-------------KRQYSKVEDYPQWALEALE 1304
            + IV+TPVFMPVGTQGTMKGI  EQ+  M DCR+ L NTYHLGHRPG E +K AGGLHK M W+  +LTDSGGFQMVSL+KL  V E GVNF SPH    M L PE S+EIQ A+GADIMMQLD VI  LT G  V+EA +RSIRWLDRC  AH R  DQA+F I+QGGL+ +LR +C + M +R  +  G AIGGLSGGEEK  FWR+V  CC    LP + PRYVMGVG+ +D+++C  LGADMFDCVYPTRT RFG A+V  G ++ L+   YK DF PIDK C+C  C  YTRAY+H+I G  +    L+S+HN+ + L+ MR++R +I ++   +F + F              K+   K+ + PQW  +A++
Sbjct:   33 HSIVETPVFMPVGTQGTMKGIVPEQLVSM-DCRILLCNTYHLGHRPGHERVKAAGGLHKMMNWNRSILTDSGGFQMVSLSKLMTVDENGVNFESPHTGEMMALPPEKSIEIQQALGADIMMQLDHVIHVLTTGDIVKEAMHRSIRWLDRCKVAHTR-DDQAMFPILQGGLNLELRKECAKEMAKRAKV--GIAIGGLSGGEEKDHFWRVVAACC--AALPPHLPRYVMGVGFPVDLVICSFLGADMFDCVYPTRTARFGTAMVRRGGLMQLNQKRYKEDFLPIDKKCECNTCKNYTRAYIHSIVGKETVGCHLVSVHNIKHQLDLMRDVRQAIQSNSVEQFLKQFLYDYYGPIQSENPSKQDSEKMREVPQWVRDAVD 404          
BLAST of Queuine tRNA-ribosyltransferase catalytic subunit 1 vs. Ensembl Celegans
Match: tgt-2 (Queuine tRNA-ribosyltransferase accessory subunit 2 [Source:UniProtKB/Swiss-Prot;Acc:Q9NEU3])

HSP 1 Score: 55.8398 bits (133), Expect = 3.675e-8
Identity = 59/237 (24.89%), Postives = 102/237 (43.04%), Query Frame = 3
Query:  543 EIQNAIGADIMMQLDDVISSLTAG-PRVEEATYRSIRWLDRCIEAHKRPQDQALFAIVQGGLSEDLRTKC-LEMMLERQHMVGGFAIGGLSGGEEKASFWRMVNICCKE--GGLPVNKPRYVMGVGYSLDILVCVALGADMFDCVYPTRTGRFGCAL-----VPWGS----VLLSNASYKFDFNPIDKDCKCIACAKYTRAYL-HTINGSPSFAS-LISIHNVAYMLNFMREMRSSI 1208
            EI N+ G   +  L D  +    G  ++ +A  R+  + ++  +  ++   + + ++  GG S+  R KC +++ L     + G+ +      E K +  + +    +E    LP  K R + G      +L  V  G D+FD  +P +    G A       P  S    V  +N  +  DF  +   C C  C KYT+ YL H +N     AS L+ IHN+       + +RSS+
Sbjct:  134 EIINSFGCGSIETLVDYDTPKDVGQKKLVKAVDRTKTFQEQLFQQDEKVNGERIVSL-GGGFSKYHRRKCAVDVGLAEN--IAGYTVEFREFTEGKETDDKEMKELLEETFSPLPPTKLRCISGPFNPKTVLFLVQQGIDLFDSSFPVKLAEEGHAFCLSDDFPTSSKYEVVDFNNEKFADDFTALFDGCACYTCTKYTKGYLQHLLNTRELLASILLVIHNMTEYDKMFKLIRSSL 367          
BLAST of Queuine tRNA-ribosyltransferase catalytic subunit 1 vs. Ensembl Fly
Match: Tgt (gene:FBgn0031321 transcript:FBtr0077971)

HSP 1 Score: 488.034 bits (1255), Expect = 1.948e-170
Identity = 238/396 (60.10%), Postives = 289/396 (72.98%), Query Frame = 3
Query:  132 LECNLIAKCSTSRARVNKITLCGQSRNKNQIVDTPVFMPVGTQGTMKGITTEQMKEMFDCRLFLGNTYHLGHRPGPEIMKKAGGLHKFMKWDGGLLTDSGGFQMVSLAKLSYVTEEGVNFTSPHDESQMLLTPEHSMEIQNAIGADIMMQLDDVISSLTAGPRVEEATYRSIRWLDRCIEAHKRPQDQALFAIVQGGLSEDLRTKCLEMMLERQHMVGGFAIGGLSGGEEKASFWRMVNICCKEGGLPVNKPRYVMGVGYSLDILVCVALGADMFDCVYPTRTGRFGCALVPWGSVLLSNASYKFDFNPIDKDCKCIACAKYTRAYLHTINGSPSF-ASLISIHNVAYMLNFMREMRSSIVADKFPEFCRDFFKRQYSKVEDYPQWALEALETVNI 1316
            L   ++A+CS S+AR   +TL      ++  V+TPVFMPVGTQGT+KGI  +Q+ E+ +C++ LGNTYHLG RPG E +KKAGGLHKFM W   +LTDSGGFQMVSL +L+ + E GVNF SP D SQ +LTPEHS+EIQNAIG DIMMQLDDV+ + T GPRVEEA  R+IRW+DRCIEAH R  DQ+LF IVQGGL   LR +C+  ++ERQ  V GFA+GGLSGGE K  FWRMV++C   G LP +KPRY+MGVG++ D++VCVALG DMFDCV+PTRT RFGCALV  G + L    YK D  PIDKDC C  C +YTR+YLH I  + S  +SL+SIHNVAY L  MR MR +I  D+FP+F  DF  R + K E  P W  EAL  VNI
Sbjct:    9 LTYKVVAECSVSKARAGLMTL------RHSEVNTPVFMPVGTQGTLKGIVPDQLIEL-NCQILLGNTYHLGLRPGIETLKKAGGLHKFMGWPRAILTDSGGFQMVSLLQLAEIDEHGVNFRSPFDNSQCMLTPEHSIEIQNAIGGDIMMQLDDVVKTTTTGPRVEEAMERTIRWVDRCIEAHARDDDQSLFPIVQGGLDVPLRQRCVSALMERQ--VRGFAVGGLSGGESKHDFWRMVDVCT--GYLPKDKPRYLMGVGFAADLVVCVALGIDMFDCVFPTRTARFGCALVDSGQLNLKQPKYKLDMEPIDKDCDCSTCRRYTRSYLHHIATNESVSSSLLSIHNVAYQLRLMRSMREAIQRDEFPQFVADFMARHF-KAEPVPAWIREALSAVNI 392          
BLAST of Queuine tRNA-ribosyltransferase catalytic subunit 1 vs. Ensembl Fly
Match: CG3434 (gene:FBgn0036000 transcript:FBtr0076473)

HSP 1 Score: 83.9593 bits (206), Expect = 4.546e-17
Identity = 71/274 (25.91%), Postives = 127/274 (46.35%), Query Frame = 3
Query:  522 LTPEHSMEIQNAIGADIMMQLDDVISSL-TAGPRVEEATYRSIRWLDRCIEAHKRPQDQALFAIVQGGLSEDLRTKCLEMMLERQ------HMVGGFAIGGLSGGE-EKASFWRMVNICCKEGGLPVNKPRYVMGVGYSLDILVCVALGADMFDCVYPTRTGRFGCAL-----------VPWGSVLLSNASYKFDFNPIDKDCKCIACAKYTRAYLHTINGSPSFAS--LISIHNVAYMLNFMREMRSSIVADKFPEFCRDFFKRQYSKVE-DY 1277
            L+ E  MEI  +   D+   L D  ++L +A  RV+++  R+ +++    E H+   +  L A + GG +   RT+ ++   E+       ++  GF   GLS    + +    +V  C K+  L  +KP+ + G    L +L  +  G D+FD  Y         AL           VP+  + +++ + K DF P   +C C+ C K+TRAYLH +  +       L+ +HN+ + + F  ++R S+  D  P+   +  + Q  K + DY
Sbjct:  128 LSSERYMEIVASFKPDMYEGLCDADTNLESAKKRVQKSVDRTEKFMQYIYE-HRGKVNSTLLAPIVGGYNTFARTQSIKHAREQPAGSYGGYIFEGFHANGLSATTLDTSKLLPIVEHCVKQ--LEEDKPKILPGAYTPLTVLELIQQGIDVFDTSYAYCASLNFKALSFSFVQDAVEHVPF--LDITDEAIKEDFTPPLSNCNCLTCQKHTRAYLHHLYKTNELLGPILLMVHNLYHYMAFFEKIRESVAKDTLPQLT-ELVRNQNGKTQVDY 395          
BLAST of Queuine tRNA-ribosyltransferase catalytic subunit 1 vs. Ensembl Zebrafish
Match: qtrt1 (queuine tRNA-ribosyltransferase 1 [Source:NCBI gene;Acc:393985])

HSP 1 Score: 488.804 bits (1257), Expect = 4.830e-171
Identity = 234/403 (58.06%), Postives = 297/403 (73.70%), Query Frame = 3
Query:  117 SSERTLECNLIAKCSTSRARVNKITLCGQSRNKNQIVDTPVFMPVGTQGTMKGITTEQMKEMFDCRLFLGNTYHLGHRPGPEIMKKAGGLHKFMKWDGGLLTDSGGFQMVSLAKLSYVTEEGVNFTSPHDESQMLLTPEHSMEIQNAIGADIMMQLDDVISSLTAGPRVEEATYRSIRWLDRCIEAHKRPQDQALFAIVQGGLSEDLRTKCLEMMLERQHMVGGFAIGGLSGGEEKASFWRMVNICCKEGGLPVNKPRYVMGVGYSLDILVCVALGADMFDCVYPTRTGRFGCALVPWGSVLLSNASYKFDFNPIDKDCKCIACAKYTRAYLHTINGSPSFA-SLISIHNVAYMLNFMREMRSSIVADKFPEFCRDFFKRQYSKVEDYPQWALEALETVNIVI 1322
            SS   L   ++A+C  S+AR   +TL       +  V+TPVFMPVGTQGTMKGIT +Q++++ DC++ LGNTYHLG RPGP++++KA GLH FMKW   LLTDSGGFQMVSL +LS VTEEGV F SP+D  ++LLTPE S+ IQN++G+DIMMQLDDV+SS   GPRVEEA +RS+RWLDRCI A+K P  Q LFAI+QGGL  +LR  CL+ M +R   V GFAIGGLSGGEEK  FW+MV +      LP  KPRY+MGVGY++D++VCVALG DMFDCV+PTRT RFG ALVPWGS+ L    Y  DF PID DC+C  C +++RAYLH +  S + A   I+IHN++Y L+ MR +R SI+  +FPEF ++F KR +     YP WA+EAL++VNI +
Sbjct:    8 SSAAPLALRIVAECPVSKARACSLTL------PHCAVNTPVFMPVGTQGTMKGITADQLEDL-DCQICLGNTYHLGMRPGPDLIEKANGLHGFMKWRRNLLTDSGGFQMVSLVELSEVTEEGVTFRSPYDGKEILLTPEQSIAIQNSLGSDIMMQLDDVVSSTVKGPRVEEAMHRSVRWLDRCIAANKNPDRQNLFAIIQGGLDAELRKACLKEMTKRD--VPGFAIGGLSGGEEKDDFWKMVTLSTDH--LPREKPRYLMGVGYAVDLVVCVALGCDMFDCVFPTRTARFGSALVPWGSLQLKQKQYAKDFQPIDPDCQCPTCRRHSRAYLHALFKSDTAAMHHITIHNISYQLSLMRSVRQSIIDQRFPEFVKEFMKRMFPSSSQYPSWAVEALQSVNICL 399          
BLAST of Queuine tRNA-ribosyltransferase catalytic subunit 1 vs. Ensembl Zebrafish
Match: qtrt2 (queuine tRNA-ribosyltransferase accessory subunit 2 [Source:NCBI gene;Acc:402798])

HSP 1 Score: 101.679 bits (252), Expect = 7.965e-23
Identity = 76/294 (25.85%), Postives = 128/294 (43.54%), Query Frame = 3
Query:  522 LTPEHSMEIQNAIGADIMMQLDD--VISSLTAGPRVEEATYRSIRWLDRCIEAHKRPQD---QALFAIVQGGLSEDLRTKCLEMMLERQHMVGGFAIGGL-SGGEEKASFWRMVNICCKEGGLPVNKPRYVMGVGYSLDILVCVALGADMFDCVYPTRTGRFGCAL--------------VPWGSVL---------------------------LSNASYKFDFNPIDKDCKCIACAKYTRAYLHTINGSPSFAS--LISIHNVAYMLNFMREMRSSIVADKFPEFCRDFFKRQ 1256
            LT    M IQ A+  D    + D     + T+  RV +A  R++  LD C+  H++ Q+     +F +V+GG   + R +      +R   VGGF + G  S   ++    +++     E  LP  KPR V+GVG   +++ CV  G D+F+  +P +    GCAL                  +VL                           L +  Y+ DF P+ + C C  C K+ RAY+H +  +    +  L+ +HN+A+ L F + +R +I +D+  +F      R+
Sbjct:  124 LTAARFMSIQAAVQPDCYQSMADGETWQANTSRKRVRKAVDRTLAHLDECLVLHQKTQELKHAEIFGVVEGGDILEERLRSARETAKRP--VGGFVLDGFHSSAMDQDVRAQLIQETSAE--LPQEKPRLVLGVGRPDEVISCVEAGVDLFESFFPFQVTERGCALSFNYTIDPDPETAGTSASTVLECNGETPEVKKPSANEDVENMTPFEINLKDKRYRDDFRPLVEGCVCYCCQKHMRAYVHHLLVTNELLAGVLLMLHNMAHYLGFFKALRDAITSDRLQDFKNTVLHRR 413          
BLAST of Queuine tRNA-ribosyltransferase catalytic subunit 1 vs. Ensembl Zebrafish
Match: qtrt2 (queuine tRNA-ribosyltransferase accessory subunit 2 [Source:NCBI gene;Acc:402798])

HSP 1 Score: 101.679 bits (252), Expect = 8.212e-23
Identity = 76/294 (25.85%), Postives = 128/294 (43.54%), Query Frame = 3
Query:  522 LTPEHSMEIQNAIGADIMMQLDD--VISSLTAGPRVEEATYRSIRWLDRCIEAHKRPQD---QALFAIVQGGLSEDLRTKCLEMMLERQHMVGGFAIGGL-SGGEEKASFWRMVNICCKEGGLPVNKPRYVMGVGYSLDILVCVALGADMFDCVYPTRTGRFGCAL--------------VPWGSVL---------------------------LSNASYKFDFNPIDKDCKCIACAKYTRAYLHTINGSPSFAS--LISIHNVAYMLNFMREMRSSIVADKFPEFCRDFFKRQ 1256
            LT    M IQ A+  D    + D     + T+  RV +A  R++  LD C+  H++ Q+     +F +V+GG   + R +      +R   VGGF + G  S   ++    +++     E  LP  KPR V+GVG   +++ CV  G D+F+  +P +    GCAL                  +VL                           L +  Y+ DF P+ + C C  C K+ RAY+H +  +    +  L+ +HN+A+ L F + +R +I +D+  +F      R+
Sbjct:  132 LTAARFMSIQAAVQPDCYQSMADGETWQANTSRKRVRKAVDRTLAHLDECLVLHQKTQELKHAEIFGVVEGGDILEERLRSARETAKRP--VGGFVLDGFHSSAMDQDVRAQLIQETSAE--LPQEKPRLVLGVGRPDEVISCVEAGVDLFESFFPFQVTERGCALSFNYTIDPDPETAGTSASTVLECNGETPEVKKPSANEDVENMTPFEINLKDKRYRDDFRPLVEGCVCYCCQKHMRAYVHHLLVTNELLAGVLLMLHNMAHYLGFFKALRDAITSDRLQDFKNTVLHRR 421          
BLAST of Queuine tRNA-ribosyltransferase catalytic subunit 1 vs. Ensembl Zebrafish
Match: qtrt2 (queuine tRNA-ribosyltransferase accessory subunit 2 [Source:NCBI gene;Acc:402798])

HSP 1 Score: 101.679 bits (252), Expect = 8.826e-23
Identity = 76/294 (25.85%), Postives = 128/294 (43.54%), Query Frame = 3
Query:  522 LTPEHSMEIQNAIGADIMMQLDD--VISSLTAGPRVEEATYRSIRWLDRCIEAHKRPQD---QALFAIVQGGLSEDLRTKCLEMMLERQHMVGGFAIGGL-SGGEEKASFWRMVNICCKEGGLPVNKPRYVMGVGYSLDILVCVALGADMFDCVYPTRTGRFGCAL--------------VPWGSVL---------------------------LSNASYKFDFNPIDKDCKCIACAKYTRAYLHTINGSPSFAS--LISIHNVAYMLNFMREMRSSIVADKFPEFCRDFFKRQ 1256
            LT    M IQ A+  D    + D     + T+  RV +A  R++  LD C+  H++ Q+     +F +V+GG   + R +      +R   VGGF + G  S   ++    +++     E  LP  KPR V+GVG   +++ CV  G D+F+  +P +    GCAL                  +VL                           L +  Y+ DF P+ + C C  C K+ RAY+H +  +    +  L+ +HN+A+ L F + +R +I +D+  +F      R+
Sbjct:  124 LTAARFMSIQAAVQPDCYQSMADGETWQANTSRKRVRKAVDRTLAHLDECLVLHQKTQELKHAEIFGVVEGGDILEERLRSARETAKRP--VGGFVLDGFHSSAMDQDVRAQLIQETSAE--LPQEKPRLVLGVGRPDEVISCVEAGVDLFESFFPFQVTERGCALSFNYTIDPDPETAGTSASTVLECNGETPEVKKPSANEDVENMTPFEINLKDKRYRDDFRPLVEGCVCYCCQKHMRAYVHHLLVTNELLAGVLLMLHNMAHYLGFFKALRDAITSDRLQDFKNTVLHRR 413          
BLAST of Queuine tRNA-ribosyltransferase catalytic subunit 1 vs. Ensembl Xenopus
Match: qtrt1 (queuine tRNA-ribosyltransferase 1 [Source:NCBI gene;Acc:394694])

HSP 1 Score: 458.759 bits (1179), Expect = 6.951e-159
Identity = 227/394 (57.61%), Postives = 278/394 (70.56%), Query Frame = 3
Query:  144 LIAKCSTSRARVNKITLCGQSRNKNQIVDTPVFMPVGTQGTMKGITTEQMKEMFDCRLFLGNTYHLGHRPGPEIMKKAGGLHKFMKWDGGLLTDSGGFQMVSLAKLSYVTEEGVNFTSPHDESQMLLTPEHSMEIQNAIGADIMMQLDDVISSLTAGPRVEEATYRSIRWLDRCIEAHKRPQDQALFAIVQGGLSEDLRTKCLEMMLERQHMVGGFAIGGLSGGEEKASFWRMVNICCKEGGLPVNKPRYVMGVGYSLDILVCVALGADMFDCVYPTRTGRFGCALVPWGSVLLSNASYKFDFNPIDKDCKCIACAKYTRAYLHTINGSPSFA-SLISIHNVAYMLNFMREMRSSIVADKFPEFCRDFFKRQYSKVEDYPQWALEALETVNIVI 1322
            ++A+C  ++AR  +  L       +  V TPVFMP+   G               C + LGNTYHLG RPGPEIMKKAGGLH FM W   LLTDSGGFQMVSL +LS VTEEGV F SP+D  ++LLTPE S+EIQNA+G+DIMMQLDDV+SS   GPRVEEA +RSIRWLDRCI A+  P  Q LFAI+QGGL  +LR KCL+ M +R   V GFAIGGLSGGEEK  FWRMV +      LP +KPRY+MGVGY+ D++VCVALG DMFDCV+PTRT RFG ALVPWGS+ L N  +  DF PIDK+C C  C +Y+RAY++ +  S + A   I+IHN+AY LN MR +R SI+  +FP+F +DF +  YS  + YPQWA++ALETV I +
Sbjct:   37 VLAECPVTKARACEFRL------PHGPVKTPVFMPLRNLG---------------CEICLGNTYHLGMRPGPEIMKKAGGLHGFMNWGKNLLTDSGGFQMVSLVELSKVTEEGVQFRSPYDGKEILLTPEKSIEIQNALGSDIMMQLDDVVSSTITGPRVEEAMHRSIRWLDRCIAANSNPDRQNLFAIIQGGLDAELRRKCLQEMTKRD--VPGFAIGGLSGGEEKDHFWRMVTLSTDH--LPRDKPRYLMGVGYATDLVVCVALGCDMFDCVFPTRTARFGSALVPWGSLQLKNKQFATDFQPIDKNCDCPTCQRYSRAYINALFKSDTAAMHHITIHNIAYQLNLMRSVRDSILQGRFPQFVQDFMRTMYSSRDKYPQWAVDALETVGITL 405          
BLAST of Queuine tRNA-ribosyltransferase catalytic subunit 1 vs. Ensembl Xenopus
Match: qtrt1 (queuine tRNA-ribosyltransferase 1 [Source:NCBI gene;Acc:394694])

HSP 1 Score: 456.833 bits (1174), Expect = 1.448e-158
Identity = 228/389 (58.61%), Postives = 274/389 (70.44%), Query Frame = 3
Query:  159 STSRARVNKITLCGQSRNKNQIVDTPVFMPVGTQGTMKGITTEQMKEMFDCRLFLGNTYHLGHRPGPEIMKKAGGLHKFMKWDGGLLTDSGGFQMVSLAKLSYVTEEGVNFTSPHDESQMLLTPEHSMEIQNAIGADIMMQLDDVISSLTAGPRVEEATYRSIRWLDRCIEAHKRPQDQALFAIVQGGLSEDLRTKCLEMMLERQHMVGGFAIGGLSGGEEKASFWRMVNICCKEGGLPVNKPRYVMGVGYSLDILVCVALGADMFDCVYPTRTGRFGCALVPWGSVLLSNASYKFDFNPIDKDCKCIACAKYTRAYLHTINGSPSFA-SLISIHNVAYMLNFMREMRSSIVADKFPEFCRDFFKRQYSKVEDYPQWALEALETVNIVI 1322
            S S   V K   C + R  +  V TPVFMP+   G               C + LGNTYHLG RPGPEIMKKAGGLH FM W   LLTDSGGFQMVSL +LS VTEEGV F SP+D  ++LLTPE S+EIQNA+G+DIMMQLDDV+SS   GPRVEEA +RSIRWLDRCI A+  P  Q LFAI+QGGL  +LR KCL+ M +R   V GFAIGGLSGGEEK  FWRMV +      LP +KPRY+MGVGY+ D++VCVALG DMFDCV+PTRT RFG ALVPWGS+ L N  +  DF PIDK+C C  C +Y+RAY++ +  S + A   I+IHN+AY LN MR +R SI+  +FP+F +DF +  YS  + YPQWA++ALETV I +
Sbjct:    9 SNSECPVTKARAC-EFRLPHGPVKTPVFMPLRNLG---------------CEICLGNTYHLGMRPGPEIMKKAGGLHGFMNWGKNLLTDSGGFQMVSLVELSKVTEEGVQFRSPYDGKEILLTPEKSIEIQNALGSDIMMQLDDVVSSTITGPRVEEAMHRSIRWLDRCIAANSNPDRQNLFAIIQGGLDAELRRKCLQEMTKRD--VPGFAIGGLSGGEEKDHFWRMVTLSTDH--LPRDKPRYLMGVGYATDLVVCVALGCDMFDCVFPTRTARFGSALVPWGSLQLKNKQFATDFQPIDKNCDCPTCQRYSRAYINALFKSDTAAMHHITIHNIAYQLNLMRSVRDSILQGRFPQFVQDFMRTMYSSRDKYPQWAVDALETVGITL 377          
BLAST of Queuine tRNA-ribosyltransferase catalytic subunit 1 vs. Ensembl Xenopus
Match: qtrt1 (queuine tRNA-ribosyltransferase 1 [Source:NCBI gene;Acc:394694])

HSP 1 Score: 401.364 bits (1030), Expect = 4.174e-137
Identity = 205/394 (52.03%), Postives = 260/394 (65.99%), Query Frame = 3
Query:  144 LIAKCSTSRARVNKITLCGQSRNKNQIVDTPVFMPVGTQGTMKGITTEQMKEMFDCRLFLGNTYHLGHRPGPEIMKKAGGLHKFMKWDGGLLTDSGGFQMVSLAKLSYVTEEGVNFTSPHDESQMLLTPEHSMEIQNAIGADIMMQLDDVISSLTAGPRVEEATYRSIRWLDRCIEAHKRPQDQALFAIVQGGLSEDLRTKCLEMMLERQHMVGGFAIGGLSGGEEKASFWRMVNICCKEGGLPVNKPRYVMGVGYSLDILVCVALGADMFDCVYPTRTGRFGCALVPWGSVLLSNASYKFDFNPIDKDCKCIACAKYTRAYLHTINGSPSFA-SLISIHNVAYMLNFMREMRSSIVADKFPEFCRDFFKRQYSKVEDYPQWALEALETVNIVI 1322
            ++A+C  ++AR  +  L       +  V TPVFMPVGTQGTM    ++ +             +++ H PG                        GGFQMVSL +LS VTEEGV F SP+D  ++LLTPE S+EIQNA+G+DIMMQLDDV+SS   GPRVEEA +RSIRWLDRCI A+  P  Q LFAI+QGGL  +LR KCL+ M +R   V GFAIGGLSGGEEK  FWRMV +      LP +KPRY+MGVGY+ D++VCVALG DMFDCV+PTRT RFG ALVPWGS+ L N  +  DF PIDK+C C  C +Y+RAY++ +  S + A   I+IHN+AY LN MR +R SI+  +FP+F +DF +  YS  + YPQWA++ALETV I +
Sbjct:   13 VLAECPVTKARACEFRL------PHGPVKTPVFMPVGTQGTMGDGRSQLL-------------FYIIHSPG------------------------GGFQMVSLVELSKVTEEGVQFRSPYDGKEILLTPEKSIEIQNALGSDIMMQLDDVVSSTITGPRVEEAMHRSIRWLDRCIAANSNPDRQNLFAIIQGGLDAELRRKCLQEMTKRD--VPGFAIGGLSGGEEKDHFWRMVTLSTDH--LPRDKPRYLMGVGYATDLVVCVALGCDMFDCVFPTRTARFGSALVPWGSLQLKNKQFATDFQPIDKNCDCPTCQRYSRAYINALFKSDTAAMHHITIHNIAYQLNLMRSVRDSILQGRFPQFVQDFMRTMYSSRDKYPQWAVDALETVGITL 359          
BLAST of Queuine tRNA-ribosyltransferase catalytic subunit 1 vs. Ensembl Xenopus
Match: qtrt1 (queuine tRNA-ribosyltransferase 1 [Source:NCBI gene;Acc:394694])

HSP 1 Score: 399.053 bits (1024), Expect = 3.215e-136
Identity = 205/394 (52.03%), Postives = 254/394 (64.47%), Query Frame = 3
Query:  144 LIAKCSTSRARVNKITLCGQSRNKNQIVDTPVFMPVGTQGTMKGITTEQMKEMFDCRLFLGNTYHLGHRPGPEIMKKAGGLHKFMKWDGGLLTDSGGFQMVSLAKLSYVTEEGVNFTSPHDESQMLLTPEHSMEIQNAIGADIMMQLDDVISSLTAGPRVEEATYRSIRWLDRCIEAHKRPQDQALFAIVQGGLSEDLRTKCLEMMLERQHMVGGFAIGGLSGGEEKASFWRMVNICCKEGGLPVNKPRYVMGVGYSLDILVCVALGADMFDCVYPTRTGRFGCALVPWGSVLLSNASYKFDFNPIDKDCKCIACAKYTRAYLHTINGSPSFA-SLISIHNVAYMLNFMREMRSSIVADKFPEFCRDFFKRQYSKVEDYPQWALEALETVNIVI 1322
            ++A+C  ++AR  +  L       +  V TPVFMPVGTQGTM                                               G   DSGGFQMVSL +LS VTEEGV F SP+D  ++LLTPE S+EIQNA+G+DIMMQLDDV+SS   GPRVEEA +RSIRWLDRCI A+  P  Q LFAI+QGGL  +LR KCL+ M +R   V GFAIGGLSGGEEK  FWRMV +      LP +KPRY+MGVGY+ D++VCVALG DMFDCV+PTRT RFG ALVPWGS+ L N  +  DF PIDK+C C  C +Y+RAY++ +  S + A   I+IHN+AY LN MR +R SI+  +FP+F +DF +  YS  + YPQWA++ALETV I +
Sbjct:   13 VLAECPVTKARACEFRL------PHGPVKTPVFMPVGTQGTMGD---------------------------------------------GRSADSGGFQMVSLVELSKVTEEGVQFRSPYDGKEILLTPEKSIEIQNALGSDIMMQLDDVVSSTITGPRVEEAMHRSIRWLDRCIAANSNPDRQNLFAIIQGGLDAELRRKCLQEMTKRD--VPGFAIGGLSGGEEKDHFWRMVTLSTDH--LPRDKPRYLMGVGYATDLVVCVALGCDMFDCVFPTRTARFGSALVPWGSLQLKNKQFATDFQPIDKNCDCPTCQRYSRAYINALFKSDTAAMHHITIHNIAYQLNLMRSVRDSILQGRFPQFVQDFMRTMYSSRDKYPQWAVDALETVGITL 351          
BLAST of Queuine tRNA-ribosyltransferase catalytic subunit 1 vs. Ensembl Xenopus
Match: qtrt2 (queuine tRNA-ribosyltransferase accessory subunit 2 [Source:NCBI gene;Acc:549645])

HSP 1 Score: 68.9366 bits (167), Expect = 4.169e-12
Identity = 51/173 (29.48%), Postives = 83/173 (47.98%), Query Frame = 3
Query:  513 QMLLTPEHSMEIQNAIGADIMMQLDD--VISSLTAGPRVEEATYRSIRWLDRCIE---AHKRPQDQALFAIVQGG--LSEDLRTKCLEMMLERQHMVGGFAIGGLSGG--EEKASFWRMVNICCKEGGLPVNKPRYVMGVGYSLDILVCVALGADMFDCVYPTRTGRFGCALV 1004
            ++ +T +  +  Q  +  D    L D  V     +  RV+++  R++ +LD C++    H+  +   L   V+GG  L E LR+         +  VGGF + G  GG  E++ S    V        LP +KPR++ G+G   ++L CV  G D+FD  +P R    GCAL+
Sbjct:  121 RIEMTAQKFISAQRVLRPDWFQCLSDGEVTPGGNSRKRVKKSVDRTLAFLDECLQLLSGHEDLKPCVLIGAVEGGDLLEERLRS----ARETAKRPVGGFLLDGFHGGSAEKELSLISAVT-----AALPEDKPRFIHGMGRPDEVLECVQRGVDLFDSCFPYRVTERGCALI 284          
BLAST of Queuine tRNA-ribosyltransferase catalytic subunit 1 vs. Ensembl Mouse
Match: Qtrt1 (queuine tRNA-ribosyltransferase catalytic subunit 1 [Source:MGI Symbol;Acc:MGI:1931441])

HSP 1 Score: 460.299 bits (1183), Expect = 1.228e-159
Identity = 226/395 (57.22%), Postives = 284/395 (71.90%), Query Frame = 3
Query:  144 LIAKCSTSRARVNKITLCGQSRNKNQIVDTPVFMPVGTQGTMKGITTEQMKEMFDCRLFLGNTYHLGHRPGPEIMKKAGGLHKFMKWDGGLLTDSGGFQMVSLAKLSYVTEEGVNFTSPHDESQMLLTPEHSMEIQNAIGADIMMQLDDVISSLTAGPRVEEATYRSIRWLDRCIEAHKRPQDQALFAIVQGGLSEDLRTKCLEMMLERQHMVGGFAIGGLSGGEEKASFWRMVNICCKEGGLPVNKPRYVMGVGYSLDILVCVALGADMFDCVYPTRTGRFGCALVPWGSVLLSNASYKFDFNPIDKDCKCIACAKYTRAYLHTINGSPSFASL--ISIHNVAYMLNFMREMRSSIVADKFPEFCRDFFKRQYSKVEDYPQWALEALETVNIVI 1322
            L+A+CS S AR       G+ R  +  V TPVFMPVGTQ TMKGITTEQ+  +  CR+ LGNTYHLG RPGPE+++KA GLH FM W   LLTDSGGFQMVSL  LS VTEEGV+F SP+D  + LL+PE S+EIQNA+G+DI+MQLD V+SS   GP VEEA +RS+RWLDRCI AHK P  Q LFAI+QGGL+ DLRT CL+ M +R   V GFAIGGLSGGE KA FW+MV +      LP +KPRY+MGVGY+ D++VCVALG DMFDCVYPTRT RFG ALVP G++ L    Y  DF+PI+ +C C  C  ++RA+LH +  S +  +L  +++HN+AY L  +  +RSSI+  +FP+F R+F +  Y      P WA+EAL +V I++
Sbjct:   19 LVAECSRSGARA------GELRLPHGTVATPVFMPVGTQATMKGITTEQLDSL-GCRICLGNTYHLGLRPGPELIRKAQGLHGFMNWPHNLLTDSGGFQMVSLFSLSEVTEEGVHFRSPYDGEETLLSPERSVEIQNALGSDIIMQLDHVVSSTVTGPLVEEAMHRSVRWLDRCIAAHKHPDKQNLFAIIQGGLNADLRTTCLKEMTKRD--VPGFAIGGLSGGESKAQFWKMVALSTSM--LPKDKPRYLMGVGYATDLVVCVALGCDMFDCVYPTRTARFGSALVPTGNLQLKKKQYAKDFSPINPECPCPTCQTHSRAFLHALLHSDNTTALHHLTVHNIAYQLQLLSAVRSSILEQRFPDFVRNFMRTMYGDHSLCPAWAVEALASVGIML 402          
BLAST of Queuine tRNA-ribosyltransferase catalytic subunit 1 vs. Ensembl Mouse
Match: Qtrt1 (queuine tRNA-ribosyltransferase catalytic subunit 1 [Source:MGI Symbol;Acc:MGI:1931441])

HSP 1 Score: 91.6633 bits (226), Expect = 7.608e-22
Identity = 43/111 (38.74%), Postives = 69/111 (62.16%), Query Frame = 3
Query:  996 ALVPWGSVLLSNASYKFDFNPIDKDCKCIACAKYTRAYLHTINGSPSFASL--ISIHNVAYMLNFMREMRSSIVADKFPEFCRDFFKRQYSKVEDYPQWALEALETVNIVI 1322
            ALVP G++ L    Y  DF+PI+ +C C  C  ++RA+LH +  S +  +L  +++HN+AY L  +  +RSSI+  +FP+F R+F +  Y      P WA+EAL +V I++
Sbjct:    3 ALVPTGNLQLKKKQYAKDFSPINPECPCPTCQTHSRAFLHALLHSDNTTALHHLTVHNIAYQL--LSAVRSSILEQRFPDFVRNFMRTMYGDHSLCPAWAVEALASVGIML 111          
BLAST of Queuine tRNA-ribosyltransferase catalytic subunit 1 vs. Ensembl Mouse
Match: Qtrt2 (queuine tRNA-ribosyltransferase accessory subunit 2 [Source:MGI Symbol;Acc:MGI:1922194])

HSP 1 Score: 84.3445 bits (207), Expect = 4.051e-17
Identity = 70/295 (23.73%), Postives = 119/295 (40.34%), Query Frame = 3
Query:  522 LTPEHSMEIQNAIGADIMMQLDDVISS---LTAGPRVEEATYRSIRWLDRCI---EAHKRPQDQALFAIVQGGLSEDLRTKCLEMMLERQHMVGGFAIGGLSGGEEKASFWRMVNICCKEGGLPVNKPRYVMGVGYSLDILVCVALGADMFDCVYPTRTGRFGCALV--------PWGSVLLSNA---------------------------------SYKFDFNPIDKDCKCIACAKYTRAYLHTINGSPSFAS--LISIHNVAYMLNFMREMRSSIVADKFPEF----CRDFF 1247
            +T    M IQ A+  D    L D  +S    T+  R  ++  RS+ +LD C+   E  +  Q   +  +++GG   + R +      +R   VGGF + G  G +   +  R+  +      LP +KPR + GV    ++L C+  G D+F+  +P +    GCAL         P  ++L  N                                   Y+ DF+P+ + C C  C  +TRAY+H +  +    +  L+ +HN  +   F   +R ++  D   +     CR  F
Sbjct:  125 MTVSKFMAIQEALQPDWFQCLSDGEASCAETTSIKRARKSVDRSLLFLDSCLRLQEESEVLQKSVIIGVIEGGDVMEERLRSARETAKRP--VGGFLLDGFQG-DPAVTETRLHLLSSVTAELPEDKPRLICGVSRPDEVLECIERGVDLFESFFPYQVTERGCALTFTFDCQLNPEETLLQQNGIQEKIKGLDQAKKIEATGCNQEMTSFEINLKEKKYQEDFDPLVRGCSCYCCKNHTRAYIHHLLMTNELLAGVLLMMHNFEHYFGFFCSIREALKNDTLAQLKELICRQMF 416          
BLAST of Queuine tRNA-ribosyltransferase catalytic subunit 1 vs. Ensembl Mouse
Match: Qtrt2 (queuine tRNA-ribosyltransferase accessory subunit 2 [Source:MGI Symbol;Acc:MGI:1922194])

HSP 1 Score: 72.0182 bits (175), Expect = 3.153e-13
Identity = 53/234 (22.65%), Postives = 92/234 (39.32%), Query Frame = 3
Query:  687 QDQALFAIVQGGLSEDLRTKCLEMMLERQHMVGGFAIGGLSGGEEKASFWRMVNICCKEGGLPVNKPRYVMGVGYSLDILVCVALGADMFDCVYPTRTGRFGCALV--------PWGSVLLSNA---------------------------------SYKFDFNPIDKDCKCIACAKYTRAYLHTINGSPSFAS--LISIHNVAYMLNFMREMRSSIVADKFPEF----CRDFF 1247
            Q   +  +++GG   + R +      +R   VGGF + G  G +   +  R+  +      LP +KPR + GV    ++L C+  G D+F+  +P +    GCAL         P  ++L  N                                   Y+ DF+P+ + C C  C  +TRAY+H +  +    +  L+ +HN  +   F   +R ++  D   +     CR  F
Sbjct:  115 QKSVIIGVIEGGDVMEERLRSARETAKRP--VGGFLLDGFQG-DPAVTETRLHLLSSVTAELPEDKPRLICGVSRPDEVLECIERGVDLFESFFPYQVTERGCALTFTFDCQLNPEETLLQQNGIQEKIKGLDQAKKIEATGCNQEMTSFEINLKEKKYQEDFDPLVRGCSCYCCKNHTRAYIHHLLMTNELLAGVLLMMHNFEHYFGFFCSIREALKNDTLAQLKELICRQMF 345          
BLAST of Queuine tRNA-ribosyltransferase catalytic subunit 1 vs. UniProt/SwissProt
Match: sp|Q28HC6|TGT_XENTR (Queuine tRNA-ribosyltransferase catalytic subunit 1 OS=Xenopus tropicalis OX=8364 GN=qtrt1 PE=2 SV=2)

HSP 1 Score: 488.804 bits (1257), Expect = 3.166e-170
Identity = 237/394 (60.15%), Postives = 292/394 (74.11%), Query Frame = 3
Query:  144 LIAKCSTSRARVNKITLCGQSRNKNQIVDTPVFMPVGTQGTMKGITTEQMKEMFDCRLFLGNTYHLGHRPGPEIMKKAGGLHKFMKWDGGLLTDSGGFQMVSLAKLSYVTEEGVNFTSPHDESQMLLTPEHSMEIQNAIGADIMMQLDDVISSLTAGPRVEEATYRSIRWLDRCIEAHKRPQDQALFAIVQGGLSEDLRTKCLEMMLERQHMVGGFAIGGLSGGEEKASFWRMVNICCKEGGLPVNKPRYVMGVGYSLDILVCVALGADMFDCVYPTRTGRFGCALVPWGSVLLSNASYKFDFNPIDKDCKCIACAKYTRAYLHTINGSPSFA-SLISIHNVAYMLNFMREMRSSIVADKFPEFCRDFFKRQYSKVEDYPQWALEALETVNIVI 1322
            ++A+C  ++AR  +  L       +  V TPVFMPVGTQGTMKG+T +Q++ +  C + LGNTYHLG RPGPEIMKKAGGLH FM W   LLTDSGGFQMVSL +LS VTEEGV F SP+D  ++LLTPE S+EIQNA+G+DIMMQLDDV+SS   GPRVEEA +RSIRWLDRCI A+  P  Q LFAI+QGGL  +LR KCL+ M +R   V GFAIGGLSGGEEK  FWRMV +      LP +KPRY+MGVGY+ D++VCVALG DMFDCV+PTRT RFG ALVPWGS+ L N  +  DF PIDK+C C  C +Y+RAY++ +  S + A   I+IHN+AY LN MR +R SI+  +FP+F +DF +  YS  + YPQWA++ALETV I +
Sbjct:   13 VLAECPVTKARACEFRL------PHGPVKTPVFMPVGTQGTMKGVTADQLRNL-GCEICLGNTYHLGMRPGPEIMKKAGGLHGFMNWGRNLLTDSGGFQMVSLVELSKVTEEGVQFRSPYDGKEILLTPEKSIEIQNALGSDIMMQLDDVVSSTITGPRVEEAMHRSIRWLDRCIAANSNPDRQNLFAIIQGGLDAELRRKCLQEMTKRD--VPGFAIGGLSGGEEKDHFWRMVTLSTDH--LPRDKPRYLMGVGYATDLVVCVALGCDMFDCVFPTRTARFGSALVPWGSLQLKNKQFAKDFQPIDKNCDCPTCQRYSRAYINALFKSDTAAMHHITIHNIAYQLNLMRSVRDSILQGRFPQFVQDFMRTMYSSRDKYPQWAVDALETVGITL 395          
BLAST of Queuine tRNA-ribosyltransferase catalytic subunit 1 vs. UniProt/SwissProt
Match: sp|Q9VPY8|TGT_DROME (Queuine tRNA-ribosyltransferase catalytic subunit OS=Drosophila melanogaster OX=7227 GN=Tgt PE=2 SV=1)

HSP 1 Score: 488.034 bits (1255), Expect = 1.953e-169
Identity = 238/396 (60.10%), Postives = 289/396 (72.98%), Query Frame = 3
Query:  132 LECNLIAKCSTSRARVNKITLCGQSRNKNQIVDTPVFMPVGTQGTMKGITTEQMKEMFDCRLFLGNTYHLGHRPGPEIMKKAGGLHKFMKWDGGLLTDSGGFQMVSLAKLSYVTEEGVNFTSPHDESQMLLTPEHSMEIQNAIGADIMMQLDDVISSLTAGPRVEEATYRSIRWLDRCIEAHKRPQDQALFAIVQGGLSEDLRTKCLEMMLERQHMVGGFAIGGLSGGEEKASFWRMVNICCKEGGLPVNKPRYVMGVGYSLDILVCVALGADMFDCVYPTRTGRFGCALVPWGSVLLSNASYKFDFNPIDKDCKCIACAKYTRAYLHTINGSPSF-ASLISIHNVAYMLNFMREMRSSIVADKFPEFCRDFFKRQYSKVEDYPQWALEALETVNI 1316
            L   ++A+CS S+AR   +TL      ++  V+TPVFMPVGTQGT+KGI  +Q+ E+ +C++ LGNTYHLG RPG E +KKAGGLHKFM W   +LTDSGGFQMVSL +L+ + E GVNF SP D SQ +LTPEHS+EIQNAIG DIMMQLDDV+ + T GPRVEEA  R+IRW+DRCIEAH R  DQ+LF IVQGGL   LR +C+  ++ERQ  V GFA+GGLSGGE K  FWRMV++C   G LP +KPRY+MGVG++ D++VCVALG DMFDCV+PTRT RFGCALV  G + L    YK D  PIDKDC C  C +YTR+YLH I  + S  +SL+SIHNVAY L  MR MR +I  D+FP+F  DF  R + K E  P W  EAL  VNI
Sbjct:    9 LTYKVVAECSVSKARAGLMTL------RHSEVNTPVFMPVGTQGTLKGIVPDQLIEL-NCQILLGNTYHLGLRPGIETLKKAGGLHKFMGWPRAILTDSGGFQMVSLLQLAEIDEHGVNFRSPFDNSQCMLTPEHSIEIQNAIGGDIMMQLDDVVKTTTTGPRVEEAMERTIRWVDRCIEAHARDDDQSLFPIVQGGLDVPLRQRCVSALMERQ--VRGFAVGGLSGGESKHDFWRMVDVCT--GYLPKDKPRYLMGVGFAADLVVCVALGIDMFDCVFPTRTARFGCALVDSGQLNLKQPKYKLDMEPIDKDCDCSTCRRYTRSYLHHIATNESVSSSLLSIHNVAYQLRLMRSMREAIQRDEFPQFVADFMARHF-KAEPVPAWIREALSAVNI 392          
BLAST of Queuine tRNA-ribosyltransferase catalytic subunit 1 vs. UniProt/SwissProt
Match: sp|Q4QQY7|TGT_XENLA (Queuine tRNA-ribosyltransferase catalytic subunit 1 OS=Xenopus laevis OX=8355 GN=qtrt1 PE=2 SV=1)

HSP 1 Score: 484.182 bits (1245), Expect = 2.597e-168
Identity = 235/395 (59.49%), Postives = 293/395 (74.18%), Query Frame = 3
Query:  144 LIAKCSTSRARVNKITLC-GQSRNKNQIVDTPVFMPVGTQGTMKGITTEQMKEMFDCRLFLGNTYHLGHRPGPEIMKKAGGLHKFMKWDGGLLTDSGGFQMVSLAKLSYVTEEGVNFTSPHDESQMLLTPEHSMEIQNAIGADIMMQLDDVISSLTAGPRVEEATYRSIRWLDRCIEAHKRPQDQALFAIVQGGLSEDLRTKCLEMMLERQHMVGGFAIGGLSGGEEKASFWRMVNICCKEGGLPVNKPRYVMGVGYSLDILVCVALGADMFDCVYPTRTGRFGCALVPWGSVLLSNASYKFDFNPIDKDCKCIACAKYTRAYLHTINGSPSFA-SLISIHNVAYMLNFMREMRSSIVADKFPEFCRDFFKRQYSKVEDYPQWALEALETVNIVI 1322
            ++A+C  ++AR  ++ +  GQ       V TPVFMPVGTQGTMKG+T +Q++ +  C + LGNTYHLG RPGPEIMKKA GLH FM WD  LLTDSGGFQMVSL +LS VTEEGV F SP+D  ++LLTPE S+EIQNA+G+DIMMQLDDV+SS  +GPRVEEA +RSIRWLDRCI A+  P  Q LFAI+QGGL  +LR +CL+ M +R   V GFAIGGLSGGEEK  FWRMV +      LP +KPRY+MGVGY+ D++VCVALG DMFDCV+PTRT RFG ALVPWGS+ L +  +  DF PIDK+C C  C +Y+R+Y++ +  S + A   I+IHN+AY LN MR +R SI+  +FP+F +DF K  Y   + YPQWA+ ALETV I +
Sbjct:   13 VLAECPVTKARACELQMPHGQ-------VKTPVFMPVGTQGTMKGVTADQLRNL-GCEICLGNTYHLGMRPGPEIMKKASGLHGFMNWDRNLLTDSGGFQMVSLVELSKVTEEGVQFRSPYDGKEILLTPEKSIEIQNALGSDIMMQLDDVVSSTISGPRVEEAMHRSIRWLDRCIAANGNPDRQNLFAIIQGGLDAELRKQCLQEMTKRD--VPGFAIGGLSGGEEKDHFWRMVTLSTDH--LPRDKPRYLMGVGYATDLVVCVALGCDMFDCVFPTRTARFGSALVPWGSLQLKSKQFAKDFQPIDKNCDCPTCQRYSRSYINALFKSDTAAMHHITIHNIAYQLNLMRSVRESILQGRFPQFVQDFMKTMYGNKDKYPQWAVAALETVGITL 395          
BLAST of Queuine tRNA-ribosyltransferase catalytic subunit 1 vs. UniProt/SwissProt
Match: sp|Q7SYK1|TGT_DANRE (Queuine tRNA-ribosyltransferase catalytic subunit 1 OS=Danio rerio OX=7955 GN=qtrt1 PE=2 SV=1)

HSP 1 Score: 474.937 bits (1221), Expect = 1.326e-164
Identity = 233/403 (57.82%), Postives = 296/403 (73.45%), Query Frame = 3
Query:  117 SSERTLECNLIAKCSTSRARVNKITLCGQSRNKNQIVDTPVFMPVGTQGTMKGITTEQMKEMFDCRLFLGNTYHLGHRPGPEIMKKAGGLHKFMKWDGGLLTDSGGFQMVSLAKLSYVTEEGVNFTSPHDESQMLLTPEHSMEIQNAIGADIMMQLDDVISSLTAGPRVEEATYRSIRWLDRCIEAHKRPQDQALFAIVQGGLSEDLRTKCLEMMLERQHMVGGFAIGGLSGGEEKASFWRMVNICCKEGGLPVNKPRYVMGVGYSLDILVCVALGADMFDCVYPTRTGRFGCALVPWGSVLLSNASYKFDFNPIDKDCKCIACAKYTRAYLHTINGSPSFA-SLISIHNVAYMLNFMREMRSSIVADKFPEFCRDFFKRQYSKVEDYPQWALEALETVNIVI 1322
            SS   L   ++A+C  S+AR   +TL       +  V+TPVFMPVGTQGTMKGIT +Q++++ DC++ LGNTYHLG RPGP++++KA GLH FMKW   LLTDSGGFQMVSL +LS VTEEGV F SP+D  ++LLTPE S+ IQN++G+DIMMQLDDV+SS   GPRVEEA +RS+RWLDRCI A+K P  Q LFAI+QGGL  +LR  CL+ M +R   V GFAIGGL GGEEK  FW+MV +      LP  KPRY+MGVGY++D++VCVALG DMFDCV+PTRT RFG ALVPWGS+ L    Y  DF PID DC+C  C +++RAYLH +  S + A   I+IHN++Y L+ MR +R SI+  +FPEF ++F KR +     YP WA+EAL++VNI +
Sbjct:    8 SSAAPLALRIVAECPVSKARACSLTL------PHCAVNTPVFMPVGTQGTMKGITADQLEDL-DCQICLGNTYHLGMRPGPDLIEKANGLHGFMKWRRNLLTDSGGFQMVSLVELSEVTEEGVTFRSPYDGKEILLTPEQSIAIQNSLGSDIMMQLDDVVSSTVKGPRVEEAMHRSVRWLDRCIAANKNPDRQNLFAIIQGGLDAELRKACLKEMTKRD--VPGFAIGGLGGGEEKDDFWKMVTLSTDH--LPREKPRYLMGVGYAVDLVVCVALGCDMFDCVFPTRTARFGSALVPWGSLQLKQKQYAKDFQPIDPDCQCPTCRRHSRAYLHALFKSDTAAMHHITIHNISYQLSLMRSVRQSIIDQRFPEFVKEFMKRMFPSSSQYPSWAVEALQSVNICL 399          
BLAST of Queuine tRNA-ribosyltransferase catalytic subunit 1 vs. UniProt/SwissProt
Match: sp|Q9BXR0|TGT_HUMAN (Queuine tRNA-ribosyltransferase catalytic subunit 1 OS=Homo sapiens OX=9606 GN=QTRT1 PE=1 SV=3)

HSP 1 Score: 471.47 bits (1212), Expect = 2.827e-163
Identity = 231/395 (58.48%), Postives = 285/395 (72.15%), Query Frame = 3
Query:  144 LIAKCSTSRARVNKITLCGQSRNKNQIVDTPVFMPVGTQGTMKGITTEQMKEMFDCRLFLGNTYHLGHRPGPEIMKKAGGLHKFMKWDGGLLTDSGGFQMVSLAKLSYVTEEGVNFTSPHDESQMLLTPEHSMEIQNAIGADIMMQLDDVISSLTAGPRVEEATYRSIRWLDRCIEAHKRPQDQALFAIVQGGLSEDLRTKCLEMMLERQHMVGGFAIGGLSGGEEKASFWRMVNICCKEGGLPVNKPRYVMGVGYSLDILVCVALGADMFDCVYPTRTGRFGCALVPWGSVLLSNASYKFDFNPIDKDCKCIACAKYTRAYLHTINGSPSFASL--ISIHNVAYMLNFMREMRSSIVADKFPEFCRDFFKRQYSKVEDYPQWALEALETVNIVI 1322
            L+A+CS SRAR  ++ L       +  V TPVFMPVGTQ TMKGITTEQ+ +   CR+ LGNTYHLG RPGPE+++KA GLH FM W   LLTDSGGFQMVSL  LS VTEEGV F SP+D ++ LL+PE S++IQNA+G+DI+MQLDDV+SS   GPRVEEA YRSIRWLDRCI AH+RP  Q LFAI+QGGL  DLR  CLE M +R   V GFAIGGLSGGE K+ FWRMV +      LP +KPRY+MGVGY+ D++VCVALG DMFDCV+PTRT RFG ALVP G++ L    ++ DF PID +C C  C K++RA+LH +  S + A+L  +++HN+AY L  M  +R+SIV  +FP+F RDF    Y      P WA +AL +V I +
Sbjct:   19 LVAECSRSRARAGELWL------PHGTVATPVFMPVGTQATMKGITTEQL-DALGCRICLGNTYHLGLRPGPELIQKANGLHGFMNWPHNLLTDSGGFQMVSLVSLSEVTEEGVRFRSPYDGNETLLSPEKSVQIQNALGSDIIMQLDDVVSSTVTGPRVEEAMYRSIRWLDRCIAAHQRPDKQNLFAIIQGGLDADLRATCLEEMTKRD--VPGFAIGGLSGGESKSQFWRMVALSTSR--LPKDKPRYLMGVGYATDLVVCVALGCDMFDCVFPTRTARFGSALVPTGNLQLRKKVFEKDFGPIDPECTCPTCQKHSRAFLHALLHSDNTAALHHLTVHNIAYQLQLMSAVRTSIVEKRFPDFVRDFMGAMYGDPTLCPTWATDALASVGITL 402          
BLAST of Queuine tRNA-ribosyltransferase catalytic subunit 1 vs. TrEMBL
Match: A0A2C9JMJ7 (Queuine tRNA-ribosyltransferase catalytic subunit 1 OS=Biomphalaria glabrata OX=6526 GN=106060177 PE=3 SV=1)

HSP 1 Score: 506.138 bits (1302), Expect = 1.904e-174
Identity = 241/400 (60.25%), Postives = 303/400 (75.75%), Query Frame = 3
Query:  120 SERTLECNLIAKCSTSRARVNKITLCGQSRNKNQIVDTPVFMPVGTQGTMKGITTEQMKEMFDCRLFLGNTYHLGHRPGPEIMKKAGGLHKFMKWDGGLLTDSGGFQMVSLAKLSYVTEEGVNFTSPHDESQMLLTPEHSMEIQNAIGADIMMQLDDVISSLTAGPRVEEATYRSIRWLDRCIEAHKRPQDQALFAIVQGGLSEDLRTKCLEMMLERQHMVGGFAIGGLSGGEEKASFWRMVNICCKEGGLPVNKPRYVMGVGYSLDILVCVALGADMFDCVYPTRTGRFGCALVPWGSVLLSNASYKFDFNPIDKDCKCIACAKYTRAYLHTI-NGSPSFASLISIHNVAYMLNFMREMRSSIVADKFPEFCRDFFKRQYSKVEDYPQWALEALETVNI 1316
            +   L  N++AKCSTS+AR   +TL       + +VDTPVFMPVGTQGT+KG+  +Q++EM  C++ LGNTYHLG+RPGPE+++KAGGLH FMKWD  LLTDSGGFQMVSL KL+ +TEEGV F SPHD S+MLLTPE S+EIQN+IGADI+MQLDDV+ S  +GPR+EEA +R+IRWLDRCI+AH+RP +Q LF IVQGGL+ +LR +C   +++R   VGGFAIGGLSGGEEK+ FWRMV +      LP  KPRY+MGVG+++D++VCVALG DMFDCV+PTRT RFGCALV  G + L +  +  DF PID +C+C  C  Y RAYLHT+ N  P+  ++I++HNVAY LN M  MR SI  DKFPEF + FF   +    DYP W L+AL +VNI
Sbjct:    9 NSHALSLNILAKCSTSKARACAMTL------PHAVVDTPVFMPVGTQGTLKGLVPDQLREM-GCKIMLGNTYHLGNRPGPELLEKAGGLHNFMKWDRALLTDSGGFQMVSLLKLAEITEEGVKFQSPHDGSEMLLTPERSIEIQNSIGADIIMQLDDVVHSSVSGPRLEEAMHRTIRWLDRCIKAHRRPSEQCLFPIVQGGLNAELRKQCAHELVKRD--VGGFAIGGLSGGEEKSEFWRMVKL--STDLLPDCKPRYLMGVGFAVDLVVCVALGCDMFDCVFPTRTARFGCALVKTGQLNLKSKIFAKDFRPIDSECQCSTCKTYNRAYLHTLANSEPAACNIITVHNVAYQLNLMSSMRQSIFEDKFPEFVQQFFTDMFPD-GDYPDWTLQALASVNI 396          
BLAST of Queuine tRNA-ribosyltransferase catalytic subunit 1 vs. TrEMBL
Match: R7VA28 (Queuine tRNA-ribosyltransferase catalytic subunit 1 OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_19396 PE=3 SV=1)

HSP 1 Score: 505.753 bits (1301), Expect = 2.543e-174
Identity = 241/400 (60.25%), Postives = 308/400 (77.00%), Query Frame = 3
Query:  120 SERTLECNLIAKCSTSRARVNKITLCGQSRNKNQIVDTPVFMPVGTQGTMKGITTEQMKEMFDCRLFLGNTYHLGHRPGPEIMKKAGGLHKFMKWDGGLLTDSGGFQMVSLAKLSYVTEEGVNFTSPHDESQMLLTPEHSMEIQNAIGADIMMQLDDVISSLTAGPRVEEATYRSIRWLDRCIEAHKRPQDQALFAIVQGGLSEDLRTKCLEMMLERQHMVGGFAIGGLSGGEEKASFWRMVNICCKEGGLPVNKPRYVMGVGYSLDILVCVALGADMFDCVYPTRTGRFGCALVPWGSVLLSNASYKFDFNPIDKDCKCIACAKYTRAYLHTINGSPSF-ASLISIHNVAYMLNFMREMRSSIVADKFPEFCRDFFKRQYSKVEDYPQWALEALETVNI 1316
            ++R L+  ++A+CS S+AR +KI+L       +  VD PVFMPVGTQGT+KG+  EQ+K++  C++ LGNTYHLG+RPGPEI+ + GGLHKFM WD  LLTDSGGFQMVSL KL+ +TEEGV F +PHD S++LLTPE S+EIQNAIGADI+MQLDDV+ +LT G RVEEA +R+IRWLDRCI AHK+P+ Q LF IVQGGL+ +LR +C + +++R   V GFAIGGLSGGEEK++FWRMV+       LP  KPRY+MGVG++LD++VCVALG DMFDCV+PTRT RFGCALV  G + L    +K DF PID++C+C  C KYTRAYLHTI    +  ASLI++HNV +MLN M+ +R SI+ DKFPEF ++F   ++   E YP WA+EAL +VNI
Sbjct:    6 AKRALKFEVLAECSKSKARTSKISLV------HATVDAPVFMPVGTQGTLKGMLPEQLKQL-GCQIMLGNTYHLGNRPGPEILDEVGGLHKFMDWDRALLTDSGGFQMVSLLKLAEITEEGVEFEAPHDGSKLLLTPEKSIEIQNAIGADIIMQLDDVVHTLTTGHRVEEAMHRTIRWLDRCIAAHKKPELQNLFPIVQGGLNPELRKQCAQELIKRD--VNGFAIGGLSGGEEKSAFWRMVSTSTDV--LPKEKPRYLMGVGFALDLVVCVALGCDMFDCVFPTRTARFGCALVSTGQLQLKKTEFKSDFRPIDENCECSTCKKYTRAYLHTIAAHEAVAASLITVHNVCFMLNLMKSIRESILVDKFPEFVQNFMSVRFPTGE-YPSWAIEALSSVNI 393          
BLAST of Queuine tRNA-ribosyltransferase catalytic subunit 1 vs. TrEMBL
Match: A0A1S3H8H3 (Queuine tRNA-ribosyltransferase catalytic subunit 1 OS=Lingula unguis OX=7574 GN=LOC106153059 PE=3 SV=1)

HSP 1 Score: 505.368 bits (1300), Expect = 3.635e-174
Identity = 238/398 (59.80%), Postives = 306/398 (76.88%), Query Frame = 3
Query:  132 LECNLIAKCSTSRARVNKITLCGQSRNKNQIVDTPVFMPVGTQGTMKGITTEQMKEMFDCRLFLGNTYHLGHRPGPEIMKKAGGLHKFMKWDGGLLTDSGGFQMVSLAKLSYVTEEGVNFTSPHDESQMLLTPEHSMEIQNAIGADIMMQLDDVISSLTAGPRVEEATYRSIRWLDRCIEAHKRPQDQALFAIVQGGLSEDLRTKCLEMMLERQHMVGGFAIGGLSGGEEKASFWRMVNICCKEGGLPVNKPRYVMGVGYSLDILVCVALGADMFDCVYPTRTGRFGCALVPWGSVLLSNASYKFDFNPIDKDCKCIACAKYTRAYLHTING-SPSFASLISIHNVAYMLNFMREMRSSIVADKFPEFCRDFFKRQYSKVEDYPQWALEALETVNIVI 1322
            L   ++A+CST++ARV+K+ L       +  VDTPVFMPVGTQGT+K +  +Q++EM DC++ LGNTYHLGHRPGPE+++KAGGLHKFM W+  LLTDSGGFQMVSL KL+ +TEEGV F SPHD S M+LTPE S+EIQN+IGADI+MQLDDV+ S T GPRVEEA +R+IRWLDRC++AH RP DQ++F IVQGGL  +LR KC + + +R   V GFAIGGLSGGEEK+ FWRMV++      LP++KPRY+MGVG+++D++VC ALG DMFDCVYPTRT RFG ALVP G + L    +  DF PID++C C  C++YTR+YLHTI G  P  A LI++HNV Y LN MR +R SI+ + FP+F +DF    +   +DYP+WA+EAL +VN+ +
Sbjct:   10 LSFKVLAECSTTKARVSKLIL------PHHEVDTPVFMPVGTQGTLKAMLPDQLEEM-DCQIILGNTYHLGHRPGPELLEKAGGLHKFMNWNRNLLTDSGGFQMVSLLKLAEITEEGVKFESPHDGSTMMLTPEKSIEIQNSIGADIIMQLDDVVHSTTTGPRVEEAMWRTIRWLDRCLKAHGRPHDQSIFPIVQGGLDAELRKKCAQELTKRD--VSGFAIGGLSGGEEKSQFWRMVSLSTDH--LPLDKPRYLMGVGFAVDLVVCCALGCDMFDCVYPTRTARFGTALVPTGLLNLKLEKFSRDFRPIDENCGCSTCSQYTRSYLHTIAGHKPVAAQLITVHNVKYQLNLMRGIRKSIMENTFPKFVQDFMSALFPS-KDYPEWAVEALASVNVTL 395          
BLAST of Queuine tRNA-ribosyltransferase catalytic subunit 1 vs. TrEMBL
Match: A0A4P9YFZ0 (Queuine tRNA-ribosyltransferase (Fragment) OS=Rozella allomycis (strain CSF55) OX=988480 GN=ROZALSC1DRAFT_30670 PE=3 SV=1)

HSP 1 Score: 504.212 bits (1297), Expect = 1.594e-173
Identity = 242/413 (58.60%), Postives = 308/413 (74.58%), Query Frame = 3
Query:   84 SVNKILFSREKSSERTLECNLIAKCSTSRARVNKITLCGQSRNKNQIVDTPVFMPVGTQGTMKGITTEQMKEMFDCRLFLGNTYHLGHRPGPEIMKKAGGLHKFMKWDGGLLTDSGGFQMVSLAKLSYVTEEGVNFTSPHDESQMLLTPEHSMEIQNAIGADIMMQLDDVISSLTAGPRVEEATYRSIRWLDRCIEAHKRPQDQALFAIVQGGLSEDLRTKCLEMMLERQHMVGGFAIGGLSGGEEKASFWRMVNICCKEGGLPVNKPRYVMGVGYSLDILVCVALGADMFDCVYPTRTGRFGCALVPWGSVLLSNASYKFDFNPIDKDCKCIACAKYTRAYLHTINGSPSFA-SLISIHNVAYMLNFMREMRSSIVADKFPEFCRDFFKRQYS-KVEDYPQWALEALETVNI 1316
            S N +  +R + ++  LE  +IA+CST+ ARV+K+ L       +Q+VDTPVFMPVGTQGTMKG+T +QMK++ DC+LFLGNTYHLGHRPGPE+++K GGLHKFM WD  LLTDSGGFQMVSL KL+ + EEGV F SPHD S M+LTPEHS+ +Q +IGADIMMQLDDV+ +LT GPR+EEA YRS+RWLDRCI+AH    +Q LFAI+QGGL  DLR KC+E M++R   + G+AIGGLSGGE+K SFW++V  C     LP NKPRY MGVGY+ D++VCVALG DMFDCVYPTRT RFG ALVP+G + LSN+ +K D  PID++C C  C  ++RA++H++ G  +    LISIHN+ Y L  MR+MR +I  D+FP F + F    +   V  YPQW ++A  +V I
Sbjct:    8 SFNTLGVARFEMTKNLLE--IIAQCSTTSARVSKMHL------PHQVVDTPVFMPVGTQGTMKGLTMKQMKDL-DCQLFLGNTYHLGHRPGPELLEKMGGLHKFMDWDRALLTDSGGFQMVSLLKLAEIKEEGVQFQSPHDGSIMMLTPEHSISLQTSIGADIMMQLDDVVHTLTEGPRMEEAMYRSVRWLDRCIKAHTNTDNQHLFAIIQGGLDYDLRGKCIEEMVKRD--LPGYAIGGLSGGEDKESFWKIVKFCADR--LPKNKPRYCMGVGYATDLVVCVALGVDMFDCVYPTRTARFGYALVPFGKLSLSNSEFKDDHRPIDENCSCFTCKNHSRAFIHSLIGKETVGCHLISIHNICYQLTLMRQMREAIEKDEFPVFVKSFMNNMFGPHVSKYPQWMIDAFSSVGI 407          
BLAST of Queuine tRNA-ribosyltransferase catalytic subunit 1 vs. TrEMBL
Match: A0A1S3JXL2 (Queuine tRNA-ribosyltransferase catalytic subunit 1 OS=Lingula unguis OX=7574 GN=LOC106177051 PE=3 SV=1)

HSP 1 Score: 502.671 bits (1293), Expect = 3.882e-173
Identity = 237/398 (59.55%), Postives = 305/398 (76.63%), Query Frame = 3
Query:  132 LECNLIAKCSTSRARVNKITLCGQSRNKNQIVDTPVFMPVGTQGTMKGITTEQMKEMFDCRLFLGNTYHLGHRPGPEIMKKAGGLHKFMKWDGGLLTDSGGFQMVSLAKLSYVTEEGVNFTSPHDESQMLLTPEHSMEIQNAIGADIMMQLDDVISSLTAGPRVEEATYRSIRWLDRCIEAHKRPQDQALFAIVQGGLSEDLRTKCLEMMLERQHMVGGFAIGGLSGGEEKASFWRMVNICCKEGGLPVNKPRYVMGVGYSLDILVCVALGADMFDCVYPTRTGRFGCALVPWGSVLLSNASYKFDFNPIDKDCKCIACAKYTRAYLHTING-SPSFASLISIHNVAYMLNFMREMRSSIVADKFPEFCRDFFKRQYSKVEDYPQWALEALETVNIVI 1322
            L   ++A+CST++ARV+K+ L       +  VDTPVFMPVGTQGT+K +  +Q++EM DC++ LGNTYHLGHRPGPE+++KAGGLHKFM W+  LLTDSGGFQMVSL KL+ +TEEGV F SPHD S M+LTPE S+EIQN+IGADI+MQLDDV+ S T GPRVEEA +R+IRWLDRC++AH RP DQ++F IVQGGL  +LR KC + + +R   V GFAIGGLSGGEEK+ FWRMV++      LP +KPRY+MGVG+++D++VC ALG DMFDCVYPTRT RFG ALVP G + L    +  DF PID++C C  C++YTR+YLHTI G  P  A LI++HNV Y LN MR +R SI+ + FP+F +DF    +   +DYP+W++EAL +VN+ +
Sbjct:   10 LSFKVLAECSTTKARVSKLIL------PHHEVDTPVFMPVGTQGTLKAMLPDQLEEM-DCQIILGNTYHLGHRPGPELLEKAGGLHKFMNWNRNLLTDSGGFQMVSLLKLAEITEEGVKFESPHDGSTMMLTPEKSIEIQNSIGADIIMQLDDVVHSTTTGPRVEEAMWRTIRWLDRCLKAHARPHDQSIFPIVQGGLDAELRKKCAQELTKRD--VSGFAIGGLSGGEEKSQFWRMVSLSTDH--LPGDKPRYLMGVGFAVDLVVCCALGCDMFDCVYPTRTARFGTALVPTGLLNLKLEKFSQDFRPIDENCGCSTCSQYTRSYLHTIAGHKPVAAQLITVHNVRYQLNLMRGIRKSIMENTFPKFVQDFMSALFPS-KDYPEWSVEALASVNVTL 395          
BLAST of Queuine tRNA-ribosyltransferase catalytic subunit 1 vs. Ensembl Cavefish
Match: qtrt1 (queuine tRNA-ribosyltransferase catalytic subunit 1 [Source:NCBI gene;Acc:103032114])

HSP 1 Score: 486.108 bits (1250), Expect = 1.069e-169
Identity = 232/398 (58.29%), Postives = 292/398 (73.37%), Query Frame = 3
Query:  132 LECNLIAKCSTSRARVNKITLCGQSRNKNQIVDTPVFMPVGTQGTMKGITTEQMKEMFDCRLFLGNTYHLGHRPGPEIMKKAGGLHKFMKWDGGLLTDSGGFQMVSLAKLSYVTEEGVNFTSPHDESQMLLTPEHSMEIQNAIGADIMMQLDDVISSLTAGPRVEEATYRSIRWLDRCIEAHKRPQDQALFAIVQGGLSEDLRTKCLEMMLERQHMVGGFAIGGLSGGEEKASFWRMVNICCKEGGLPVNKPRYVMGVGYSLDILVCVALGADMFDCVYPTRTGRFGCALVPWGSVLLSNASYKFDFNPIDKDCKCIACAKYTRAYLHTINGSPSFA-SLISIHNVAYMLNFMREMRSSIVADKFPEFCRDFFKRQYSKVEDYPQWALEALETVNIVI 1322
            L   ++A+C  S+AR   +TL       +  V+TPVFMPVGTQGTMKGIT EQ++E+  C++ LGNTYHLG RPGPE+++KA GLH FM W   LLTDSGGFQMVSL +LS VTEEGV F SP+D  ++LLTPE S+ IQN++G+DIMMQLDDV+SS   GPRVEEA +RS+RWLDRCI A+K P  Q LFAI+QGGL+ DLR  CL+ M +R   V GFA+GGLSGGEEK  FW+MV +      LP  KPRY+MGVGY++D++VCVALG DMFDCV+PTRT RFG ALVPWGS+ +    Y  DF PID DC+C  C +++RAYLH +  S + A   I+IHN++Y L  MR +R SI+  +FPEF R F +R +   E YP WA++AL +VNI +
Sbjct:   27 LALRILAECPVSKARACVLTL------PHGPVNTPVFMPVGTQGTMKGITVEQLEEL-GCQICLGNTYHLGMRPGPELIEKASGLHGFMNWRRNLLTDSGGFQMVSLVELSEVTEEGVMFRSPYDGKEILLTPEQSITIQNSLGSDIMMQLDDVVSSTVTGPRVEEAMHRSVRWLDRCIAANKNPDRQNLFAIIQGGLNADLRKACLDEMTKRD--VPGFAVGGLSGGEEKDDFWKMVTLSTDH--LPRGKPRYLMGVGYAVDLVVCVALGCDMFDCVFPTRTARFGSALVPWGSLQIKQKQYAKDFQPIDPDCQCATCKRHSRAYLHALFKSDTAAMHHITIHNISYQLTLMRSVRQSIIEQRFPEFVRSFMRRMFPSSEQYPSWAVDALASVNIAL 413          
BLAST of Queuine tRNA-ribosyltransferase catalytic subunit 1 vs. Ensembl Cavefish
Match: qtrt1 (queuine tRNA-ribosyltransferase catalytic subunit 1 [Source:NCBI gene;Acc:103032114])

HSP 1 Score: 428.328 bits (1100), Expect = 2.141e-147
Identity = 210/355 (59.15%), Postives = 262/355 (73.80%), Query Frame = 3
Query:  117 SSERTLECNLIAKCSTSRARVNKITLCGQSRNKNQIVDTPVFMPVGTQGTMKGITTEQMKEMFDCRLFLGNTYHLGHRPGPEIMKKAGGLHKFMKWDGGLLTDSGGFQMVSLAKLSYVTEEGVNFTSPHDESQMLLTPEHSMEIQNAIGADIMMQLDDVISSLTAGPRVEEATYRSIRWLDRCIEAHKRPQDQALFAIVQGGLSEDLRTKCLEMMLERQHMVGGFAIGGLSGGEEKASFWRMVNICCKEGGLPVNKPRYVMGVGYSLDILVCVALGADMFDCVYPTRTGRFGCALVPWGSVLLSNASYKFDFNPIDKDCKCIACAKYTRAYLHTINGSPSFA-SLISIHNVAYML 1178
            S    L   ++A+C  S+AR   +TL       +  V+TPVFMPVGTQGTMKGIT EQ++E+  C++ LGNTYHLG RPGPE+++KA GLH FM W   LLTDSGGFQMVSL +LS VTEEGV F SP+D  ++LLTPE S+ IQN++G+DIMMQLDDV+SS   GPRVEEA +RS+RWLDRCI A+K P  Q LFAI+QGGL+ DLR  CL+ M +R   V GFA+GGLSGGEEK  FW+MV +      LP  KPRY+MGVGY++D++VCVALG DMFDCV+PTRT RFG ALVPWGS+ +    Y  DF PID DC+C  C +++RAYLH +  S + A   I+IHN++Y +
Sbjct:   22 SHAAPLALRILAECPVSKARACVLTL------PHGPVNTPVFMPVGTQGTMKGITVEQLEEL-GCQICLGNTYHLGMRPGPELIEKASGLHGFMNWRRNLLTDSGGFQMVSLVELSEVTEEGVMFRSPYDGKEILLTPEQSITIQNSLGSDIMMQLDDVVSSTVTGPRVEEAMHRSVRWLDRCIAANKNPDRQNLFAIIQGGLNADLRKACLDEMTKRD--VPGFAVGGLSGGEEKDDFWKMVTLSTDH--LPRGKPRYLMGVGYAVDLVVCVALGCDMFDCVFPTRTARFGSALVPWGSLQIKQKQYAKDFQPIDPDCQCATCKRHSRAYLHALFKSDTAAMHHITIHNISYQV 365          
BLAST of Queuine tRNA-ribosyltransferase catalytic subunit 1 vs. Ensembl Cavefish
Match: qtrt2 (queuine tRNA-ribosyltransferase accessory subunit 2 [Source:NCBI gene;Acc:103043312])

HSP 1 Score: 101.679 bits (252), Expect = 6.865e-23
Identity = 78/296 (26.35%), Postives = 124/296 (41.89%), Query Frame = 3
Query:  513 QMLLTPEHSMEIQNAIGADIMMQLDD--VISSLTAGPRVEEATYRSIRWLDRCIEAHKRPQD--QA-LFAIVQGGLSEDLRTKCLEMMLERQHMVGGFAIGGLSGGEEKASFWRMVNICCKEGGLPVNKPRYVMGVGYSLDILVCVALGADMFDCVYPTRTGRFGCAL--------------VPWGSVLLSNAS-----------------------------YKFDFNPIDKDCKCIACAKYTRAYLHTINGSPSFAS--LISIHNVAYMLNFMREMRSSIVADKFPEFCRDFFK 1250
            +M LT    M +Q AI  D    + D     + T+  RV +A  R++  LD C+  H++ Q+  QA +F +V+GG   + R +      +R   V GF + G      K    R   I      LP  KPR + GVG   +++ CV +G D+F+  +P +    GCAL                  +VL SN                               Y+ D  P+ + C C  C  +TRAY+H +  +    +  L+ +HN A+ L F R +R ++  D+  +F R   +
Sbjct:  121 RMELTVAKFMALQAAIKPDFYQSMADGETWQANTSRKRVRKAVDRTLAHLDECLILHQKTQELKQAKIFGVVEGGNILEERVRSARETAKRP--VAGFVLDGFQSAAMKQDL-RSQLITAVTAELPQEKPRLLQGVGRPDEVIACVEVGVDLFEGFFPFQVTERGCALCFDCTVTTDPETAGTSPSTVLESNEERPVVEEPKENGDSCPENMTRFEMNLNDKRYREDLRPLVEGCSCYCCKNHTRAYIHHLLVTNELLAGVLLMLHNTAHYLRFFRALREALANDRLQDFKRRVLQ 413          
BLAST of Queuine tRNA-ribosyltransferase catalytic subunit 1 vs. Ensembl Cavefish
Match: qtrt2 (queuine tRNA-ribosyltransferase accessory subunit 2 [Source:NCBI gene;Acc:103043312])

HSP 1 Score: 74.3294 bits (181), Expect = 7.048e-14
Identity = 52/168 (30.95%), Postives = 80/168 (47.62%), Query Frame = 3
Query:  513 QMLLTPEHSMEIQNAIGADIMMQLDD--VISSLTAGPRVEEATYRSIRWLDRCIEAHKRPQD--QA-LFAIVQGGLSEDLRTKCLEMMLERQHMVGGFAIGGLSGGEEKASFWRMVNICCKEGGLPVNKPRYVMGVGYSLDILVCVALGADMFDCVYPTRTGRFGCAL 1001
            +M LT    M +Q AI  D    + D     + T+  RV +A  R++  LD C+  H++ Q+  QA +F +V+GG   + R +      +R   V GF + G      K    R   I      LP  KPR + GVG   +++ CV +G D+F+  +P +    GCAL
Sbjct:  121 RMELTVAKFMALQAAIKPDFYQSMADGETWQANTSRKRVRKAVDRTLAHLDECLILHQKTQELKQAKIFGVVEGGNILEERVRSARETAKRP--VAGFVLDGFQSAAMKQDL-RSQLITAVTAELPQEKPRLLQGVGRPDEVIACVEVGVDLFEGFFPFQVTERGCAL 285          
BLAST of Queuine tRNA-ribosyltransferase catalytic subunit 1 vs. Ensembl Sea Lamprey
Match: qtrt1 (queuine tRNA-ribosyltransferase 1 [Source:NCBI gene;Acc:393985])

HSP 1 Score: 452.21 bits (1162), Expect = 2.279e-157
Identity = 220/398 (55.28%), Postives = 281/398 (70.60%), Query Frame = 3
Query:  132 LECNLIAKCSTSRARVNKITLCGQSRNKNQIVDTPVFMPVGTQGTMKGITTEQMKEMFDCRLFLGNTYHLGHRPGPEIMKKAGGLHKFMKWDGGLLTDSGGFQMVSLAKLSYVTEEGVNFTSPHDESQMLLTPEHSMEIQNAIGADIMMQLDDVISSLTAGPRVEEATYRSIRWLDRCIEAHKRPQDQALFAIVQGGLSEDLRTKCLEMMLERQHMVGGFAIGGLSGGEEKASFWRMVNICCKEGGLPVNKPRYVMGVGYSLDILVCVALGADMFDCVYPTRTGRFGCALVPWGSVLLSNASYKFDFNPIDKDCKCIACAKYTRAYLHTI-NGSPSFASLISIHNVAYMLNFMREMRSSIVADKFPEFCRDFFKRQYSKVEDYPQWALEALETVNIVI 1322
            L   ++A+C  S AR   +         +  V  PVFMPVGTQGT+KG+T  Q++ +  C + LGNTYHL  RPGPE+++ A GLH FM W+  LLTDSGGFQMVSL +L+ VTEEGV F+SP+D   +LLTPE S+ IQN++G+DIMMQLDDV+SS   GPRVEEA +RS+RWLDRCI A+K P  Q LFAI+QGGL  DLR KCL+ M +R   V GFAIGGLSGGEEK  FWR V +  +   LP +KPRY+MGVGY+ D++VCVALG DMFDCV+PTRT RFG ALVP GS+ L N ++  DF PID  C C  C + +RA+LH +    P+    +++HN+AY L+ M  +R SIV  +FP+F R F  R+Y   + YP WA++AL +VNIV+
Sbjct:   16 LSLRVVAECRWSGARAATLV------APHGPVALPVFMPVGTQGTLKGLTARQLRRL-GCGICLGNTYHLAMRPGPELIEMAKGLHGFMDWERCLLTDSGGFQMVSLVELAEVTEEGVRFSSPYDGRHILLTPEASIHIQNSLGSDIMMQLDDVVSSTVTGPRVEEAMWRSVRWLDRCIAANKNPDSQNLFAIIQGGLDPDLRLKCLQEMSKRD--VPGFAIGGLSGGEEKQLFWRAVKLSTEH--LPRDKPRYLMGVGYATDLVVCVALGCDMFDCVFPTRTARFGSALVPSGSLQLKNKTFAKDFAPIDDQCTCPTCKRCSRAFLHALFRSDPAACHHVTVHNIAYQLSLMSAVRDSIVEQRFPDFVRGFMARRYGSRDAYPHWAVDALASVNIVL 402          
BLAST of Queuine tRNA-ribosyltransferase catalytic subunit 1 vs. Ensembl Nematostella
Match: EDO31230 (Queuine tRNA-ribosyltransferase [Source:UniProtKB/TrEMBL;Acc:A7SYI3])

HSP 1 Score: 502.671 bits (1293), Expect = 6.136e-177
Identity = 242/407 (59.46%), Postives = 303/407 (74.45%), Query Frame = 3
Query:   99 LFSREKSSERTLECNLIAKCSTSRARVNKITLCGQSRNKNQIVDTPVFMPVGTQGTMKGITTEQMKEMFDCRLFLGNTYHLGHRPGPEIMKKAGGLHKFMKWDGGLLTDSGGFQMVSLAKLSYVTEEGVNFTSPHDESQMLLTPEHSMEIQNAIGADIMMQLDDVISSLTAGPRVEEATYRSIRWLDRCIEAHKRPQDQALFAIVQGGLSEDLRTKCLEMMLERQHMVGGFAIGGLSGGEEKASFWRMVNICCKEGGLPVNKPRYVMGVGYSLDILVCVALGADMFDCVYPTRTGRFGCALVPWGSVLLSNASYKFDFNPIDKDCKCIACAKYTRAYLHTINGSPSFA-SLISIHNVAYMLNFMREMRSSIVADKFPEFCRDFFKRQYSKVEDYPQWALEALETVNI 1316
            +  ++K+ E  L   ++A+CST++AR   +TL       +  V+TPVFMPVGTQGTMKG+T  Q++++ DC++ LGNTYHLG RPG E + KAGGLH FM W   LLTDSGGFQMVSL KLS +TEEGV F SPHD  ++LLTPE SMEIQN+IGADIMMQLDDV+SS T GPRVEEA +RSIRWLDRCI +HKR ++Q LFAI+QGGL  +LR +C+E M++R     G AIGGLSGGEEK  FWR V +C   G LP NKPRYVMGVGY++D++VC ALGADM+DCVYPTRT RFG ALVPWG + L    +  D  PID DC C  CA++TRA+L+++ G  S A   I+IHN++Y +  MR +R SI ADKFP+F RDF +R Y + E YP+W ++AL + NI
Sbjct:    1 MADKQKTRESALTFKILAECSTTKARTGILTL------PHHRVETPVFMPVGTQGTMKGLTCSQLEDL-DCQIILGNTYHLGMRPGTETLDKAGGLHGFMNWKRALLTDSGGFQMVSLIKLSEITEEGVKFQSPHDGKELLLTPEKSMEIQNSIGADIMMQLDDVVSSTTKGPRVEEAMWRSIRWLDRCIASHKRTKEQNLFAIIQGGLDTELRKQCVEEMVKRD--TPGIAIGGLSGGEEKDQFWRTVTLCT--GLLPRNKPRYVMGVGYAVDLVVCCALGADMYDCVYPTRTARFGTALVPWGQLHLKKKQFSSDIRPIDPDCTCSTCARHTRAFLNSLLGRESVACHYITIHNISYQMQLMRGIRESIKADKFPQFVRDFMRRMYPEGE-YPKWVVDALLSANI 395          
BLAST of Queuine tRNA-ribosyltransferase catalytic subunit 1 vs. Ensembl Nematostella
Match: EDO27349 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T9H6])

HSP 1 Score: 286.96 bits (733), Expect = 4.145e-95
Identity = 138/219 (63.01%), Postives = 170/219 (77.63%), Query Frame = 3
Query:   99 LFSREKSSERTLECNLIAKCSTSRARVNKITLCGQSRNKNQIVDTPVFMPVGTQGTMKGITTEQMKEMFDCRLFLGNTYHLGHRPGPEIMKKAGGLHKFMKWDGGLLTDSGGFQMVSLAKLSYVTEEGVNFTSPHDESQMLLTPEHSMEIQNAIGADIMMQLDDVISSLTAGPRVEEATYRSIRWLDRCIEAHKRPQDQALFAIVQGGLSEDLRTKCLE 755
            +  ++K+ E  L   +IA+CST++AR   +TL       +  V+TPVFMPVGTQGTMKG+T  Q++++ DC++ LGNTYHLG RPG E + KAGGLH FM W   LLTDSGGFQMVSL KLS +TEEGV F SPHD  ++LLTPE SMEIQN+IGADIMMQLDDV+SS T GPRVEEA +RSIRWLDRCI +HKR ++Q LFAI+QGGL  +LR +C+E
Sbjct:    1 MADKQKTRESALTFKIIAECSTTKARTGILTL------PHYRVETPVFMPVGTQGTMKGLTCSQLEDL-DCQIILGNTYHLGMRPGTETLDKAGGLHGFMNWKRALLTDSGGFQMVSLIKLSEITEEGVKFQSPHDGKELLLTPEKSMEIQNSIGADIMMQLDDVVSSTTKGPRVEEAMWRSIRWLDRCIASHKRTKEQNLFAIIQGGLDTELRKQCVE 212          
BLAST of Queuine tRNA-ribosyltransferase catalytic subunit 1 vs. Ensembl Nematostella
Match: EDO31231 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SYI4])

HSP 1 Score: 141.354 bits (355), Expect = 1.999e-40
Identity = 70/124 (56.45%), Postives = 91/124 (73.39%), Query Frame = 3
Query:  108 REKSSERTLECNLIAKCSTSRARVNKITLCGQSRNKNQIVDTPVFMPVGTQGTMKGITTEQMKEMFDCRLFLGNTYHLGHRPGPEIMKKAGGLHKFMKWDGGLLTDSGGFQMVSLAKLSYVTEE 479
            ++K+ E  L   ++A+CST++AR   +TL       +  V+TPVFMPVGTQGTMKG+T  Q++++ DC++ LGNTYHLG RPG E + KAGGLH FM W   LLTDSGGFQMVSL KLS +TE+
Sbjct:    4 KQKTRESALTFKILAECSTTKARTGILTL------PHHRVETPVFMPVGTQGTMKGLTCSQLEDL-DCQIILGNTYHLGMRPGTETLDKAGGLHGFMNWKRALLTDSGGFQMVSLIKLSEITEK 120          
BLAST of Queuine tRNA-ribosyltransferase catalytic subunit 1 vs. Ensembl Medaka
Match: qtrt1 (queuine tRNA-ribosyltransferase catalytic subunit 1 [Source:NCBI gene;Acc:101166387])

HSP 1 Score: 481.485 bits (1238), Expect = 4.189e-168
Identity = 231/403 (57.32%), Postives = 292/403 (72.46%), Query Frame = 3
Query:  117 SSERTLECNLIAKCSTSRARVNKITLCGQSRNKNQIVDTPVFMPVGTQGTMKGITTEQMKEMFDCRLFLGNTYHLGHRPGPEIMKKAGGLHKFMKWDGGLLTDSGGFQMVSLAKLSYVTEEGVNFTSPHDESQMLLTPEHSMEIQNAIGADIMMQLDDVISSLTAGPRVEEATYRSIRWLDRCIEAHKRPQDQALFAIVQGGLSEDLRTKCLEMMLERQHMVGGFAIGGLSGGEEKASFWRMVNICCKEGGLPVNKPRYVMGVGYSLDILVCVALGADMFDCVYPTRTGRFGCALVPWGSVLLSNASYKFDFNPIDKDCKCIACAKYTRAYLHTINGSPSFA-SLISIHNVAYMLNFMREMRSSIVADKFPEFCRDFFKRQYSKVEDYPQWALEALETVNIVI 1322
            S+   L   ++A+C  ++AR   +TL       +  V+TPVFMPVGTQGT+KGIT +Q+ E   C++ LGNTYHLG RPGP+++ KA GLH FM W   LLTDSGGFQMVSL +LS VTEEGVNF SP+D  ++LL+PE S+ IQN++G+DIMMQLDDV+SS   GPRVEEA +RSIRWLDRCI A+K P  Q LFAI+QGGL  +LR  CL+ M +R   V GFAIGGLSGGEEK  FWRMV +      LP  KPRY+MGVGY++D++VCVALG DMFDCV+PTRT RFG ALVPWGS+ +    Y  DF PID DC C  C +++RAYLH +  S + A   +++HN+AY L+ MR +R SIV  +FPEF R F KR +   +DYP WA++AL +VN+ +
Sbjct:    8 SAASPLTLRIVAECPVTKARACDLTL------PHCTVNTPVFMPVGTQGTLKGITVDQL-ESLGCQICLGNTYHLGMRPGPDLIVKAKGLHGFMNWKRNLLTDSGGFQMVSLVELSEVTEEGVNFKSPYDGKEILLSPEKSISIQNSLGSDIMMQLDDVVSSTVKGPRVEEAMHRSIRWLDRCIAANKNPDKQNLFAIIQGGLDAELRKACLKEMTQRD--VSGFAIGGLSGGEEKNDFWRMVTLSTDH--LPQEKPRYLMGVGYAVDLVVCVALGCDMFDCVFPTRTARFGSALVPWGSLQVKQKQYAKDFLPIDPDCHCPTCKRHSRAYLHALFKSDTAAMHHVTVHNIAYQLSLMRSVRQSIVEGRFPEFIRTFMKRMFPSRDDYPGWAVDALASVNVTL 399          
BLAST of Queuine tRNA-ribosyltransferase catalytic subunit 1 vs. Ensembl Medaka
Match: qtrt1 (queuine tRNA-ribosyltransferase catalytic subunit 1 [Source:NCBI gene;Acc:101166387])

HSP 1 Score: 428.713 bits (1101), Expect = 1.167e-147
Identity = 212/383 (55.35%), Postives = 270/383 (70.50%), Query Frame = 3
Query:   90 NKILFSREKSSERTLECNLIAKCSTSRARVNKITLCGQSRNKNQIVDTPVFMPVGTQGTMKGITTEQMKEMFDCRLFLGNTYHLGHRPGPEIMKKAGGLHKFMKWDGGLLTDSGGFQMVSLAKLSYVTEEGVNFTSPHDESQMLLTPEHSMEIQNAIGADIMMQLDDVISSLTAGPRVEEATYRSIRWLDRCIEAHKRPQDQALFAIVQGGLSEDLRTKCLEMMLERQHMVGGFAIGGLSGGEEKASFWRMVNICCKEGGLPVNKPRYVMGVGYSLDILVCVALGADMFDCVYPTRTGRFGCALVPWGSVLLSNASYKFDFNPIDKDCKCIACAKYTRAYLHTINGSPSFA-SLISIHNVAYMLNFMREMRSSIVADKFPEFC 1235
            N +   +  S+   L   ++A+C  ++AR   +TL       +  V+TPVFMPVGTQGT+KGIT +Q+ E   C++ LGNTYHLG RPGP+++ KA GLH FM W   LLTDSGGFQMVSL +LS VTEEGVNF SP+D  ++LL+PE S+ IQN++G+DIMMQLDDV+SS   GPRVEEA +RSIRWLDRCI A+K P  Q LFAI+QGGL  +LR  CL+ M +R   V GFAIGGLSGGEEK  FWRMV +      LP  KPRY+MGVGY++D++VCVALG DMFDCV+PTRT RFG ALVPWGS+ +    Y  DF PID DC C  C +++RAYLH +  S + A   +++HN+AY ++  + +   I   K  +FC
Sbjct:   16 NSMSLQKALSAASPLTLRIVAECPVTKARACDLTL------PHCTVNTPVFMPVGTQGTLKGITVDQL-ESLGCQICLGNTYHLGMRPGPDLIVKAKGLHGFMNWKRNLLTDSGGFQMVSLVELSEVTEEGVNFKSPYDGKEILLSPEKSISIQNSLGSDIMMQLDDVVSSTVKGPRVEEAMHRSIRWLDRCIAANKNPDKQNLFAIIQGGLDAELRKACLKEMTQRD--VSGFAIGGLSGGEEKNDFWRMVTLSTDH--LPQEKPRYLMGVGYAVDLVVCVALGCDMFDCVFPTRTARFGSALVPWGSLQVKQKQYAKDFLPIDPDCHCPTCKRHSRAYLHALFKSDTAAMHHVTVHNIAYQVSDGKHL---IKLAKLFKFC 384          
BLAST of Queuine tRNA-ribosyltransferase catalytic subunit 1 vs. Ensembl Medaka
Match: qtrt2 (queuine tRNA-ribosyltransferase accessory subunit 2 [Source:NCBI gene;Acc:101162962])

HSP 1 Score: 92.8189 bits (229), Expect = 5.691e-20
Identity = 67/252 (26.59%), Postives = 107/252 (42.46%), Query Frame = 3
Query:  606 TAGPRVEEATYRSIRWLDRCIEAHKRPQDQ---ALFAIVQGGLSEDLRTKCLEMMLERQHMVGGFAIGGLSGGEEKASFWRMVNICCKEGGLPVNKPRYVMGVGYSLDILVCVALGADMFDCVYPTRTGRFGCALV--------PWGSVL---------------------------------LSNASYKFDFNPIDKDCKCIACAKYTRAYLHTINGSPSFAS--LISIHNVAYMLNFMREMRSSIVADKF 1223
            T+  R+ ++  R++ +LD C+  H++ QD     LF +V+GG   + R +      +R   V GF + GL  G    +  R   I      LP +KPR + GVG   ++L CV  G D+F+  +P +    GCAL         P  +VL                                 L +  Y+ DF  + + C C  C  + RAYLH +  +    +  L+ IHN+ +  NF   +R ++  DK 
Sbjct:  155 TSRKRIRKSVDRTLAYLDECLLVHQKSQDLDGVELFGVVEGGDVMEERVRSARETAKRP--VAGFCLDGLQTGSVDQAL-RTQLITSMTTELPEDKPRLLQGVGRPDEVLACVEAGVDLFEGFFPFQVTERGCALCFNYDVSPDPECAVLELNEEKHSAGDNMQPKGDLNCEDQTQMTSFEMNLKDKRYQDDFKSLVEGCGCYCCKNHQRAYLHHLLVTNELLAGVLLMIHNMTHYQNFFGAVREALATDKM 403          
BLAST of Queuine tRNA-ribosyltransferase catalytic subunit 1 vs. Planmine SMEST
Match: SMESG000001252.1 (SMESG000001252.1)

HSP 1 Score: 879.782 bits (2272), Expect = 0.000e+0
Identity = 419/419 (100.00%), Postives = 419/419 (100.00%), Query Frame = 3
Query:   66 MSSIDRSVNKILFSREKSSERTLECNLIAKCSTSRARVNKITLCGQSRNKNQIVDTPVFMPVGTQGTMKGITTEQMKEMFDCRLFLGNTYHLGHRPGPEIMKKAGGLHKFMKWDGGLLTDSGGFQMVSLAKLSYVTEEGVNFTSPHDESQMLLTPEHSMEIQNAIGADIMMQLDDVISSLTAGPRVEEATYRSIRWLDRCIEAHKRPQDQALFAIVQGGLSEDLRTKCLEMMLERQHMVGGFAIGGLSGGEEKASFWRMVNICCKEGGLPVNKPRYVMGVGYSLDILVCVALGADMFDCVYPTRTGRFGCALVPWGSVLLSNASYKFDFNPIDKDCKCIACAKYTRAYLHTINGSPSFASLISIHNVAYMLNFMREMRSSIVADKFPEFCRDFFKRQYSKVEDYPQWALEALETVNIVI 1322
            MSSIDRSVNKILFSREKSSERTLECNLIAKCSTSRARVNKITLCGQSRNKNQIVDTPVFMPVGTQGTMKGITTEQMKEMFDCRLFLGNTYHLGHRPGPEIMKKAGGLHKFMKWDGGLLTDSGGFQMVSLAKLSYVTEEGVNFTSPHDESQMLLTPEHSMEIQNAIGADIMMQLDDVISSLTAGPRVEEATYRSIRWLDRCIEAHKRPQDQALFAIVQGGLSEDLRTKCLEMMLERQHMVGGFAIGGLSGGEEKASFWRMVNICCKEGGLPVNKPRYVMGVGYSLDILVCVALGADMFDCVYPTRTGRFGCALVPWGSVLLSNASYKFDFNPIDKDCKCIACAKYTRAYLHTINGSPSFASLISIHNVAYMLNFMREMRSSIVADKFPEFCRDFFKRQYSKVEDYPQWALEALETVNIVI
Sbjct:    1 MSSIDRSVNKILFSREKSSERTLECNLIAKCSTSRARVNKITLCGQSRNKNQIVDTPVFMPVGTQGTMKGITTEQMKEMFDCRLFLGNTYHLGHRPGPEIMKKAGGLHKFMKWDGGLLTDSGGFQMVSLAKLSYVTEEGVNFTSPHDESQMLLTPEHSMEIQNAIGADIMMQLDDVISSLTAGPRVEEATYRSIRWLDRCIEAHKRPQDQALFAIVQGGLSEDLRTKCLEMMLERQHMVGGFAIGGLSGGEEKASFWRMVNICCKEGGLPVNKPRYVMGVGYSLDILVCVALGADMFDCVYPTRTGRFGCALVPWGSVLLSNASYKFDFNPIDKDCKCIACAKYTRAYLHTINGSPSFASLISIHNVAYMLNFMREMRSSIVADKFPEFCRDFFKRQYSKVEDYPQWALEALETVNIVI 419          
The following BLAST results are available for this feature:
BLAST of Queuine tRNA-ribosyltransferase catalytic subunit 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
QTRT15.886e-16458.48queuine tRNA-ribosyltransferase catalytic subunit ... [more]
QTRT17.115e-6858.82queuine tRNA-ribosyltransferase catalytic subunit ... [more]
QTRT13.465e-6663.10queuine tRNA-ribosyltransferase catalytic subunit ... [more]
QTRT11.474e-5061.43queuine tRNA-ribosyltransferase catalytic subunit ... [more]
QTRT15.122e-3848.18queuine tRNA-ribosyltransferase catalytic subunit ... [more]
back to top
BLAST of Queuine tRNA-ribosyltransferase catalytic subunit 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
tgt-11.420e-13954.76Queuine tRNA-ribosyltransferase catalytic subunit ... [more]
tgt-23.675e-824.89Queuine tRNA-ribosyltransferase accessory subunit ... [more]
back to top
BLAST of Queuine tRNA-ribosyltransferase catalytic subunit 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Tgt1.948e-17060.10gene:FBgn0031321 transcript:FBtr0077971[more]
CG34344.546e-1725.91gene:FBgn0036000 transcript:FBtr0076473[more]
back to top
BLAST of Queuine tRNA-ribosyltransferase catalytic subunit 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
qtrt14.830e-17158.06queuine tRNA-ribosyltransferase 1 [Source:NCBI gen... [more]
qtrt27.965e-2325.85queuine tRNA-ribosyltransferase accessory subunit ... [more]
qtrt28.212e-2325.85queuine tRNA-ribosyltransferase accessory subunit ... [more]
qtrt28.826e-2325.85queuine tRNA-ribosyltransferase accessory subunit ... [more]
back to top
BLAST of Queuine tRNA-ribosyltransferase catalytic subunit 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
qtrt16.951e-15957.61queuine tRNA-ribosyltransferase 1 [Source:NCBI gen... [more]
qtrt11.448e-15858.61queuine tRNA-ribosyltransferase 1 [Source:NCBI gen... [more]
qtrt14.174e-13752.03queuine tRNA-ribosyltransferase 1 [Source:NCBI gen... [more]
qtrt13.215e-13652.03queuine tRNA-ribosyltransferase 1 [Source:NCBI gen... [more]
qtrt24.169e-1229.48queuine tRNA-ribosyltransferase accessory subunit ... [more]
back to top
BLAST of Queuine tRNA-ribosyltransferase catalytic subunit 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Qtrt11.228e-15957.22queuine tRNA-ribosyltransferase catalytic subunit ... [more]
Qtrt17.608e-2238.74queuine tRNA-ribosyltransferase catalytic subunit ... [more]
Qtrt24.051e-1723.73queuine tRNA-ribosyltransferase accessory subunit ... [more]
Qtrt23.153e-1322.65queuine tRNA-ribosyltransferase accessory subunit ... [more]
back to top
BLAST of Queuine tRNA-ribosyltransferase catalytic subunit 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q28HC6|TGT_XENTR3.166e-17060.15Queuine tRNA-ribosyltransferase catalytic subunit ... [more]
sp|Q9VPY8|TGT_DROME1.953e-16960.10Queuine tRNA-ribosyltransferase catalytic subunit ... [more]
sp|Q4QQY7|TGT_XENLA2.597e-16859.49Queuine tRNA-ribosyltransferase catalytic subunit ... [more]
sp|Q7SYK1|TGT_DANRE1.326e-16457.82Queuine tRNA-ribosyltransferase catalytic subunit ... [more]
sp|Q9BXR0|TGT_HUMAN2.827e-16358.48Queuine tRNA-ribosyltransferase catalytic subunit ... [more]
back to top
BLAST of Queuine tRNA-ribosyltransferase catalytic subunit 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2C9JMJ71.904e-17460.25Queuine tRNA-ribosyltransferase catalytic subunit ... [more]
R7VA282.543e-17460.25Queuine tRNA-ribosyltransferase catalytic subunit ... [more]
A0A1S3H8H33.635e-17459.80Queuine tRNA-ribosyltransferase catalytic subunit ... [more]
A0A4P9YFZ01.594e-17358.60Queuine tRNA-ribosyltransferase (Fragment) OS=Roze... [more]
A0A1S3JXL23.882e-17359.55Queuine tRNA-ribosyltransferase catalytic subunit ... [more]
back to top
BLAST of Queuine tRNA-ribosyltransferase catalytic subunit 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
qtrt11.069e-16958.29queuine tRNA-ribosyltransferase catalytic subunit ... [more]
qtrt12.141e-14759.15queuine tRNA-ribosyltransferase catalytic subunit ... [more]
qtrt26.865e-2326.35queuine tRNA-ribosyltransferase accessory subunit ... [more]
qtrt27.048e-1430.95queuine tRNA-ribosyltransferase accessory subunit ... [more]
back to top
BLAST of Queuine tRNA-ribosyltransferase catalytic subunit 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
qtrt12.279e-15755.28queuine tRNA-ribosyltransferase 1 [Source:NCBI gen... [more]
back to top
BLAST of Queuine tRNA-ribosyltransferase catalytic subunit 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Queuine tRNA-ribosyltransferase catalytic subunit 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO312306.136e-17759.46Queuine tRNA-ribosyltransferase [Source:UniProtKB... [more]
EDO273494.145e-9563.01Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO312311.999e-4056.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Queuine tRNA-ribosyltransferase catalytic subunit 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
qtrt14.189e-16857.32queuine tRNA-ribosyltransferase catalytic subunit ... [more]
qtrt11.167e-14755.35queuine tRNA-ribosyltransferase catalytic subunit ... [more]
qtrt25.691e-2026.59queuine tRNA-ribosyltransferase accessory subunit ... [more]
back to top
BLAST of Queuine tRNA-ribosyltransferase catalytic subunit 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000001252.10.000e+0100.00SMESG000001252.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30027908 ID=SMED30027908|Name=Queuine tRNA-ribosyltransferase catalytic subunit 1|organism=Schmidtea mediterranea sexual|type=transcript|length=1525bp
GTCATTTTAAAAACTTTTCTCAATTTTAGATTACATTGACTAACATTAAA
CAGATTTTCAAGAAGATGTCTTCAATCGATAGAAGTGTTAATAAAATATT
ATTTTCACGTGAAAAGTCTTCTGAAAGAACACTAGAATGTAATTTGATTG
CCAAATGTTCAACTAGTCGCGCCAGAGTAAATAAAATTACTCTTTGTGGT
CAAAGTCGCAACAAAAATCAAATTGTTGATACCCCAGTATTTATGCCAGT
AGGAACGCAGGGTACAATGAAAGGTATTACCACTGAACAAATGAAAGAAA
TGTTTGACTGCAGATTATTTTTGGGAAATACATATCATTTAGGTCACCGA
CCAGGACCTGAAATAATGAAAAAAGCTGGAGGTTTGCATAAATTTATGAA
ATGGGATGGTGGTTTATTAACTGATAGTGGAGGGTTTCAAATGGTGTCGT
TGGCAAAATTGTCTTATGTTACCGAAGAGGGAGTAAATTTTACTTCTCCA
CATGATGAAAGTCAAATGCTATTAACCCCTGAACATTCAATGGAAATTCA
AAATGCAATAGGAGCAGACATTATGATGCAATTAGACGACGTAATTTCTT
CTCTAACCGCCGGCCCTCGCGTTGAAGAAGCAACTTATCGATCAATTCGT
TGGTTAGATAGATGCATTGAAGCACATAAACGCCCACAAGACCAAGCCTT
ATTTGCAATTGTTCAAGGAGGATTATCAGAAGATTTAAGAACAAAATGTT
TAGAAATGATGCTTGAAAGACAACACATGGTCGGAGGATTTGCAATTGGT
GGTCTTAGCGGAGGAGAGGAAAAGGCTTCGTTTTGGAGAATGGTGAATAT
CTGCTGCAAGGAAGGAGGTCTTCCAGTCAATAAGCCGCGATATGTGATGG
GAGTGGGATATTCACTGGATATTTTGGTCTGTGTGGCTTTAGGAGCTGAT
ATGTTCGATTGCGTTTATCCTACTCGCACTGGTAGATTCGGTTGCGCACT
TGTTCCCTGGGGCAGTGTCCTCCTTTCTAATGCATCGTACAAATTCGATT
TCAACCCGATAGATAAGGATTGCAAATGTATCGCCTGTGCCAAATACACG
AGAGCCTATCTCCATACTATCAATGGCAGCCCGTCTTTCGCGAGTTTGAT
CAGTATTCACAATGTTGCCTACATGTTAAACTTTATGCGGGAAATGAGAT
CTTCAATAGTCGCCGATAAATTTCCAGAGTTTTGTCGCGATTTCTTCAAA
CGTCAGTATTCAAAAGTTGAAGATTATCCACAATGGGCATTGGAAGCCTT
GGAAACTGTGAATATTGTTATATGAATACAATTTTTGGTGATTTTGGCAA
TCTATGTAATTAATCAATAAAAATAATGATCGGATATTAAATATTCCAGC
TGCACCTATAAGATCTGATAAAATCAATACGAGTAGTAAAATCACAATTT
TGGATGAAATCCAATAATTTTTTGTTCGTTTGAATGAAGTTGTTTTTATT
TCATTTTTTGTTTGTTTAAATGATG
back to top

protein sequence of SMED30027908-orf-1

>SMED30027908-orf-1 ID=SMED30027908-orf-1|Name=SMED30027908-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=420bp
MSSIDRSVNKILFSREKSSERTLECNLIAKCSTSRARVNKITLCGQSRNK
NQIVDTPVFMPVGTQGTMKGITTEQMKEMFDCRLFLGNTYHLGHRPGPEI
MKKAGGLHKFMKWDGGLLTDSGGFQMVSLAKLSYVTEEGVNFTSPHDESQ
MLLTPEHSMEIQNAIGADIMMQLDDVISSLTAGPRVEEATYRSIRWLDRC
IEAHKRPQDQALFAIVQGGLSEDLRTKCLEMMLERQHMVGGFAIGGLSGG
EEKASFWRMVNICCKEGGLPVNKPRYVMGVGYSLDILVCVALGADMFDCV
YPTRTGRFGCALVPWGSVLLSNASYKFDFNPIDKDCKCIACAKYTRAYLH
TINGSPSFASLISIHNVAYMLNFMREMRSSIVADKFPEFCRDFFKRQYSK
VEDYPQWALEALETVNIVI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR036511TGT-like_sf
IPR004803TGT
IPR002616tRNA_ribo_trans-like
Vocabulary: biological process
TermDefinition
GO:0006400tRNA modification
GO:0008616queuosine biosynthetic process
GO:0008033tRNA processing
GO:0101030tRNA-guanine transglycosylation
Vocabulary: molecular function
TermDefinition
GO:0008479queuine tRNA-ribosyltransferase activity
GO:0016740transferase activity
GO:0016757transferase activity, transferring glycosyl groups
GO:0016763transferase activity, transferring pentosyl groups
GO:0042803protein homodimerization activity
GO:0046872metal ion binding
GO:0046982protein heterodimerization activity
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005739mitochondrion
GO:0005741mitochondrial outer membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR036511Queuine tRNA-ribosyltransferase-likeGENE3DG3DSA:3.20.20.105coord: 14..402
e-value: 6.4E-144
score: 481.4
IPR036511Queuine tRNA-ribosyltransferase-likeSUPERFAMILYSSF51713tRNA-guanine transglycosylasecoord: 27..396
IPR002616tRNA-guanine(15) transglycosylase-likeTIGRFAMTIGR00449TIGR00449coord: 49..399
e-value: 2.8E-114
score: 379.8
IPR002616tRNA-guanine(15) transglycosylase-likePFAMPF01702TGTcoord: 36..398
e-value: 1.1E-135
score: 452.3
IPR004803tRNA-guanine transglycosylaseTIGRFAMTIGR00430TIGR00430coord: 45..399
e-value: 6.4E-119
score: 395.1
NoneNo IPR availablePANTHERPTHR43530FAMILY NOT NAMEDcoord: 24..418